ML17263A833: Difference between revisions

From kanterella
Jump to navigation Jump to search
(Created page by program invented by StriderTol)
(Created page by program invented by StriderTol)
Line 17: Line 17:


=Text=
=Text=
{{#Wiki_filter:AttachmBllDNawÃI0'oOMCl0'o'4Ul4QwO~DOOUMV-R.E.GinnaEmergency ActionLevelsAnnotated Classification CriteriaBasedonResponsetoNRCRAlsCategory1.0CSFSTStatusCategory2.0-ReactorFuelCategory3.0Category4.0Category5.0Category6.0Category7.0Category8.0Category9.0ReactorCoolantSystemContainment Radioactivity ReleaseElectrical FailuresEquipment FailuresHazardsOther R.E.GinnaEmergency ActionLevelsProposedRevision19BasedonResponsetoNRCRAIsCategory1.0Category2.00Category3.0Category4.0Category5.0Category6.0Category7.0Category8.0Category9.0CSFSTStatusReactorFuelReactorCoolantSystemContainment Radioactivity ReleaseElecrtical FailuresEquipment Failures-HazardsOther10/11/94 1.0CSFSTStatus1.1Subcriticality 1.1.1Alert[SA2]ORANGEorREDpathF-0.1SUBCRITICALITY ANDEmergency borationisrequiredPowerOperations, HotShutdownCatego.0CSFSTStatus1.0CSFSTStatus12CoreCooling1.2.1SiteAreaEmergency
{{#Wiki_filter:Attachm B ll DN aw&#xc3;I 0'o OM Cl 0'o'4 Ul4 Qw O~DOO UMV-R.E.Ginna Emergency Action Levels Annotated Classification Criteria Based on Response to NRC RAls Category 1.0 CSFST Status Category 2.0-Reactor Fuel Category 3.0 Category 4.0 Category 5.0 Category 6.0 Category 7.0 Category 8.0 Category 9.0 Reactor Coolant System Containment Radioactivity Release Electrical Failures Equipment Failures Hazards Other R.E.Ginna Emergency Action Levels Proposed Revision 19 Based on Response to NRC RAIs Category 1.0 Category 2.0 0 Category 3.0 Category 4.0 Category 5.0 Category 6.0 Category 7.0 Category 8.0 Category 9.0 CSFST Status Reactor Fuel Reactor Coolant System Containment Radioactivity Release Elecrtical Failures Equipment Failures-Hazards Other 10/11/94 1.0 CSFST Status 1.1 Subcriticality 1.1.1 Alert[SA2]ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required Power Operations, Hot Shutdown Cate go.0 CSFST Status 1.0 CSFST Status 12 Core Cooling 1.2.1 Site Area Emergency[fpl/fl, rl][SS4]ORANGE or RED path in F-0.2, CORE COOLING Power Operations, Hot Shutdown 1.2.2 General Emergency[fl, rl, cpl]1.1.2 Site Area Emergency[SS2]RED path in F-0.1 SUBCRITICALITY AND either: Emergency boration is inoperable OR Power range not<6%within 15 min.of initiation of emergency boration Power Operations, Hot Shutdown RED path in F~-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.Power Operations, Hot Shutdown 1.1.3 General Emergency[SG2]RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either: RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown 1-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 1.0 CSFST Status 13 Heat Sink 1.3.1 Site Area Emergency[fpl, rpl][SS4]RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown Catego.0 CSFST Status 1.0 CSFST Status 1.4 Integrity 1.4.1 Alert[rpl]RED path on F-0.4, INTEGRITY Power Operations, Hot Shutdown 1-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 CSFST Status 1.0 CSFST Status 1.5 Containment 1.5.1 General Emergency[6, rl, cpl]RED path F-0.5, CONTAINMENT resulting from loss of reactor coolant Power Operations, Hot Shutdown 1-4 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Reactor Fuel 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.1 Unusual Event[SU4]Coolant sample activity:>100%%uo of 84/E bar pCi/cc total specific activity OR>0.2 pCi/cc I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded All 2.1.2 Alert[0]Coolant activity>300 pCi/cc I-131 equivalent Power operation, hot shutdown 2.1.3 Site Area Emergency[fi.rpl/rl]Coolant activity>300 pCi/cc I-131 equivalent and any of the following:
[fpl/fl,rl][SS4]ORANGEorREDpathinF-0.2,CORECOOLINGPowerOperations, HotShutdown1.2.2GeneralEmergency
~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling
[fl,rl,cpl]1.1.2SiteAreaEmergency
<EOP Fig.MIN SUBCOOLING due to RCS leakage~Containment radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.1 Unusual Event[SU4]Letdown Line Monitor R-9>2 R/hr All 2.2.2 Alert Letdown Line Monitor R-9>10 R/hr Power operation, hot shutdown 2.2.3 Site Area Emergency[fl, rpl]Letdown Line Monitor R-9>10 R/hr and any of the following:
[SS2]REDpathinF-0.1SUBCRITICALITY ANDeither:Emergency borationisinoperable ORPowerrangenot<6%within15min.ofinitiation ofemergency borationPowerOperations, HotShutdownREDpathinF~-0.2,CORECOOLINGANDFunctional restoration procedures noteffective within15min.PowerOperations, HotShutdown1.1.3GeneralEmergency
~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling
[SG2]REDpathinF-0.1,SUBCRITICALITY ANDActualorimminententryintoeither:REDpathinF-0.2,CORECOOLINGORREDpathinF-0.3,HEATSINKPowerOperations, HotShutdown1-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 1.0CSFSTStatus13HeatSink1.3.1SiteAreaEmergency
<EOP Fig.MIN SUBCOOLING due to RCS leakage~Containment*radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Cate go.0 Reactor Fuel 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2.3.2 Site Area Emergency[fl, rl]Containment radiation monitor R-29/R-30 reading>100 R/hr Power operation, hot shutdown 2.8.3 General Emergency[fl, rl, cpl]Containment radiation monitor R-29/R-30 reading>1000 R/hr 2.0 Reactor Fuel 2.4 Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event[AU2]Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint All 2.4.2 Alert[AA2]Con6rmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:~R-2 Containment Area Monitor~R-5 Spent Fuel Pit~R-12 Containment Noble Gas Power operation, hot shutdown 2.4.8 Alert[AA2]Report of visual observation of irradiated fuel uncovered All 2-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot, loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0-Reactor Coolant System 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.1 Unusual Event[SU5]3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.1 Unusual Event[cl]Unidentified or pressure boundary leakage>10 gpm OR Identified leakage>25 gpm Power operation, hot shutdown 3.1.2 Alert[rpl]Primary system leakage>46 gpm Power operation, hot shutdown Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator Power operation, hot shutdown 1 3.2.2 Site Area Emergency[rpl, cl]Unisolable release of secondary side to atmosphere with primary to secondary leakage>46 gpm Power operation, hot shutdown 3.1.3 Site Area Emergency[fpl, rl][SS5]3.2.3 Site Area Emergency[fl,cl]RVLIS cannot be maintained
[fpl,rpl][SS4]REDpathinF-0.3,HEATSINKPowerOperations, HotShutdownCatego.0CSFSTStatus1.0CSFSTStatus1.4Integrity 1.4.1Alert[rpl]REDpathonF-0.4,INTEGRITY PowerOperations, HotShutdown1-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0CSFSTStatus1.0CSFSTStatus1.5Containment 1.5.1GeneralEmergency
>43%with no RCPs running OR With the reactor vessel head removed, it is reported that water level in the reactor vessel is dropping in an.uncontrolled manner and core uncovery is likely.Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator AND Either: Coolant activity>300 pCi/cc of I-131 OR Letdown Line Monitor R-9>10 8/hr All Power operation, hot shutdown 3-1 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0 Reactor Coolant System 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert[rl]RCS subcooling
[6,rl,cpl]REDpathF-0.5,CONTAINMENT resulting fromlossofreactorcoolantPowerOperations, HotShutdown1-4fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0ReactorFuel2.0ReactorFuel2.1CoolantActivity2.1.1UnusualEvent[SU4]Coolantsampleactivity:
<EOP Fig.MIN SUBCOOLING due to RCS leakage Power operation, hot shutdown 3-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 4.0 Containment
>100%%uoof84/EbarpCi/cctotalspecificactivityOR>0.2pCi/ccI-131equivalent andtheconditions ofTechnical Specifications 3.1.4.3.b areexceededAll2.1.2Alert[0]Coolantactivity>300pCi/ccI-131equivalent Poweroperation, hotshutdown2.1.3SiteAreaEmergency
[fi.rpl/rl]Coolantactivity>300pCi/ccI-131equivalent andanyofthefollowing:
~REDpathonF-0.4,INTEGRITY
~Primarysystemleakage>46gpm~RCSsubcooling
<EOPFig.MINSUBCOOLING duetoRCSleakage~Containment radiation monitorR-29/R-30 reading>10R/hrPoweroperation, hotshutdown2.0ReactorFuel2.2FailedFuelDetectors 2.2.1UnusualEvent[SU4]LetdownLineMonitorR-9>2R/hrAll2.2.2AlertLetdownLineMonitorR-9>10R/hrPoweroperation, hotshutdown2.2.3SiteAreaEmergency
[fl,rpl]LetdownLineMonitorR-9>10R/hrandanyofthefollowing:
~REDpathonF-0.4,INTEGRITY
~Primarysystemleakage>46gpm~RCSsubcooling
<EOPFig.MINSUBCOOLING duetoRCSleakage~Containment*radiation monitorR-29/R-30 reading>10R/hrPoweroperation, hotshutdown2-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0ReactorFuel2.0ReactorFuel2.3Containment Radiation 2.3.1AlertContainment radiation monitorR-29/R-30 reading>10R/hrPoweroperation, hotshutdown2.3.2SiteAreaEmergency
[fl,rl]Containment radiation monitorR-29/R-30 reading>100R/hrPoweroperation, hotshutdown2.8.3GeneralEmergency
[fl,rl,cpl]Containment radiation monitorR-29/R-30 reading>1000R/hr2.0ReactorFuel2.4Refueling Accidents orOtherRadiation Monitors2.4.1UnusualEvent[AU2]Spentfuelpool(reactorcavityduringrefueling) waterlevelcannotberestoredandmaintained abovethespentfuelpoollowwaterlevelalarmsetpointAll2.4.2Alert[AA2]Con6rmedsustained alarmonanyofthefollowing radiation monitorsresulting fromanuncontrolled fuelhandlingprocess:~R-2Containment AreaMonitor~R-5SpentFuelPit~R-12Containment NobleGasPoweroperation, hotshutdown2.4.8Alert[AA2]Reportofvisualobservation ofirradiated fueluncovered All2-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot,lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0-ReactorCoolantSystem3.0ReactorCoolantSystem3.1RCSLeakage3.1.1UnusualEvent[SU5]3.0ReactorCoolantSystem3.2PrimarytoSecondary Leakage3.2.1UnusualEvent[cl]Unidentified orpressureboundaryleakage>10gpmORIdentified leakage>25gpmPoweroperation, hotshutdown3.1.2Alert[rpl]Primarysystemleakage>46gpmPoweroperation, hotshutdownReleaseofsecondary sidetoatmosphere withprimarytosecondary leakage>0.1gpmpersteamgenerator Poweroperation, hotshutdown13.2.2SiteAreaEmergency
[rpl,cl]Unisolable releaseofsecondary sidetoatmosphere withprimarytosecondary leakage>46gpmPoweroperation, hotshutdown3.1.3SiteAreaEmergency
[fpl,rl][SS5]3.2.3SiteAreaEmergency
[fl,cl]RVLIScannotbemaintained
>43%withnoRCPsrunningORWiththereactorvesselheadremoved,itisreportedthatwaterlevelinthereactorvesselisdroppinginan.uncontrolled mannerandcoreuncoveryislikely.Releaseofsecondary sidetoatmosphere withprimarytosecondary leakage>0.1gpmpersteamgenerator ANDEither:Coolantactivity>300pCi/ccofI-131ORLetdownLineMonitorR-9>108/hrAllPoweroperation, hotshutdown3-1fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0ReactorCoolantSystem3.0ReactorCoolantSystem3.3RCSSubcooling 3.3.1Alert[rl]RCSsubcooling
<EOPFig.MINSUBCOOLING duetoRCSleakagePoweroperation, hotshutdown3-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.
pot.losscl-contain.loss Category4.0Containment


==4.0 Containment==
==4.0 Containment==
4.1Containment Integrity Status4.1.1UnusualEvent[cl]4.0Containment 4.1Containment Integrity Status4.1.3SiteAreaEmergency
 
[rl,cl]Bothdoorsopenoncontainment airlockORInability toclosecontainment pressurerelieforpurgevalveswhichresultsinaradiological releasepathwaytotheenvironment ORCIorCVIvalve(s)notclosedwhenrequiredwhichresultsinaradiological releasepathwaytotheenvironment Either:CIorCVIvalve(s)notclosedwhenrequiredfollowing confirmed LOCAORInability toisolateanyprimarysystemdischarging outsidecontainment ANDRadiological releasepathwaytotheenvironment existsPoweroperation, hotshutdownPoweroperation, hotshutdown4.1.2SiteAreaEmergency
===4.1 Containment===
[rl,cl]Rapiduncontrolled decreaseincontainment pressurefollowing initialincreaseORLossofprimarycoolantinsidecontainment withcontainment pressureorsumplevelresponsenotconsistent withLOCAconditions Poweroperation, hotshutdown4.1.4GeneralEmergency
Integrity Status 4.1.1 Unusual Event[cl]4.0 Containment
[fl,rl,cpl]Safetyinjection signalduetoLOCAwithlessthanminimumoperablecontainment heatremovalequipment, Table4.3ANDAnyindicators offuelcladloss,Table4.1Poweroperation, hotshutdown4-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 0Category4.0Containment
 
===4.1 Containment===
Integrity Status 4.1.3 Site Area Emergency[rl, cl]Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR CI or CVI valve(s)not closed when required which results in a radiological release pathway to the environment Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists Power operation, hot shutdown Power operation, hot shutdown 4.1.2 Site Area Emergency[rl, cl]Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions Power operation, hot shutdown 4.1.4 General Emergency[fl, rl, cpl]Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Power operation, hot shutdown 4-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 0 Category 4.0 Containment


==4.0 Containment==
==4.0 Containment==
4.1Containment Integrity Status4.1.5GeneralEmergency
 
[fpVfl,rl,cl]4.0Containment 4.2SGTubeRupturew/Secondary Release4.2.1SiteAreaEmergency
===4.1 Containment===
[rl,cl]Either:Rapiduncontrolled decreaseincontainment pressurefollowing initialincreaseORLossofprimarycoolantinsidecontainment withcontainment pressureorsumplevelresponsenotconsistent withLOCAconditions ANDAnyindicators offuelcladdamage,Table4.2Poweroperation, hot'hutdown 4.1.6GeneralEmergency
Integrity Status 4.1.5 General Emergency[fpVfl, rl,cl]4.0 Containment 4.2 SG Tube Rupture w/Secondary Release 4.2.1 Site Area Emergency[rl, cl]Either: Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot'hutdown 4.1.6 General Emergency[fpVfl, rl,cl]Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" Power operation, hot shutdown 4.2.2 General Emergency[fpVfl, rl, cl]Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot shutdown Power operation, hot shutdown 4-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss  
[fpVfl,rl,cl]Either:CIorCVIvalve(s)notclosedwhenrequiredfollowing confirmed LOCAORInability toisolateanyprimarysystemdischarging outsidecontainment ANDRadiological releasepathwaytotheenvironment existsANDAnyindicators offuelcladdamage,Table4.2Unisolable secondary sidelinebreakwithSGtuberuptureasidentified inE-3"SteamGenerator TubeRupture"Poweroperation, hotshutdown4.2.2GeneralEmergency
[fpVfl,rl,cl]Unisolable secondary sidelinebreakwithSGtuberuptureasidentified inE-3"SteamGenerator TubeRupture"ANDAnyindicators offuelcladdamage,Table4.2Poweroperation, hotshutdownPoweroperation, hotshutdown4-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss  


==4.0 Containment==
==4.0 Containment==
4.3Combustible GasConcentrations 4.3.1GeneralEmergency Ifl,rl,cpl]
24%hydrogenconcentration incontainment Poweroperation, hotshutdownCatego.0Containment Table4.1FuelCladLossIndicators 1.Coolantactivity>300pCi/ccofI-1312.Containment radmonitorR-29/R-30 reading>100R/hr3.LetdownMonitorR-9reading>10R/hr4.REDpathinF-0.2,CORECOOLINGTable4.2FuelCladDamaeIndicators
~ORANGEorREDpathinF-0.2,CORECOOLING~REDpathinF-0.3,HEATSINK~Coolantactivity>300pCi/ccofI-131~Containment radmonitorR-29/R-30 reading>100H/hr~LetdownMonitorR-9reading>10R/hr<28psigN/A>28psigTable4.3MinimumOperableContainment HeatRemovalEuimentCNMTPressureRecircFansOperableSprayPumpsReuired4-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category6.0Radioactivity Release6.0Radioactivity Release/AreaRadiation 6.1EQluentMonitors6.1.1UnusualEvent[AU1]6.0Radioactivity Release/AreaRadiation 6.1EQluentMonitors6.1.4GeneralEmergency
[AG1]AvalidreadingonanymonitorsTable5.1column"NUE"for>60min.unlesssampleanalysiscanconfirmreleaserates<2xtechnical specifications withinthistimeperiod.AvalidreadingonanymonitorsTable5.1column"GE"for>15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"GE"withinthistimeperiod.AllAll6.1.2Alert[AA1]AvalidreadingonanymonitorsTable5.1column"Alert"for>15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"Alert"withinthistimeperiod.All6.1.3SiteAreaEmergency
[AS1]AvalidreadingonanymonitorsTable5.1column"SAE"for>15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"SAE"withinthistimeperiod.All5-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoryo.0Radioactivity Release6.0Radioactivity Release/AreaRadiation


==6.0 Radioactivity==
===4.3 Combustible===
Release/AreaRadiation 6.2DoseProjections/
Gas Concentrations 4.3.1 General Emergency I fl,rl,cpl]
2 4%hydrogen concentration in containment Power operation, hot shutdown Catego.0 Containment Table 4.1 Fuel Clad Loss Indicators 1.Coolant activity>300 pCi/cc of I-131 2.Containment rad monitor R-29/R-30 reading>100 R/hr 3.Letdown Monitor R-9 reading>10 R/hr 4.RED path in F-0.2, CORE COOLING Table 4.2 Fuel Clad Dama e Indicators
~ORANGE or RED path in F-0.2, CORE COOLING~RED path in F-0.3, HEAT SINK~Coolant activity>300 pCi/cc of I-131~Containment rad monitor R-29/R-30 reading>100 H/hr~Letdown Monitor R-9 reading>10 R/hr<28 psig N/A>28 psig Table 4.3 Minimum Operable Containment Heat Removal E ui ment CNMT Pressure Recirc Fans Operable Spray Pumps Re uired 4-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 6.0 Radioactivity Release 6.0 Radioactivity Release/Area Radiation 6.1 EQluent Monitors 6.1.1 Unusual Event[AU1]6.0 Radioactivity Release/Area Radiation 6.1 EQluent Monitors 6.1.4 General Emergency[AG1]A valid reading on any monitors Table 5.1 column"NUE" for>60 min.unless sample analysis can confirm release rates<2 x technical specifications within this time period.A valid reading on any monitors Table 5.1 column"GE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"GE" within this time period.All All 6.1.2 Alert[AA1]A valid reading on any monitors Table 5.1 column"Alert" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"Alert" within this time period.All 6.1.3 Site Area Emergency[AS 1]A valid reading on any monitors Table 5.1 column"SAE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"SAE" within this time period.All 5-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category o.0 Radioactivity Release 6.0 Radioactivity Release/Area Radiation 6.0 Radioactivity Release/Area Radiation 6.2 Dose Projections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates5.2DoseProjections/
Release Rates 5.2 Dose Projections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates6.2.1UnusualEvent[AU1]6.2.4SiteAreaEmergency
Release Rates 6.2.1 Unusual Event[AU1]6.2.4 Site Area Emergency[AS1]Confirmed sample analyses for gaseous or liquid release rates>2 x technical specifications limits for>60 min.All Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"SAE" at the site boundary or beyond.All 6.2.2 Alert[AA1]Confirmed sample analyses for gaseous or liquid release rates>200 x technical specifications limits for>15 min.6.2.5 General Emergency[AG1]Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"GE" at the site boundary or beyond.All 5.2.8 Alert[AA1]Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"Alert" at the site boundary or beyond.All.Table 5.3.Plant Areas~Reactor Containment Building~Auxiliary Building~Turbine Building~Emergency Diesel Building~Screen House~Standby Auxiliary Feedwater Building 5-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego o.0 Radioactivity Release 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.1'Unusual Event[AU2]Any sustained direct ARM readings>100 x alarm or oAscale hi resulting from an uncontrolled process 5.3.2 Alert[AA3]Sustained area radiation levels>15 mR/hr in either: Control Room OR Central Alarm Station and Secondary Alarm Station 5.3.3 Alert[AA3]Sustained abnormal area radiation levels>8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.All 5-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category o.0 Radioactivity Release Monitor Table 5.1 EfHuent Monitor Classification Thresholds Alert GE R-ll R-12 R-13 R-14 R-15 R-18 R-12 A(7/9)R-14A(7/9)
[AS1]Confirmed sampleanalysesforgaseousorliquidreleaserates>2xtechnical specifications limitsfor>60min.AllDoseprojections orfieldsurveysresulting fromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"SAE"atthesiteboundaryorbeyond.All6.2.2Alert[AA1]Confirmed sampleanalysesforgaseousorliquidreleaserates>200xtechnical specifications limitsfor>15min.6.2.5GeneralEmergency
[AG1]Doseprojections orfieldsurveysresulting fromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"GE"atthesiteboundaryorbeyond.All5.2.8Alert[AA1]Doseprojections orfieldsurveysresulting fromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"Alert"atthesiteboundaryorbeyond.All.Table5.3.PlantAreas~ReactorContainment Building~Auxiliary Building~TurbineBuilding~Emergency DieselBuilding~ScreenHouse~StandbyAuxiliary Feedwater Building5-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoo.0Radioactivity Release5.0Radioactivity Release/AreaRadiation 5.3AreaRadiation Levels5.3.1'UnusualEvent[AU2]Anysustained directARMreadings>100xalarmoroAscalehiresulting fromanuncontrolled process5.3.2Alert[AA3]Sustained arearadiation levels>15mR/hrineither:ControlRoomORCentralAlarmStationandSecondary AlarmStation5.3.3Alert[AA3]Sustained abnormalarearadiation levels>8R/hrwithinanyareas,Table5.3ANDAccessisrequiredtoestablish ormaintaincoldshutdown.
All5-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoryo.0Radioactivity ReleaseMonitorTable5.1EfHuentMonitorClassification Thresholds AlertGER-llR-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)
R-15A(7/9)
R-15A(7/9)
R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr.23.8mR/hrTable5.2DoseProection/Env.Measurement Classification Thresholds AlertGETEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hr100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr5-4fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0Electrical Failures6.0Electrical Failures6.1LossofACPowerSources6.1.1UnusualEvent[SUl]Lossofabilitytosupplypowertothesafeguard busesfromoffsitecircuits751and767for>15min.All6.0Electrical Failures6.1LossofACPowerSources6.1.4SiteAreaEmergency
R-31/32 1ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr.23.8 mR/hr Table 5.2 Dose Pro ection/Env.Measurement Classification Thresholds Alert GE TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 5-4 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Electrical Failures 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.1 Unusual Event[SUl]Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for>15 min.All 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.4 Site Area Emergency[SS1]Loss of all safeguards bus AC power for>15 min.Power operation, hot shutdown 6.1.2 Alert[SA1]6.1.6 General Emergency[SGl]6.1.3 Alert[SA5]Loss of all safeguards bus AC power for>15 min.Cold Shutdown, Refueling, Defueled Loss of all safeguards bus AC power AND either: Power restoration to any safeguards bus is not likely in<4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2,"CORE COOLING" Available safeguard train AC power reduced to only one of the following for>15 min.:~EDG 1A (14/18)~EDG 1B (16/17)~Station Auxiliary Transformer 12A~Station Auxiliary Transformer 12B Power operation, hot shutdown Power operation, hot shutdown 6-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 6.0 Electrical Failures 6.0 Electrical Failures 6.2 Loss of DC Power Sources 6.2.1 Unusual Event[SU7]<105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.Cold Shutdown, Refueling 6.2.2 Site Area Emergency[SS3]>105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.Power operation, hot shutdown 6-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0 Equipment Failures 7.0 Equipment Failures V.1 Technical Specification%Requirements 7.1.1 Unusual Event[SU2]Plant is not brought to required operating mode within Technical Specifications LCO Action-Statement Time.Power operation, hot shutdown V.O Equipment Failures V.2 System Failures or Control Room Evacuation 7.2.1 Unusual Event[HU1]Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.Power Operations V.2.2 Alert[HA1]Turbine failure generated missiles result in any visible structural damage to plant vital equipment Power Operations, Hot Shutdown 7.2.8 Alert[HA5]Entry into AP-CR.1"Control Room Inaccessability" All 7.2.4 Alert[SA3]Reactor coolant temperature cannot be maintained
[SS1]Lossofallsafeguards busACpowerfor>15min.Poweroperation, hotshutdown6.1.2Alert[SA1]6.1.6GeneralEmergency
<200'F Cold Shutdown, Refueling 7-1 fyl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Cate go.0 Equipment Failures V.O Equipment Failures 7.0 Equipment Failures V.2 System Failures or Control Room Evacuation 7.3 Loss of Indications
[SGl]6.1.3Alert[SA5]Lossofallsafeguards busACpowerfor>15min.ColdShutdown, Refueling, DefueledLossofallsafeguards busACpowerANDeither:Powerrestoration toanysafeguards busisnotlikelyin<4hrsORActualorimminententryintoORANGEorREDpathonF-0.2,"CORECOOLING"Available safeguard trainACpowerreducedtoonlyoneofthefollowing for>15min.:~EDG1A(14/18)~EDG1B(16/17)~StationAuxiliary Transformer 12A~StationAuxiliary Transformer 12BPoweroperation, hotshutdownPoweroperation, hotshutdown6-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category6.0Electrical Failures6.0Electrical Failures6.2LossofDCPowerSources6.2.1UnusualEvent[SU7]<105vdcbusvoltageindications on125vdcbatteries 1Aand1Bfor>15min.ColdShutdown, Refueling 6.2.2SiteAreaEmergency
/Alarms/Communication Capability V.2.5 Site Area Emergency[HS2]V.3.1 Unusual Event[SU3]Control Room evacuation AND Core cooling cannot be established per AP-CR.1"Control Room Inaccessibility" in<20 min.All Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation Power operation, hot shutdown 7.3.2 Unusual Event[SU6]Loss of all communications capability affecting the ability to either: Perform routine operations OR Notify offsite agencies or personnel 7-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0.Equipment Failures V.O Equipment Failures V.3 Loss of Indications
[SS3]>105vdcbusvoltageindications on125vdcbatteries 1Aand1Bfor>15min.Poweroperation, hotshutdown6-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0Equipment Failures7.0Equipment FailuresV.1Technical Specification%Requirements 7.1.1UnusualEvent[SU2]Plantisnotbroughttorequiredoperating modewithinTechnical Specifications LCOAction-Statement Time.Poweroperation, hotshutdownV.OEquipment FailuresV.2SystemFailuresorControlRoomEvacuation 7.2.1UnusualEvent[HU1]Reportofmainturbinefailureresulting incasingpenetration ordamagetoturbinesealsorgenerator seals.PowerOperations V.2.2Alert[HA1]Turbinefailuregenerated missilesresultinanyvisiblestructural damagetoplantvitalequipment PowerOperations, HotShutdown7.2.8Alert[HA5]EntryintoAP-CR.1"ControlRoomInaccessability" All7.2.4Alert[SA3]Reactorcoolanttemperature cannotbemaintained
/Alarms/Communication Capability Table 7.3 Vital Control Room Panels V.3.3 Alert[SA4]B C D E F G Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation AND either: A plant transient in progress OR PPCS and SAS are unavailable Power operation, hot shutdown V.3.4 Site Area Emergency[SS6]Loss of annunciators or'indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Power operation, hot shutdown 7-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Hazards 8.0 Hazards 8.1 Security Threats 8.1.1 Unusual Event[HU4]8.0 Hazards 8.1 Security Threats 8.1.4 General Emergency[HG1]Bomb device or other indication of attempted sabotage discovered within plant Protected Area.OR Any security event which represents a potential degradation in the level of safety of the plant.Security event which results in: Loss of plant control from the Control Room OR Loss of remote shutdown capability All 8.1.2 Alert[HA4]Intrusion into plant Protected Area by an adversary.
<200'FColdShutdown, Refueling 7-1fyl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0Equipment FailuresV.OEquipment Failures7.0Equipment FailuresV.2SystemFailuresorControlRoomEvacuation 7.3LossofIndications
OR Any security event which represents an actual substantial degradation of the level of safety of the plant.All 8.1.3 Site Area Emergency[HS1]Intrusion into a plant security vital area by an adversary.
/Alarms/Communication Capability V.2.5SiteAreaEmergency
OR Any security event which represents actual or likely failures of plant systems needed to protect the public.All 8-1 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Hazards 8.0 Hazards 8.2 Fire or Explosion 8.2.1 Unusual Event DiU2]8.0 Hazards 8.3 Man-Made Events 8.3.1 Unusual Event DiU1]Confirmed fire in any plant area, Table 8.2 or Table 8.3 not extinguished in 5 15 min.of Control Room notification:
[HS2]V.3.1UnusualEvent[SU3]ControlRoomevacuation ANDCorecoolingcannotbeestablished perAP-CR.1"ControlRoomInaccessibility" in<20min.AllUnplanned lossofannunciators orindications onanyControlRoomPanels,Table7.3for>15min.ANDIncreased surveillance isrequiredforsafeplantoperation Poweroperation, hotshutdown7.3.2UnusualEvent[SU6]Lossofallcommunications capability affecting theabilitytoeither:Performroutineoperations ORNotifyoffsiteagenciesorpersonnel 7-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0.Equipment FailuresV.OEquipment FailuresV.3LossofIndications
All Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary All 8.2.2 Alert[HA2]8.3.2 Unusual Event[HU1]Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:~visible damage to plant equipment or structures needed for safe plant operation OR~which affects safety system operability as indicated by degraded system performance Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment All 8.3.3 Unusual Event[HU3]Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could affect the health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event All 8-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 8.0 Hazards 8.0 Hazards 8.3 Man-Made Events 8.3.4 Alert[HA1]8.0 Hazards 8.4 Natural Events 8.4.1 Unusual Event[HU1]'ehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 All Earthquake felt inplant by any operator AND I Confirmation of earthquake of an intensity>0.01 g per SC-5"Earthquake Emergency Plan".All 8.3.5 Alert[HA3]Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation 8.4.2 Unusual Event[HU1]Report by plant personnel of tornado within plant Protected Area boundary All 8.4.3 Unusual Event[HUl]Deer Creek flooding over entrance road bridge (hand rail)OR Lake level>252 ft OR Screen House Suction Bay water level<15 ft (low-low level alarm)All 8-3~fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 8.0 Hazards 8.4 Natural Events 8.4.4 Alert[HA1]Category.0 Hazards 8.0 Hazards 8.4 Natural Events 8.4.7 Alert[HA1]Earthquake felt inplant by any plant operations personnel AND Confirmation of earthquake of an intensity)0.08 g per SC-5"Earthquake Emergency Plan" All Flood water accumulating on screen house operating floor OR Lake level>253 ft I'R Screen House Suction Bay water level<13 ft All 8.4.5 Alert[HA1]Sustained winds>75 mph OR Tornado strikes a plant vital area, Table 8.3 All 8.4.6 Alert[HAl]Table 8.2 Plant Areas~Turbine Building~TSC~Service Building~Contaminated Storage Building Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 All Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House 8-4 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 9.0 Other 9.1.1 Unusual Event Category 9.0 Other 9.0 Other 9.1.3 Alert Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.AIl 9.1.2 Unusual Event 9.1.4 Alert Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment, Attach.A.Power operation, hot shutdown Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a, loss or potential loss of either fuel clad or RCS barrier, Attach.A.Power operation, hot shutdown 9-1 fpl-fuel clad pot.loss Q-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 9.0 Other 9.1.5 Site Area Emergency Category 9.0 Other 9.0 Other 9.1.V General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public.Any releases are not expected to result in exposures which exceed EPA PAGs, Attach.A.All As determined by the Shik Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential for a large release of radioactive material in excess of EPA PAGs outside the site boundary.All 9.1.6 Site Area Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to either: Loss or potential loss of both fuel clad and RCS barrier, Attach.A.OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attach.A.9.1.8 General Emergency Any event, as determined by the ShiA.Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attach.A.Power operation, hot shutdown Power operation, hot shutdown 9-2 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss OSSI-92-402A-4-REG fgi.J 2'gf I'innd EAL Technical Bases Document, Rev 1}Attachment C New York EAL Upgrade Project R.E.Ginna Emergency Action Levels Technical Bases Revision 1 Based on Proposed Responses to NRC RAIs 10/11/94 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document.Rev 1 PURPOSE The purpose of this document is to provide an explanation and rationale for each of the emergency action levels (EALs)included in the EAL Upgrade Program for R.E.Ginna Nuclear Power Station (REGNPS).It is also intended to facilitate the review process of the REGNPS EALs and provide historical documentation for future reference.
/Alarms/Communication Capability Table7.3VitalControlRoomPanelsV.3.3Alert[SA4]BCDEFGUnplanned lossofannunciators orindications onanyControlRoomPanels,Table7.3for>15min.ANDIncreased surveillance isrequiredforsafeplantoperation ANDeither:Aplanttransient inprogressORPPCSandSASareunavailable Poweroperation, hotshutdownV.3.4SiteAreaEmergency
This document is also intended to be utilized by, those individuals responsible for implementation of EPIP-1-0"Ginna Station Event Evaluation and Classification" as a technical reference and aid in EAL interpretation.
[SS6]Lossofannunciators or'indications onanyControlRoomPanels,Table7.3ANDCompletelossofabilitytomonitorallcriticalsafetyfunctionstatusANDAplanttransient inprogressPoweroperation, hotshutdown7-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0Hazards8.0Hazards8.1SecurityThreats8.1.1UnusualEvent[HU4]8.0Hazards8.1SecurityThreats8.1.4GeneralEmergency
DISCUSSION EALs are the plant-specific indications, conditions or instrument readings which are utilized to classify emergency conditions defined in the REGNPS Emergency Plan.Subsequent to the acceptance by the NRC of NUMARC/NESP-007"Methodology for Development of Emergency Action Levels" as an acceptable alternative to the NUREG 0654 EAL guidance, the four nuclear utilities in the State of New York decided to perform a joint implementation of the new methodology.
[HG1]Bombdeviceorotherindication ofattempted sabotagediscovered withinplantProtected Area.ORAnysecurityeventwhichrepresents apotential degradation inthelevelofsafetyoftheplant.Securityeventwhichresultsin:LossofplantcontrolfromtheControlRoomORLossofremoteshutdowncapability All8.1.2Alert[HA4]Intrusion intoplantProtected Areabyanadversary.
This upgrade project involved the following plants:~Nine Mile Point Unit 1 (NMPC)~Nine Mile Point Unit 2 (NMPC)James A.FitzPatrick Nuclear Power Plant (NYPA)~Indian Point Station 2 (ConEd)~Indian Point 3 Nuclear Po'wer Station (NYPA)~R.E.Ginna Nuclear Power Station (RG&E)While the upgraded EALs are site specific, an objective of the upgrade project was to ensure conformity and consistency between the sites to the extent possible.The revised EALs were derived from the Initiating Conditions and example EALs given in the REGNPS Plant-Specific EAL Guideline (PEG).The PEG is the REGNPS interpretation of the NUMARC methodology for developing EALs.The PEG identifies deletions from the NUMARC methodology by striking out words and phrases that are not applicable to REGNPS;additions are identified by underlining new words and phrases.The source of documents for PEG changes from NUNC methodology are listed in the references section of the PEG.Many of the EALs derived from the NV)~C methodology are fission product barrier based.That is, the conditions which define the EALs are OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev l based upon loss or potential loss of one or more of the three fission product barriers.The primary fission product barriers are: A.r F 1 1 in The fuel cladding is comprised of the zirconium tubes which house the ceramic uranium oxide pellets along with the end plugs which are welded into each end of the fuel rods.B.r I n m The RCS is comprised of the reactor vessel shell, vessel head, vessel nozzles and penetrations and all primary systems directly connected t'o the reactor vessel up to the first containment isolation valve.C~i~Yh i i p'fh p containment structure and all isolation valves required to maintain containment integrity under accident conditions.
ORAnysecurityeventwhichrepresents anactualsubstantial degradation ofthelevelofsafetyoftheplant.All8.1.3SiteAreaEmergency
The following criteria serves as the bases for event classification related to fission product barrier loss: n 1Ev n Any loss or potential loss of containment hhzf'ny loss or any potential loss of either fuel clad or RCS r n Any loss of both fuel clad and RCS or Any potential loss of both fuel clad and RCS or Any potential loss of either fuel clad or RCS with a loss of any additional barrier Loss of any two barriers with loss or potential loss of a third Those EALs-which'reference one or more of the fission product barrier IC designators (FC, RCS and PC)in the PEG Reference section of the technical bases are derived from the Fission Product Barrier Analysis.The analysis entailed an evaluation of every combination of the plant specific barrier loss/potential loss indicators applied to the above criteria.
[HS1]Intrusion intoaplantsecurityvitalareabyanadversary.
OSSI-92-402A-4-REG Ginna EAI.Technical Bases Document, Rev I Where possible, the EALs have been made consistent with'nd utilize the conditions defined in the REGNPS Critical Safety Function Status Trees (CSFSTs).While the symptoms that drive operator actions specified in the CSFSTs are not indicative of gll possible conditions which warrant emergency classification, they do define the symptoms, independent of initiating events, for which reactor plant safety and/or fission product barrier integrity are threatened.
ORAnysecurityeventwhichrepresents actualorlikelyfailuresofplantsystemsneededtoprotectthepublic.All8-1fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Hazards8.0Hazards8.2FireorExplosion 8.2.1UnusualEventDiU2]8.0Hazards8.3Man-MadeEvents8.3.1UnusualEventDiU1]Confirmed fireinanyplantarea,Table8.2orTable8.3notextinguished in515min.ofControlRoomnotification:
Where these symptoms are clearly representative of one of the PEG Initiating Conditions, they have been utilized as an EAL.This allows for rapid classification of emergency situations based on plant conditions without the need for additional evaluation or event diagnosis.
AllVehiclecrashintoorprojectile whichimpactsplantstructures orsystemswithinProtected AreaboundaryAll8.2.2Alert[HA2]8.3.2UnusualEvent[HU1]Fireorexplosion inanyplantarea,Table8.2orTable8.3whichresultsinEITHER:~visibledamagetoplantequipment orstructures neededforsafeplantoperation OR~whichaffectssafetysystemoperability asindicated bydegradedsystemperformance Reportbyplantpersonnel ofanexplosion withinProtected Areaboundaryresulting invisibledamagetopermanent structures orequipment All8.3.3UnusualEvent[HU3]Reportordetection oftoxicorflammable gasesthatcouldenterorhaveenteredwithintheProtected Areaboundaryinamountsthatcouldaffectthehealthofplantpersonnel orsafeplantoperation ORReportbylocal,countyorstateofficials forpotential evacuation ofsitepersonnel basedonoffsiteeventAll8-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category8.0Hazards8.0Hazards8.3Man-MadeEvents8.3.4Alert[HA1]8.0Hazards8.4NaturalEvents8.4.1UnusualEvent[HU1]'ehiclecrashorprojectile impactwhichprecludes personnel accesstoordamagesequipment inplantvitalareas,Table8.3AllEarthquake feltinplantbyanyoperatorANDIConfirmation ofearthquake ofanintensity
Although some of the EALs presented here are based on conditions defined in the CSFSTs, classification of emergencies using these EALs is not dependent upon Emergency Operating Procedures (EOPs)entry or execution.
>0.01gperSC-5"Earthquake Emergency Plan".All8.3.5Alert[HA3]Reportordetection oftoxicorflammable gaseswithinaplantarea,Table8.3,inconcentrations thatwillbelifethreatening toplantpersonnel orprecludeaccesstoequipment neededforsafeplantoperation 8.4.2UnusualEvent[HU1]Reportbyplantpersonnel oftornadowithinplantProtected AreaboundaryAll8.4.3UnusualEvent[HUl]DeerCreekfloodingoverentranceroadbridge(handrail)ORLakelevel>252ftORScreenHouseSuctionBaywaterlevel<15ft(low-lowlevelalarm)All8-3~fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 8.0Hazards8.4NaturalEvents8.4.4Alert[HA1]Category.0Hazards8.0Hazards8.4NaturalEvents8.4.7Alert[HA1]Earthquake feltinplantbyanyplantoperations personnel ANDConfirmation ofearthquake ofanintensity
The EALs can be utilized independently or in conjunction with the EOPs.To the extent possible, the EALs are symptom based.That is, the action level is defined by values of key plant operating parameters which identify emergency or potential emergency conditions.
)0.08gperSC-5"Earthquake Emergency Plan"AllFloodwateraccumulating onscreenhouseoperating floorORLakelevel>253ftI'RScreenHouseSuctionBaywaterlevel<13ftAll8.4.5Alert[HA1]Sustained winds>75mphORTornadostrikesaplantvitalarea,Table8.3All8.4.6Alert[HAl]Table8.2PlantAreas~TurbineBuilding~TSC~ServiceBuilding~Contaminated StorageBuildingAnynaturaleventwhichresultsinareportofvisiblestructural damageorassessment byControlRoompersonnel ofactualdamagetoequipment neededforsafeplantoperation, Table8.3AllTable8.3PlantVitalAreas~ControlBuilding~ReactorContainment BuildingAuxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouse8-4fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 9.0Other9.1.1UnusualEventCategory9.0Other9.0Other9.1.3AlertAnyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadtoorhasledtoapotential degradation ofthelevelofsafetyoftheplant.Anyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldcauseorhascausedactualsubstantial degradation ofthelevelofsafetyoftheplant.AIl9.1.2UnusualEvent9.1.4AlertAnyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadtoorhasledtoalossorpotential lossofcontainment, Attach.A.Poweroperation, hotshutdownAnyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadorhasledtoa,lossorpotential lossofeitherfuelcladorRCSbarrier,Attach.A.Poweroperation, hotshutdown9-1fpl-fuelcladpot.lossQ-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 9.0Other9.1.5SiteAreaEmergency Category9.0Other9.0Other9.1.VGeneralEmergency Asdetermined bytheShiftSupervisor orEmergency Coordinator, eventsareinprogresswhichindicateactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.Anyreleasesarenotexpectedtoresultinexposures whichexceedEPAPAGs,Attach.A.AllAsdetermined bytheShikSupervisor orEmergency Coordinator, eventsareinprogresswhichindicateactualorimminentcoredamageandthepotential foralargereleaseofradioactive materialinexcessofEPAPAGsoutsidethesiteboundary.
This approach is appropriate because it allows the full scope of variations in the types of events to be classified as emergencies.
All9.1.6SiteAreaEmergency Anyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadorhasledtoeither:Lossorpotential lossofbothfuelcladandRCSbarrier,Attach.A.ORLossorpotential lossofeitherfuelcladorRCSbarrierinconjunction withalossofcontainment, Attach.A.9.1.8GeneralEmergency Anyevent,asdetermined bytheShiA.Supervisor orEmergency Coordinator, thatcouldleadorhasledtoalossofanytwofissionproductbarriersandlossorpotential lossofthethird,Attach.A.Poweroperation, hotshutdownPoweroperation, hotshutdown9-2fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss OSSI-92-402A-4-REG fgi.J2'gfI'inndEALTechnical BasesDocument, Rev1}Attachment CNewYorkEALUpgradeProjectR.E.GinnaEmergency ActionLevelsTechnical BasesRevision1BasedonProposedResponses toNRCRAIs10/11/94 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument.
But, a purely symptom based approach is not sufBcient to address all events for which emergency classification is appropriate.
Rev1PURPOSEThepurposeofthisdocumentistoprovideanexplanation andrationale foreachoftheemergency actionlevels(EALs)includedintheEALUpgradeProgramforR.E.GinnaNuclearPowerStation(REGNPS).
Particular events to which no predetermined symptoms can be ascribed have also been utilized as EALs since they may be indicative of potentially more serious conditions not yet fully realized.The EALs are grouped into nine categories to simplify their presentation and to promote a rapid understanding by their users.These categories are: 1.2.3.4 5.6.7.8.9.CSFST Status Reactor Fuel Reactor Coolant System Containment Radioactivity Release/Area Radiation Electrical Failures Equipment Failures Hazards Other Categories 1 through 5 are primarily symptom based.The symptoms are indicative of actual or potential degradation of either fission product barriers or personnel safety.Categories 6, 7 and 8 are event based.Electrical Failures are those events associated with losses of either AC or vital DC electrical power.Equipment Failures are abnormal and emergency events associated with vital plant system failures, while Hazards are those non-plant system related events which have affected or may affect plant safety.
Itisalsointendedtofacilitate thereviewprocessoftheREGNPSEALsandprovidehistorical documentation forfuturereference.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document.Rev I Category 9 provides the Emergency Coordinator (ShiR Supervisor) the latitude to classify and declare emergencies based on plant symptoms or events which in his judgment warrant classification.
Thisdocumentisalsointendedtobeutilizedby,thoseindividuals responsible forimplementation ofEPIP-1-0"GinnaStationEventEvaluation andClassification" asatechnical reference andaidinEALinterpretation.
This judgment includes evaluation of loss or potential loss of one or more fission product barriers warranting emergency classification consistent with the NUMlARC barrier loss criteria.The fission product barrier loss and potential loss indicators are provided in Attachment A.Categories are further divided into one or more subcategories depending on the types and number of plant conditions that dictate emergency classifications.
DISCUSSION EALsaretheplant-specific indications, conditions orinstrument readingswhichareutilizedtoclassifyemergency conditions definedintheREGNPSEmergency Plan.Subsequent totheacceptance bytheNRCofNUMARC/NESP-007 "Methodology forDevelopment ofEmergency ActionLevels"asanacceptable alternative totheNUREG0654EALguidance, thefournuclearutilities intheStateofNewYorkdecidedtoperformajointimplementation ofthenewmethodology.
For example, the Electrical Failures category has two subcategories whose values can be indicative of losses of electrical power sources: loss of AC power sources and loss of DC power sources.An EAL may or may not exist for each sub category at all four classification levels.Similarly, more than one EAL may exist for a sub category in a given emergency classification when appropriate (i.e.no EAL at the General Emergency level but three EALs at the Unusual Event level).For each EAL, the, following information is provided: Classification:
Thisupgradeprojectinvolvedthefollowing plants:~NineMilePointUnit1(NMPC)~NineMilePointUnit2(NMPC)JamesA.FitzPatrick NuclearPowerPlant(NYPA)~IndianPointStation2(ConEd)~IndianPoint3NuclearPo'werStation(NYPA)~R.E.GinnaNuclearPowerStation(RG&E)WhiletheupgradedEALsaresitespecific, anobjective oftheupgradeprojectwastoensureconformity andconsistency betweenthesitestotheextentpossible.
Unusual Event, Alert, Site Area Emergency, or General Emergency NUMARC Initiating Condition&om which the EAL was derived, if applicable.
TherevisedEALswerederivedfromtheInitiating Conditions andexampleEALsgivenintheREGNPSPlant-Specific EALGuideline (PEG).ThePEGistheREGNPSinterpretation oftheNUMARCmethodology fordeveloping EALs.ThePEGidentifies deletions fromtheNUMARCmethodology bystrikingoutwordsandphrasesthatarenotapplicable toREGNPS;additions areidentified byunderlining newwordsandphrases.Thesourceofdocuments forPEGchangesfromNUNCmethodology arelistedinthereferences sectionofthePEG.ManyoftheEALsderivedfromtheNV)~Cmethodology arefissionproductbarrierbased.Thatis,theconditions whichdefinetheEALsare OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Revlbaseduponlossorpotential lossofoneormoreofthethreefissionproductbarriers.
~Fission product barrier loss/potential loss condition which the EAL represents, if applicable.
Theprimaryfissionproductbarriersare:A.rF11inThefuelcladdingiscomprised ofthezirconium tubeswhichhousetheceramicuraniumoxidepelletsalongwiththeendplugswhichareweldedintoeachendofthefuelrods.B.rInmTheRCSiscomprised ofthereactorvesselshell,vesselhead,vesselnozzlesandpenetrations andallprimarysystemsdirectlyconnected t'othereactorvesseluptothefirstcontainment isolation valve.C~i~Yhiip'fhpcontainment structure andallisolation valvesrequiredtomaintaincontainment integrity underaccidentconditions.
~Operating Mode Applicability:
Thefollowing criteriaservesasthebasesforeventclassification relatedtofissionproductbarrierloss:n1EvnAnylossorpotential lossofcontainment hhzf'nylossoranypotential lossofeitherfuelcladorRCSrnAnylossofbothfuelcladandRCSorAnypotential lossofbothfuelcladandRCSorAnypotential lossofeitherfuelcladorRCSwithalossofanyadditional barrierLossofanytwobarrierswithlossorpotential lossofathirdThoseEALs-which'reference oneormoreofthefissionproductbarrierICdesignators (FC,RCSandPC)inthePEGReference sectionofthetechnical basesarederivedfromtheFissionProductBarrierAnalysis.
One or more of the following plant operating conditions are listed: Power Operation, Hot Shutdown, Cold Shutdown, Refuel and Defueled EAL: Description of the condition or set of conditions which comprise the EAL~Basis: Description of the rationale for the EAL~PEG  
Theanalysisentailedanevaluation ofeverycombination oftheplantspecificbarrierloss/potential lossindicators appliedtotheabovecriteria.
OSSI-92-402A-4-REG GinnaEAI.Technical BasesDocument, RevIWherepossible, theEALshavebeenmadeconsistent with'ndutilizetheconditions definedintheREGNPSCriticalSafetyFunctionStatusTrees(CSFSTs).
Whilethesymptomsthatdriveoperatoractionsspecified intheCSFSTsarenotindicative ofgllpossibleconditions whichwarrantemergency classification, theydodefinethesymptoms, independent ofinitiating events,forwhichreactorplantsafetyand/orfissionproductbarrierintegrity arethreatened.
Wherethesesymptomsareclearlyrepresentative ofoneofthePEGInitiating Conditions, theyhavebeenutilizedasanEAL.Thisallowsforrapidclassification ofemergency situations basedonplantconditions withouttheneedforadditional evaluation oreventdiagnosis.
AlthoughsomeoftheEALspresented herearebasedonconditions definedintheCSFSTs,classification ofemergencies usingtheseEALsisnotdependent uponEmergency Operating Procedures (EOPs)entryorexecution.
TheEALscanbeutilizedindependently orinconjunction withtheEOPs.Totheextentpossible, theEALsaresymptombased.Thatis,theactionlevelisdefinedbyvaluesofkeyplantoperating parameters whichidentifyemergency orpotential emergency conditions.
Thisapproachisappropriate becauseitallowsthefullscopeofvariations inthetypesofeventstobeclassified asemergencies.
But,apurelysymptombasedapproachisnotsufBcient toaddressalleventsforwhichemergency classification isappropriate.
Particular eventstowhichnopredetermined symptomscanbeascribedhavealsobeenutilizedasEALssincetheymaybeindicative ofpotentially moreseriousconditions notyetfullyrealized.
TheEALsaregroupedintoninecategories tosimplifytheirpresentation andtopromotearapidunderstanding bytheirusers.Thesecategories are:1.2.3.45.6.7.8.9.CSFSTStatusReactorFuelReactorCoolantSystemContainment Radioactivity Release/AreaRadiation Electrical FailuresEquipment FailuresHazardsOtherCategories 1through5areprimarily symptombased.Thesymptomsareindicative ofactualorpotential degradation ofeitherfissionproductbarriersorpersonnel safety.Categories 6,7and8areeventbased.Electrical Failuresarethoseeventsassociated withlossesofeitherACorvitalDCelectrical power.Equipment Failuresareabnormalandemergency eventsassociated withvitalplantsystemfailures, whileHazardsarethosenon-plant systemrelatedeventswhichhaveaffectedormayaffectplantsafety.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument.
RevICategory9providestheEmergency Coordinator (ShiRSupervisor) thelatitudetoclassifyanddeclareemergencies basedonplantsymptomsoreventswhichinhisjudgmentwarrantclassification.
Thisjudgmentincludesevaluation oflossorpotential lossofoneormorefissionproductbarrierswarranting emergency classification consistent withtheNUMlARCbarrierlosscriteria.
Thefissionproductbarrierlossandpotential lossindicators areprovidedinAttachment A.Categories arefurtherdividedintooneormoresubcategories depending onthetypesandnumberofplantconditions thatdictateemergency classifications.
Forexample,theElectrical Failurescategoryhastwosubcategories whosevaluescanbeindicative oflossesofelectrical powersources:lossofACpowersourcesandlossofDCpowersources.AnEALmayormaynotexistforeachsubcategoryatallfourclassification levels.Similarly, morethanoneEALmayexistforasubcategoryinagivenemergency classification whenappropriate (i.e.noEALattheGeneralEmergency levelbutthreeEALsattheUnusualEventlevel).ForeachEAL,the,following information isprovided:
Classification:
UnusualEvent,Alert,SiteAreaEmergency, orGeneralEmergency NUMARCInitiating Condition
&omwhichtheEALwasderived,ifapplicable.
~Fissionproductbarrierloss/potential losscondition whichtheEALrepresents, ifapplicable.
~Operating ModeApplicability:
Oneormoreofthefollowing plantoperating conditions arelisted:PowerOperation, HotShutdown, ColdShutdown, RefuelandDefueledEAL:Description ofthecondition orsetofconditions whichcomprisetheEAL~Basis:Description oftherationale fortheEAL~PEG


==Reference:==
==Reference:==


PEGIC(s)andexampleEAL(s)fromwhichtheEALisderived~BasisReference(s):
PEG IC(s)and example EAL(s)from which the EAL is derived~Basis Reference(s):
Sourcedocumentation fromwhichtheEALisderived OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Theidentified operating modesaredefinedasfollowsReactorshutdownmarginislessthanTechnical Specification minimumrequiredwithcoolanttemperature (Tavg)atorabovenormaloperating temperature.
Source documentation from which the EAL is derived OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The identified operating modes are defined as follows Reactor shutdown margin is less than Technical Specification minimum required with coolant temperature (Tavg)at or above normal operating temperature.
ReactorshutdownmargingreaterthanorequaltoTechnical Specification minimumrequiredwithcoolanttemperature (Tavg)lessthannormaloperating temperature.
Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg)less than normal operating temperature.
~IhReactorshutdownmargingreaterthanorequaltoTechnical Specification minimumrequiredwithcoolanttemperature (Tavg)lessthanorequalto200'F.E~f~gReactorshutdownmargingreaterthanorequaltoTechnical Specification minimumrequiredforrefueling operations andcoolanttemperature (Tavg)lessthanorequalto140'F.Lh~luiReactorvesselcontainsnoirradiated fuel.Theseoperating modescorrelate totheNUMARC-007 andPEGidentified operating modesasfollows:hni1BPowerOperations Startup/Hot standbyHotShutdownColdShutdownRefuelDefueledAllPowerOperations PowerOperation HotShutdownColdShutdownRefuelDefueledAll OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PlantEmergency Operating Procedures (EOPs)aredesignedtomaintainand/orrestoreasetofcriticalsafetyfunctions whichareprioritized forrestoration effortsduringaccidentconditions.
~Ih Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg)less than or equal to 200'F.E~f~g Reactor shutdown margin greater than or equal to Technical Specification minimum required for refueling operations and coolant temperature (Tavg)less than or equal to 140'F.Lh~lui Reactor vessel contains no irradiated fuel.These operating modes correlate to the NUMARC-007 and PEG identified operating modes as follows: hni 1B Power Operations Startup/Hot standby Hot Shutdown Cold Shutdown Refuel Defueled All Power Operations Power Operation Hot Shutdown Cold Shutdown Refuel Defueled All OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Plant Emergency Operating Procedures (EOPs)are designed to maintain and/or restore a set of critical safety functions which are prioritized for restoration efforts during accident conditions.
Bymonitoring thecriticalsafetyfunctions status,theimpactofmultipleeventscanbeinherently addressed.
By monitoring the critical safety functions status, the impact of multiple events can be inherently addressed.
Thecriticalsafetyfunctions aremonitored throughtheuseofCriticalSafetyFunctionStatusTrees(CSFSTs).
The critical safety functions are monitored through the use of Critical Safety Function Status Trees (CSFSTs).When certain plant parameters exceed threshold values specified by the CSFST, the plant operator is directed to one or more functional restoration and/or EOPs in an attempt to restore those parameters to within acceptable limits.The following CSFSTs are utilized to be indicative of failures or potential failures of one or more fission product barriers: '0 g Rdptt l tl'SFSTldl t l f reactivity control which may pose a threat to fuel clad and RCS'ntegrity.
Whencertainplantparameters exceedthreshold valuesspecified bytheCSFST,theplantoperatorisdirectedtooneormorefunctional restoration and/orEOPsinanattempttorestorethoseparameters towithinacceptable limits.Thefollowing CSFSTsareutilizedtobeindicative offailuresorpotential failuresofoneormorefissionproductbarriers:
C g Rdp tl I'SFSTldl l f core subcooling and thus pose a direct threat to the integrity of the reactor fuel clad and RCS.~H~ink'he Red path of this CSFST is indicative of a loss of ability to remove decay heat from the core and thus poses a direct threat to fuel clad and RCS integrity.
'0gRdpttltl'SFSTldl tlfreactivity controlwhichmayposeathreattofuelcladandRCS'ntegrity.
The Red path of this CSFST is indicative of a direct threat to RCS barrier integrity.
CgRdptlI'SFSTldl lfcoresubcooling andthusposeadirectthreattotheintegrity ofthereactorfuelcladandRCS.~H~ink'he RedpathofthisCSFSTisindicative ofalossofabilitytoremovedecayheatfromthecoreandthusposesadirectthreattofuelcladandRCSintegrity.
R dp t ftg CSFSTl l dl tl t l ff clad and RCS barrier and direct threat to the containment barrier integrity.
TheRedpathofthisCSFSTisindicative ofadirectthreattoRCSbarrierintegrity.
1-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.1 Alert ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required NUIVIARC IC: Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and immediate manual trips were not successful while in power operations or hot standby FPB loss/potential loss: N/A Mode Applicability:
RdptftgCSFSTlldltltlffcladandRCSbarrieranddirectthreattothecontainment barrierintegrity.
Power Operations, Hot Shutdown Basis: CSFST Subcriticality
1-1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.1Subcriticality 1.1.1AlertORANGEorREDpathF-0.1SUBCRITICALITY ANDEmergency borationisrequiredNUIVIARCIC:FailureofReactorProtection systeminstrumentation tocompleteorinitiateanautomatic reactortriponceaReactorProtection systemsetpointhasbeenexceededandimmediate manualtripswerenotsuccessful whileinpoweroperations orhotstandbyFPBloss/potential loss:N/AModeApplicability:
-ORANGE path is entered based on failure of the intermediate range startup rate monitors to indicate negative or zero following reactor trip.This EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent requiring emergency boration.A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes control rods to be rapidly inserted into the core and brings the reactor subcritical (e.g., reactor trip button).This condition indicates failure of the automatic and manual protection systems to trip the reactor to the extent which precludes the reactor being made sub-critical.
PowerOperations, HotShutdownBasis:CSFSTSubcriticality
Although a front line automatic protection system did not function in response to a plant transient, it is the continued criticality under"conditions requiring a reactor trip which poses the potential threat to fuel clad integrity and thus warranting declaration of an Alert.PEG  
-ORANGEpathisenteredbasedonfailureoftheintermediate rangestartupratemonitorstoindicatenegativeorzerofollowing reactortrip.ThisEALaddresses anymanualtriporautomatic tripsignalfollowedbyamanualtripwhichfailstoshutdownthereactortoanextentrequiring emergency boration.
Amanualtripisanysetofactionsbythereactoroperator(s) atthereactorcontrolconsolewhichcausescontrolrodstoberapidlyinsertedintothecoreandbringsthereactorsubcritical (e.g.,reactortripbutton).Thiscondition indicates failureoftheautomatic andmanualprotection systemstotripthereactortotheextentwhichprecludes thereactorbeingmadesub-critical.
Althoughafrontlineautomatic protection systemdidnotfunctioninresponsetoaplanttransient, itisthecontinued criticality under"conditions requiring areactortripwhichposesthepotential threattofuelcladintegrity andthuswarranting declaration ofanAlert.PEG


==Reference:==
==Reference:==


SA2.11-2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
SA2.1 1-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.CSFSTF-0.1,Subcriticality 2."Methodology forDevelopment ofEmergency ActionLevelsNUMARC/NESP-007 Revision2-Questions andAnswers,June19931-3 OSSA-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.1Subcriticality 1.1.2SiteAreaEmergency REDpathinF-0.1SUBCRITICALITY ANDeither:Emergency borationisinoperable ORPowerrangenot<5%within15min.ofinitiation ofemergency borationNUINARCIC:FailureofReactorProtection systeminstrumentation tocompleteorinitiateanautomatic reactortriponceaReactorProtection systemsetpointhasbeenexceededandmanualscramtripwasnotsuccessful andthereiscontinued powergeneration.
1.CSFST F-0.1, Subcriticality 2."Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2-Questions and Answers, June 1993 1-3 OSSA-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.2 Site Area Emergency RED path in F-0.1 SUBCRITICALITY AND either: Emergency boration is inoperable OR Power range not<5%within 15 min.of initiation of emergency boration NUINARC IC: Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and manual scram trip was not successful and there is continued power generation.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTSubcriticality
Power Operations, Hot Shutdown Basis: CSFST Subcriticality
-REDpathisenteredbasedonfailureofpowerrangeindication todecreasebelow5%following areactortrip.ThisportionoftheEALaddresses anymanualtriporautomatic tripsignalfollowedbyamanualtripwhichfailstoshutdownthereactortoanextentthatthereactorisproducing moreheatloadforwhichthesafetysystemsweredesigned.
-RED path is entered based on failure of power range indication to decrease below 5%following a reactor trip.This portion of the EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent that the reactor is producing more heat load for which the safety systems were designed.A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes"control rods to be rapidly inserted into the core and brings power below that percent power associated with the ability of the safety systems to remove heat and continue to decrease." This condition indicates failure of both the automatic and manual protection systems to trip the reactor in conjunction with a failure of alternate boration systems to reduce reactor power below decay heat levels.The combination of failure ofboth front line and backup protection systems to function in response to a plant transient, along with the continued production of heat poses a direct threat to fuel clad and RCS integrity and thus warrants declaration of a Site Area Emergency.
Amanualtripisanysetofactionsbythereactoroperator(s) atthereactorcontrolconsolewhichcauses"controlrodstoberapidlyinsertedintothecoreandbringspowerbelowthatpercentpowerassociated withtheabilityofthesafetysystemstoremoveheatandcontinuetodecrease."
1-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 15 minutes is specified to allow time for emergency boration to be effective and provides a discriminator between SA2.1 and SS2.1.The classification should be made as soon as it is apparent that emergency boration is not or will not be effective in reducing reactor power below 5%.PEG  
Thiscondition indicates failureofboththeautomatic andmanualprotection systemstotripthereactorinconjunction withafailureofalternate borationsystemstoreducereactorpowerbelowdecayheatlevels.Thecombination offailureofbothfrontlineandbackupprotection systemstofunctioninresponsetoaplanttransient, alongwiththecontinued production ofheatposesadirectthreattofuelcladandRCSintegrity andthuswarrantsdeclaration ofaSiteAreaEmergency.
1-4 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev115minutesisspecified toallowtimeforemergency borationtobeeffective andprovidesadiscriminator betweenSA2.1andSS2.1.Theclassification shouldbemadeassoonasitisapparentthatemergency borationisnotorwillnotbeeffective inreducingreactorpowerbelow5%.PEG


==Reference:==
==Reference:==


SS2.1SS4.1BasisReference(s):
SS2.1 SS4.1 Basis Reference(s):
l.2.3.4CSFSTF-0.1,Subcriticality FR-S.1,ResponsetoReactorRestart/ATWS FR-S.2,ResponsetoLossofCoreShutdown"Methodology forDevelopment ofEmergency ActionLevelsNUMARC/NESP-007 Revision2-Questions andAnswers,June19931-5 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.1Subcriticality 1.1.3GeneralEmergency REDpathinF-0.1,SUBCRITICALITY ANDActualorimminententryintoeitherREDpathinF-0.2,CORECOOLINGORREDpathinF-0.3,HEATSINKMBRLRCIC:FailureoftheReactorProtection Systemtocompleteanautomatic tripandmanualtripwasnotsuccessful andthereisindication ofanextremechallenge totheabilitytocoolthecore.FPBloss/potential loss:N/AModeApplicability:
l.2.3.4 CSFST F-0.1, Subcriticality FR-S.1, Response to Reactor Restart/ATWS FR-S.2, Response to Loss of Core Shutdown"Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2-Questions and Answers, June 1993 1-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.3 General Emergency RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK MBRLRC IC: Failure of the Reactor Protection System to complete an automatic trip and manual trip was not successful and there is indication of an extreme challenge to the ability to cool the core.FPB loss/potential loss: N/A Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTSubcriticality
Power Operations, Hot Shutdown Basis: CSFST Subcriticality
-REDpathisenteredbasedon>5%reactorpowerfollowing areactortrip.CSFSTHeatSink-REDpathisenteredbasedonboth:~bothS/G'snarrowrangelevel<5%AND~Totalfeedwater flowtoS/Gs<200gpmCSFSTCoreCooling-REDpathisenteredbasedoneither:~Coreexitthermocouples
-RED path is entered based on>5%reactor power following a reactor trip.CSFST Heat Sink-RED path is entered based on both:~both S/G's narrow range level<5%AND~Total feedwater flow to S/Gs<200 gpm CSFST Core Cooling-RED path is entered based on either:~Core exit thermocouples
>1200'FOR~Coreexitthermocouples
>1200'F OR~Core exit thermocouples
>700'FAND~RVLISlevel<43%w/noRCPs(TAF).1-6 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Thecombination oftheseconditions (reactorpower>5%andHeatSink-REDorCoreCoolingREDpath)indicates theultimateheatsinkfunctionisunderextremechallenge.
>700'F AND~RVLIS level<43%w/no RCPs (TAF).1-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The combination of these conditions (reactor power>5%and Heat Sink-RED or Core Cooling RED path)indicates the ultimate heat sink function is under extreme challenge.
Additionally, theeffortstobringthereactorsubcritical havebeenunsuccessful and,asaresult,thereactorisproducing moreheatloadforwhichthesafetysystemsweredesigned.
Additionally, the efforts to bring the reactor subcritical have been unsuccessful and, as a result, the reactor is producing more heat load for which the safety systems were designed.This situation could be the precursor for a core melt sequence.A major consideration is the inability to initially remove heat during the early stages of this sequence.If emergency feedwater flow is insufficient to remove the amount of heat required by design from at least one steam generator, an extreme challenge should be considered to exist.This equates to a HEAT Sink RED condition.
Thissituation couldbetheprecursor foracoremeltsequence.
If CETs indicate>1200'F or are>700'F with RVLIS<top of active fuel a condition indicative of severe challenge to heat removal also exists.In the event this challenge exists at a time when the reactor has not been brought below the power associated with safety system design power (5%)a core melt sequence is considered to exist.In this situation, core degradation can occur rapidly.For this reason, the General Emergency declaration is intended to be anticipatory of the fission product barrier matrix declaration to permit maximum offsite intervention time.PEG  
Amajorconsideration istheinability toinitially removeheatduringtheearlystagesofthissequence.
Ifemergency feedwater flowisinsufficient toremovetheamountofheatrequiredbydesignfromatleastonesteamgenerator, anextremechallenge shouldbeconsidered toexist.ThisequatestoaHEATSinkREDcondition.
IfCETsindicate>1200'Forare>700'FwithRVLIS<topofactivefuelacondition indicative ofseverechallenge toheatremovalalsoexists.Intheeventthischallenge existsatatimewhenthereactorhasnotbeenbroughtbelowthepowerassociated withsafetysystemdesignpower(5%)acoremeltsequenceisconsidered toexist.Inthissituation, coredegradation canoccurrapidly.Forthisreason,theGeneralEmergency declaration isintendedtobeanticipatory ofthefissionproductbarriermatrixdeclaration topermitmaximumoffsiteintervention time.PEG


==Reference:==
==Reference:==


SG2.1BasisReference(s):
SG2.1 Basis Reference(s):
l.2.3.3.4CSFSTF-0.3,HeatSinkCSFSTF-0.1,Subcriticality CSFSTF-0.2,CoreCoolingFR-S.1,ResponsetoReactorRestart/ATWS FR-S.2,ResponsetoLossofCoreShutdown1-7 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.2CoreCooling1.2.1SiteAreaEmergency ORANGEorREDpathinF-0.2,CORECOOLING1%JMARCIC:Completelossoffunctionneededtoachieveormaintainhotshutdownwithreactorcoolant)200'F.FPBloss/potential loss:Fuelcladpotential loss,RCSlossModeApplicability:
l.2.3.3.4 CSFST F-0.3, Heat Sink CSFST F-0.1, Subcriticality CSFST F-0.2, Core Cooling FR-S.1, Response to Reactor Restart/ATWS FR-S.2, Response to Loss of Core Shutdown 1-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.1 Site Area Emergency ORANGE or RED path in F-0.2, CORE COOLING 1%JMARC IC: Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant)200'F.FPB loss/potential loss: Fuel clad potential loss, RCS loss Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTCoreCooling-ORANGEpathisenteredbasedoneither:~Coreexitthermocouples
Power Operations, Hot Shutdown Basis: CSFST Core Cooling-ORANGE path is entered based on either:~Core exit thermocouples
)700'FOR~RVLISlevel(43%w/noRCPs(TAF)Eithercondition indicates subcooling hasbeenlostandthatsomecladdamagemayoccur.ItmustalsobeassumedthatthelossofRCSinventory isaresultofalossofRCSbarrier.Therefore aSiteAreaEmergency iswarranted baseduponthepotential lossoffuelcladwithlossofRCSbarriers.
)700'F OR~RVLIS level (43%w/no RCPs (TAF)Either condition indicates subcooling has been lost and that some clad damage may occur.It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.Therefore a Site Area Emergency is warranted based upon the potential loss of fuel clad with loss of RCS barriers.PEG  
PEG


==Reference:==
==Reference:==


FC1.2FC3-.2FC4.1SS4.1BasisReference(s):
FC1.2 FC3-.2 FC4.1 SS4.1 Basis Reference(s):
1.CSFSTF-0.2,CoreCooling1-8 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.2CoreCooling1.2.2GeneralEmergency REDpathinF-0.2,CORECOOLINGANDFunctional restoration procedures noteffective within15min.NUINARCIC:N/AFPBloss/potential loss:Fuelcladlos,Sloss,Containment potential lossModeApplicability:
1.CSFST F-0.2, Core Cooling 1-8 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.2 General Emergency RED path in F-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.NUINARC IC: N/A FPB loss/potential loss: Fuel clad los, S loss, Containment potential loss Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTCoreCooling-REDpathisenteredbasedoneither:~Coreexitthermocouples
Power Operations, Hot Shutdown Basis: CSFST Core Cooling-RED path is entered based on either:~Core exit thermocouples
>1200'FOR~Coreexitthermocouples
>1200'F OR~Core exit thermocouples
>700'FAND~RVLISlevel<43%(TAF)Eithercondition indicates significant coreexitsuperheating andcoreuncoveryandisconsidered alossoftheFuelCladBarrier.ItmustalsobeassumedthatthelossofRCSinventory isaresultofalossofRCSbarrier.Theseconditions, ifnotmitigated, willlikelyleadtocoremeltwhichwillinturnresultinapotential lossofcontainment.
>700'F AND~RVLIS level<43%(TAF)Either condition indicates significant core exit superheating and core uncovery and is considered a loss of the Fuel Clad Barrier.It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.These conditions, if not mitigated, will likely lead to core melt which will in turn result in a potential loss of containment.
Therefore, declaration ofaGeneralEmergency iswarranted.
Therefore, declaration of a General Emergency is warranted.
Severeaccidentanalyses(e.g.,NUREG-1150) haveconcluded thatfunctionrestoration procedures canarrestcoredegradation withinthereactorvesselinasignificant fractionofthecoredamagescenarios, andthatthelikelihood ofcontainment failureisverysmallintheseevents.Giventhis,itisappropriate toprovideareasonable periodtoallowfunctionrestoration
Severe accident analyses (e.g., NUREG-1150) have concluded that function restoration procedures can arrest core degradation within the reactor vessel in a significant fraction of the core damage scenarios, and that the likelihood of containment failure is very small in these events.Given this, it is appropriate to provide a reasonable period to allow function restoration
'rocedures toarrestthecoremeltsequence.
'rocedures to arrest the core melt sequence.Whether or not procedures will be effective should be apparent within 15 minutes.The Emergency 1-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Coordinator should make the declaration as soon as it is determined that the procedures have not been, or will not be effective.
Whetherornotprocedures willbeeffective shouldbeapparentwithin15minutes.TheEmergency 1-9 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Coordinator shouldmakethedeclaration assoonasitisdetermined thattheprocedures havenotbeen,orwillnotbeeffective.
For the purpose of this EAL the term'effective'ith regards to functional restoration procedures means that the CSFST Core Cooling-RED path entry criterion no longer exists.PEG  
ForthepurposeofthisEALtheterm'effective'ith regardstofunctional restoration procedures meansthattheCSFSTCoreCooling-REDpathentrycriterion nolongerexists.PEG


==Reference:==
==Reference:==


FC1.1PC6.1PC6.2BasisReference(s):
FC1.1 PC6.1 PC6.2 Basis Reference(s):
1.CSFSTF-0.2,CoreCooling1-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.3HeatSink1.3.1SiteAreaEmergency REDpathinF-0.3,HEATSINKNUINARCIC:Completelossoffunctionneededtoachieveormaintainhotshutdownwithreactorcoolant>200'F.FPBloss/potential loss:Fuelcladpotential loss,RCSpotential lossModeApplicability:
1.CSFST F-0.2, Core Cooling 1-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.3 Heat Sink 1.3.1 Site Area Emergency RED path in F-0.3, HEAT SINK NUINARC IC: Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant>200'F.FPB loss/potential loss: Fuel clad potential loss, RCS potential loss Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTHeatSink-REDpathisenteredbasedonboth:~bothS/0'snarrowrangelevel<5%AND~Totalfeedwater flowtoS/Gs<200gpmThecombination ofthesetwoconditions indicates theultimateheatsinkfunctionisunderextremechallenge.
Power Operations, Hot Shutdown Basis: CSFST Heat Sink-RED path is entered based on both:~both S/0's narrow range level<5%AND~Total feedwater flow to S/Gs<200 gpm The combination of these two conditions indicates the ultimate heat sink function is under extreme challenge.
ThisEALaddresses lossoffunctions requiredforhotshutdownwiththereactoratpressureandtemperature.
This EAL addresses loss of functions required for hot shutdown with the reactor at pressure and temperature.
Undertheseconditions, thereisanactualmajorfailureofasystemintendedforprotection ofthepublicwithpotential formultiplefissionproductbarrierloss.Therefore, declaration ofaSiteAreaEmergency iswarranted.
Under these conditions, there is an actual major failure of a system intended for protection of the public with potential for multiple fission product barrier loss.Therefore, declaration of a Site Area Emergency is warranted.
PEG
PEG  


==Reference:==
==Reference:==


FC1.3RCS1.2SS4.1BasisReference(s):
FC1.3 RCS1.2 SS4.1 Basis Reference(s):
1.'SFSTF-0.3,HeatSink1-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.4Integrity 1.4.1AlertREDpathonF-0.4,INTEGRITY NU1VCARCIC:N/AFPBloss/potential loss:RCSpotential lossModeApplicability:
1.'SFST F-0.3, Heat Sink 1-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.4 Integrity 1.4.1 Alert RED path on F-0.4, INTEGRITY NU1VCARC IC: N/A FPB loss/potential loss: RCS potential loss Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTIntegrity
Power Operations, Hot Shutdown Basis: CSFST Integrity-RED path is entered based on both:~exceeding RCS cooldown rate of 100'F/hr AND~all RCS cold leg temperatures to the leR of the RCS Pressure/RCS Cold Leg Temperature Curve The combination of these'wo conditions indicates the RCS barrier is under significant challenge and should be considered a potential loss of RCS barrier.Any loss or potential loss of RCS barrier warrants declaration of an Alert.PEG  
-REDpathisenteredbasedonboth:~exceeding RCScooldownrateof100'F/hrAND~allRCScoldlegtemperatures totheleRoftheRCSPressure/RCS ColdLegTemperature CurveThecombination ofthese'woconditions indicates theRCSbarrierisundersignificant challenge andshouldbeconsidered apotential lossofRCSbarrier.Anylossorpotential lossofRCSbarrierwarrantsdeclaration ofanAlert.PEG


==Reference:==
==Reference:==


RCS1.1BasisReference(s):
RCS1.1 Basis Reference(s):
*1.CSFSTF-0.4,Integrity 1-12 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev11.0CSFSTStatus1.5Contaixunent 1.5.1GeneralEmergency REDpathF-0.5,CONTAINMENT NUINARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSloss,Containment potential lossModeApplicability:
*1.CSFST F-0.4, Integrity 1-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.5 Contaixunent 1.5.1 General Emergency RED path F-0.5, CONTAINMENT NUINARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
PowerOperations, HotShutdownBasis:CSFSTContainment
Power Operations, Hot Shutdown Basis: CSFST Containment
-REDpathisenteredbasedonexceeding containment designpressureof60psig.Thispressureiswellinexcessofthatexpectedfromthedesignbasislossofcoolantaccident.
-RED path is entered based on exceeding containment design pressure of 60 psig.This pressure is well in excess of that expected from the design basis loss of coolant accident.This is indicative of a loss of both RCS and fuel clad boundaries in that it is not possible to reach this condition without severe core degradation (metal-water reaction)or failure to scram in combination with RCS breach.Since containment pressures at or approaching design levels is also a potential loss of containment,'this combination of conditions requires the declaration of a General Emergency.
Thisisindicative ofalossofbothRCSandfuelcladboundaries inthatitisnotpossibletoreachthiscondition withoutseverecoredegradation (metal-water reaction) orfailuretoscramincombination withRCSbreach.Sincecontainment pressures atorapproaching designlevelsisalsoapotential lossofcontainment,'this combination ofconditions requiresthedeclaration ofaGeneralEmergency.
PEG  
PEG


==Reference:==
==Reference:==


PC1.1BasisReference(s):
PC1.1 Basis Reference(s):
1.CSFSTF-0.5,Containment 1-13 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Thereactorfuelcladdingservesastheprimaryfissionproductbarrier.Overtheusefullifeofafuelbundle,theintegrity ofthisbarriershouldremainintactaslongasfuelcladdingintegrity limitsarenotexceeded.
1.CSFST F-0.5, Containment 1-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor fuel cladding serves as the primary fission product barrier.Over the useful life of a fuel bundle, the integrity of this barrier should remain intact as long as fuel cladding integrity limits are not exceeded.Should'fuel damage occur (breach of the fuel cladding integrity) radioactive fission products are released to the reactor coolant.The magnitude of such a release is dependent upon the extent of the damage as well as the mechanism by which the damage occurred.Once released into the reactor coolant, the highly, radioactive fission products can pose significant radiological hazards inplant from reactor coolant process streams.If other fission product barriers were to fail, these radioactive fission products can pose significant offsite radiological consequences.
Should'fuel damageoccur(breachofthefuelcladdingintegrity) radioactive fissionproductsarereleasedtothereactorcoolant.Themagnitude ofsuchareleaseisdependent upontheextentofthedamageaswellasthemechanism bywhichthedamageoccurred.
The following parameters/indicators are indicative of possible fuel failures: A'g a i, t 1 fi product activity is very low.Small concentrations of fission products in'he coolant are primarily from the fission of tramp uranium in the fuel cladding or minor perforations in the cladding itself.Any significant increase from these base-line levels is indicative of fuel failures.~F il F l 0'As with coolant activity, any fuel failures will release fission products to the reactor coolant.These fission products will be circulated with the reactor coolant and be detected by the failed fuel radiation detector in the RCS letdown line.i n Although not a direct indication or measurement of fuel damage, exceeding predetermined limits on containment high range radiation monitors under LOCA conditions is indicative possible fuel failures.~f lin A'r i i nM ni r'othareaand process radiation monitoring systems designed to detect fission products during refueling conditions as well as visual observation can be utilized to indicate loss or potential loss of spent fuel cladding integrity.
Oncereleasedintothereactorcoolant,thehighly,radioactive fissionproductscanposesignificant radiological hazardsinplantfromreactorcoolantprocessstreams.Ifotherfissionproductbarriersweretofail,theseradioactive fissionproductscanposesignificant offsiteradiological consequences.
2-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.1 Unusual Event Coolant sample activity:)100%of 84/E bar p,Ci/cc total specific activity OR>0.2 p,Ci/gm I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded NUINARC IC: Fuel clad degradation FPB loss/potential loss: N/A Mode Applicability:
Thefollowing parameters/indicators areindicative ofpossiblefuelfailures:
Basis: Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This EAL addresses reactor coolant samples exceeding coolant technical specifications.
A'gai,t1fiproductactivityisverylow.Smallconcentrations offissionproductsin'hecoolantareprimarily fromthefissionoftrampuraniuminthefuelcladdingorminorperforations inthecladdingitself.Anysignificant increasefromthesebase-line levelsisindicative offuelfailures.
PEG  
~FilFl0'Aswithcoolantactivity, anyfuelfailureswillreleasefissionproductstothereactorcoolant.Thesefissionproductswillbecirculated withthereactorcoolantandbedetectedbythefailedfuelradiation detectorintheRCSletdownline.inAlthoughnotadirectindication ormeasurement offueldamage,exceeding predetermined limitsoncontainment highrangeradiation monitorsunderLOCAconditions isindicative possiblefuelfailures.
~flinA'riinMnir'othareaand processradiation monitoring systemsdesignedtodetectfissionproductsduringrefueling conditions aswellasvisualobservation canbeutilizedtoindicatelossorpotential lossofspentfuelcladdingintegrity.
2-1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.1CoolantActivity2.1.1UnusualEventCoolantsampleactivity:
)100%of84/Ebarp,Ci/cctotalspecificactivityOR>0.2p,Ci/gmI-131equivalent andtheconditions ofTechnical Specifications 3.1.4.3.b areexceededNUINARCIC:Fuelcladdegradation FPBloss/potential loss:N/AModeApplicability:
Basis:Elevatedreactorcoolantactivityrepresents apotential degradation inthelevelofsafetyoftheplantandapotential precursor ofmoreseriousproblems.
ThisEALaddresses reactorcoolantsamplesexceeding coolanttechnical specifications.
PEG


==Reference:==
==Reference:==


SU4.2BasisReference(s):
SU4.2 Basis Reference(s):
1.Technical Specifications section3.1.42-2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.1CoolantActivity2.1.2AlertCoolantactivity>300p.Ci/ccI-131equivalent IMUIKARCIC:N/AFPBloss/potential loss:FuelcladlossModeApplicability:
1.Technical Specifications section 3.1.4 2-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.2 Alert Coolant activity>300 p.Ci/cc I-131 equivalent IMUIKARC IC: N/A FPB loss/potential loss: Fuel clad loss Mode Applicability:
Poweroperation, hotshutdownBasis:Elevatedreactorcoolantactivityrepresents apotential degradation inthelevelofsafetyoftheplantandapotential precursor ofmoreseriousproblems.
Power operation, hot shutdown Basis: Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This amount of coolant activity corresponds to about 2%to 5%fuel clad damage.When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.Therefore, declaration of an Alert is warranted.
Thisamountofcoolantactivitycorresponds toabout2%to5%fuelcladdamage.Whenreactorcoolantactivityreachesthislevel,significant cladheatinghasoccurredandthusthefuelcladbarrierisconsidered lost.Therefore, declaration ofanAlertiswarranted.
PEG  
PEG


==Reference:==
==Reference:==


FC2.1BasisReference(s):
FC2.1 Basis Reference(s):
None2-3  
None 2-3  
,OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.1CoolantActivity2.1.3SiteAreaEmergency Coolantactivity>300pCi/ccI-131equivalent andanyofthefollowing:
, OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.3 Site Area Emergency Coolant activity>300 pCi/cc I-131 equivalent and any of the following:
~REDpathonF-0.4,INTEGRITY
~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling
~Primarysystemleakage>46gpm~RCSsubcooling
<EOP Fig.MIN SUBCOOLING due to RCS leakage MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS potential loss/loss Node Applicability:
<EOPFig.MINSUBCOOLING duetoRCSleakageMMARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSpotential loss/loss NodeApplicability:
Power operation, hot shutdown Basis: This EAL addresses combinations of fuel clad loss with RCS loss and potential loss indicators.
Poweroperation, hotshutdownBasis:ThisEALaddresses combinations offuelcladlosswithRCSlossandpotential lossindicators.
300 pCi/cc I-131 equivalent coolant activity corresponds to about 2%to 5%fuel clad damage.When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:
300pCi/ccI-131equivalent coolantactivitycorresponds toabout2%to5%fuelcladdamage.Whenreactorcoolantactivityreachesthislevel,significant cladheatinghasoccurredandthusthefuelcladbarrierisconsidered lost.Thiscondition incombination withanyofthefollowing RCSloss/potential lossindicators warrantsdeclaration ofaSiteAreaEmergency:
RED path on F-0.4, INTEGRITY:
REDpathonF-0.4,INTEGRITY:
RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.RCS subcooling
REDpathindicates anextremechallenge tothesafetyfunctionderivedfromappropriate instrument
<EOP Fig.MIN SUBCOOLING:
: readings, andindicates apotential lossofRCSbarrier.RCSsubcooling
This indicator addresses'conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the.fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.
<EOPFig.MINSUBCOOLING:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage>46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG  
Thisindicator addresses
'conditions whereleakagefromtheRCSisgreaterthanavailable inventory controlcapacitysuchthatalossofsubcooling hasoccurred.
Thelossofsubcooling asdetermined fromE-O,ReactorTriporSafetyInjection isthe.fundamental indication thattheinventory controlsystemsareinadequate inmaintaining RCSpressureandinventory againstthemasslossthroughaleak.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Primarysystemleakage>46gpm:Thispotential lossofRCSisbasedontheinability tomaintainnormalliquidinventory withintheReactorCoolantSystem(RCS)bynormaloperation oftheChemicalandVolumeControlSystemwhichisconsidered astwopositivedisplacement chargingpumpsdischarging tothechargingheader.PEG


==Reference:==
==Reference:==


FC2.1+RCS1.1,RCS2.1andRCS2.2BasisReference(s):
FC2.1+RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):
1.2.3.45.EPIP-2-16"CoreDamageEstimation" CSFSTF-0.4Integrity E-O,ReactorTriporSafetyInjection Technical Specifications Section3.1.5.2FSARTable9.3.62-5 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.2FailedFuelDetectors 2.2.1UnusualEventLetdownLineMonitorR-9>2R/hrNUMARCIC:Fuelcladdegradation FPBloss/potential loss:N/AModeApplicability:
1.2.3.4 5.EPIP-2-16"Core Damage Estimation" CSFST F-0.4 Integrity E-O, Reactor Trip or Safety Injection Technical Specifications Section 3.1.5.2 FSAR Table 9.3.6 2-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.1 Unusual Event Letdown Line Monitor R-9>2 R/hr NUMARC IC: Fuel clad degradation FPB loss/potential loss: N/A Mode Applicability:
Basis:Elevatedletdownlineactivityrepresents apotential degradation inthelevelofsafetyoftheplantandapotential precursor ofmoreseriousproblems.
Basis: Elevated letdown line activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This radiation level (2 H/hr)corresponds to 1%fuel failure (bases for the Technical Specifications coolant activity limits).Therefore, declaration of an Unusual Event is warranted.
Thisradiation level(2H/hr)corresponds to1%fuelfailure(basesfortheTechnical Specifications coolantactivitylimits).Therefore, declaration ofanUnusualEventiswarranted.
PEG  
PEG


==Reference:==
==Reference:==


SU4.1BasisReference(s):
SU4.1 Basis Reference(s):
1.Technical Specifications section3.1.42.P-9"Radiation Monitoring System"3.EPIP2-16section6.2.l.b2-6 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.2FailedFuelDetectors 2.2.2AlertLetdownLineMonitorR-9>10R/hrMMARCIC:N/AFPBloss/potential loss:FuelcladlossModeApplicability:
1.Technical Specifications section 3.1.4 2.P-9"Radiation Monitoring System" 3.EPIP 2-16 section 6.2.l.b 2-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.2 Alert Letdown Line Monitor R-9>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad loss Mode Applicability:
Poweroperation, hotshutdownBasis:Thiscondition indicates thelossofthefuelcladbarrier.FailedFuelMonitorreadingsof2R/hrcorresponds to1%fuelfailures.
Power operation, hot shutdown Basis: This condition indicates the loss of the fuel clad barrier.Failed Fuel Monitor readings of 2 R/hr corresponds to 1%fuel failures.Failed Fuel Monitor readings of 10 R/hr corresponds to 5%fuel failures and is considered an actual loss of fuel clad.Note: Monitor R-9 automatically shifts scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.PEG  
FailedFuelMonitorreadingsof10R/hrcorresponds to5%fuelfailuresandisconsidered anactuallossoffuelclad.Note:MonitorR-9automatically shiftsscalefrommR/hrtoR/hrwhenindicated valuesexceed1000mR/hr.PEG


==Reference:==
==Reference:==


FC6.1BasisReference(s):
FC6.1 Basis Reference(s):
l.EPIP-2-16"CoreDamageEstimation" 2.P-9"Radiation Monitoring System"3.EPIP2-16section6.2.1.b2-7 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.2FailedFuelDetectors 2.2.3SiteAreaEmergency LetdownLineMonitorR-9>108/hrandanyofthefollowing:
l.EPIP-2-16"Core Damage Estimation" 2.P-9"Radiation Monitoring System" 3.EPIP 2-16 section 6.2.1.b 2-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.3 Site Area Emergency Letdown Line Monitor R-9>10 8/hr and any of the following:
~REDpathonF-0.4,INTEGRITY
~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling
~Primarysystemleakage>46gpm~RCSsubcooling
<EOP Fig.MIN SUBCOOLING due to RCS leakage NUIKARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS potential loss Mode Applicability:
<EOPFig.MINSUBCOOLING duetoRCSleakageNUIKARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSpotential lossModeApplicability:
Power operation, hot shutdown Basis: This EAL addresses combinations of fuel clad.loss with RCS loss and potential loss indicators.
Poweroperation, hotshutdownBasis:ThisEALaddresses combinations offuelclad.losswithRCSlossandpotential lossindicators.
Failed Fuel Monitor readings of 10 R/hr corresponds to 5%fuel failures.This condition indicates the loss of the fuel clad barrier.Note: Monitor R-9 automatically shiRs scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:
FailedFuelMonitorreadingsof10R/hrcorresponds to5%fuelfailures.
RED path on F-0.4, INTEGRITY:
Thiscondition indicates thelossofthefuelcladbarrier.Note:MonitorR-9automatically shiRsscalefrommR/hrtoR/hrwhenindicated valuesexceed1000mR/hr.Thiscondition incombination withanyofthefollowing RCSloss/potential lossindicators warrantsdeclaration ofaSiteAreaEmergency:
RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.RCS subcooling
REDpathonF-0.4,INTEGRITY:
<EOP Fig.MIN SUBCOOLING:
REDpathindicates anextremechallenge tothesafetyfunctionderivedfromappropriate instrument
This indicator addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.
: readings, andindicates apotential lossofRCSbarrier.RCSsubcooling
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage>46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG  
<EOPFig.MINSUBCOOLING:
Thisindicator addresses conditions whereleakagefromtheRCSisgreaterthanavailable inventory controlcapacitysuchthatalossofsubcooling hasoccurred.
Thelossofsubcooling asdetermined fromE-O,ReactorTriporSafetyInjection isthefundamental indication thattheinventory controlsystemsareinadequate inmaintaining RCSpressureandinventory againstthemasslossthroughaleak.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Primarysystemleakage>46gpm:Thispotential lossofRCSisbasedontheinability tomaintainnormalliquidinventory withintheReactorCoolantSystem(RCS)bynormaloperation oftheChemicalandVolumeControlSystemwhichisconsidered astwopositivedisplacement chargingpumpsdischarging tothechargingheader.PEG


==Reference:==
==Reference:==


FC6.1+RCS1.1,RCS2.1andRCS2.2BasisReference(s):
FC6.1+RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):
1.2.3.45.6.7.EPIP-2-16"CoreDamageEstimation" CSFSTF-0.4Integrity E-O,ReactorTriporSafetyInjection F-0.5,Containment FR-Z.1,ResponsetoHighContainment Radiation LevelTechnical Specifications Section3.1.5.2FSARTable9.3.62-9 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.3Containment Radiation 2.3.1AlertContainment radiation monitorR-29/R-30 reading)10R/hrMB4ARCIC:N/AFPBloss/potential loss:RCSlossModeApplicability:
1.2.3.4 5.6.7.EPIP-2-16"Core Damage Estimation" CSFST F-0.4 Integrity E-O, Reactor Trip or Safety Injection F-0.5, Containment FR-Z.1, Response to High Containment Radiation Level Technical Specifications Section 3.1.5.2 FSAR Table 9.3.6 2-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading)10 R/hr MB4ARC IC: N/A FPB loss/potential loss: RCS loss Mode Applicability:
Poweroperation, hotshutdownBasis:Thel0R/hrreadingisavaluewhichindicates thereleaseofreactorcoolanttothecontainment.
Power operation, hot shutdown Basis: Thel0 R/hr reading is a value which indicates the release of reactor coolant to the containment.
Thereadingwasderivedassumingtheinstantaneous releaseanddispersal ofthereactorcoolantnoblegasandiodineinventory associated withnormaloperating concentrations (i.e.,withinT/S)intothecontainment atmosphere.
The reading was derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with normal operating concentrations (i.e., within T/S)into the containment atmosphere.
ThisEALisindicative ofaRCSleakonly.Iftheradiation monitorreadingincreased tothatspecified byReactorFuelEAL2.3.2,significant fueldamagewouldalsobeindicated.
This EAL is indicative of a RCS leak only.If the radiation monitor reading increased to that specified by Reactor Fuel EAL 2.3.2, significant fuel damage would also be indicated.
PEG
PEG  


==Reference:==
==Reference:==


RCS4.1BasisReference(s):
RCS4.1 Basis Reference(s):
1.F-0.5,Containment 2.FR-Z.1,ResponsetoHighContainment Radiation Level3.EPIP2-16,CoreDamageEstimation 2-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.3Containment Radiation 2.3.2SiteAreaEmergency Containment radiation monitorR-29/R-30 reading>100R/hrNUMARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSlossModeApplicability:
1.F-0.5, Containment 2.FR-Z.1, Response to High Containment Radiation Level 3.EPIP 2-16, Core Damage Estimation 2-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.2 Site Area Emergency Containment radiation monitor R-29/R-30 reading>100 R/hr NUMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss Mode Applicability:
Poweroperation, hotshutdownBasis:The100R/hrreadingisavaluewhichindicates thereleaseofreactorcoolant,withelevatedactivityindicative offueldamage,intothecontainment.
Power operation, hot shutdown Basis: The 100 R/hr reading is a value which indicates the release of reactor coolant, with elevated activity indicative of fuel damage, into the containment.
Thereadingisderivedassumingtheinstantaneous releaseanddispersal ofthereactorcoolantnoblegasandiodineinventory associated withaconcentration of300p.Ci/gmdoseequivalent I-131intothecontainment atmosphere.
The reading is derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with a concentration of 300 p.Ci/gm dose equivalent I-131 into the containment atmosphere.
Reactorcoolantconcentrations ofthismagnitude areseveraltimeslargerthanthemaximumconcentrations (including iodinespiking)allowedwithintechnical specifications andaretherefore indicative offueldamage(approximately 2-5%cladfailuredepending oncoreinventory andRCSvolume).Thisvalueishigherthanthatspecified inEAL2.3.1whichwouldbeindicative ofonlytheRCSbarrier.Thus,thisEALindicates alossofboththefuelcladbarrierandalossofRCSbarrierwarranting declaration ofaSiteAreaEmergency.
Reactor coolant concentrations of this magnitude are several times larger than the maximum concentrations (including iodine spiking)allowed within technical specifications and are therefore indicative of fuel damage (approximately 2-5%clad failure depending on core inventory and RCS volume).This value is higher than that specified in EAL 2.3.1 which would be indicative of only the RCS barrier.Thus, this EAL indicates a loss of both the fuel clad barrier and a loss of RCS barrier warranting declaration of a Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


FC5.1BasisReference(s):
FC5.1 Basis Reference(s):
1.P-9,Radiation Monitoring System,Section2.2.2.6,pg.P-9:22.EPIP2-16,CoreDamageEstimation 2-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.3Containment Radiation 2.3.3GeneralEmergency Containment radiation monitorR-29/R-30 reading>1000R/hrNUINARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSloss,Containment potential lossModeApplicability:
1.P-9, Radiation Monitoring System, Section 2.2.2.6, pg.P-9:2 2.EPIP 2-16, Core Damage Estimation 2-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.3 General Emergency Containment radiation monitor R-29/R-30 reading>1000 R/hr NUINARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Poweroperation, hotshutdownBasis:The1000H/hrreadingisavaluewhichindicates significant fueldamage(>20%cladfailure)wellinexcessoftheEALsassociated withbothlossoffuelcladandlossofRCSbarriers.
Power operation, hot shutdown Basis: The 1000 H/hr reading is a value which indicates significant fuel damage (>20%clad failure)well in excess of the EALs associated with both loss of fuel clad and loss of RCS barriers.A major release of radioactivity requiring offsite protective actions from core damage is not possible unless a major failure of fuel cladding allows radioactive material to be released from the core into the reactor coolant.Regardless of whether containment is challenged, this amount of activity in containment, if released, could have such severe consequences that it is prudent to treat this as a potential loss of containment, such that a General Emergency declaration is warranted.
Amajorreleaseofradioactivity requiring offsiteprotective actionsfromcoredamageisnotpossibleunlessamajorfailureoffuelcladdingallowsradioactive materialtobereleasedfromthecoreintothereactorcoolant.Regardless ofwhethercontainment ischallenged, thisamountofactivityincontainment, ifreleased, couldhavesuchsevereconsequences thatitisprudenttotreatthisasapotential lossofcontainment, suchthataGeneralEmergency declaration iswarranted.
NUREG-1228"Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents," indicates that such conditions do not exist when the amount of clad damage is less than 20%.PEG  
NUREG-1228 "SourceEstimations DuringIncidentResponsetoSevereNuclearPowerPlantAccidents,"
indicates thatsuchconditions donotexistwhentheamountofcladdamageislessthan20%.PEG


==Reference:==
==Reference:==


PC5.12-12 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
PC5.1 2-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.2.3.EPIP1-0,GinnaStationEventEvaluation andClassification EPIP2-16,CoreDamageEstimation NUREG-1228 "SourceEstimations DuringIncidentResponsetoSevereNuclearPowerPlantAccidents" Technology forEnergyReportNo.R-81-0122-13 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.3Refueling Accidents orOtherRadiation Monitors2.4.1UnusualEventSpentfuelpool(reactorcavityduringrefueling) waterlevelcannotberestoredandmaintained abovethespentfuelpoollowwaterlevelalarmsetpointNl3EIARCIC:Unexpected increaseinplantradiation orairborneconcentration.
1.2.3.EPIP 1-0, Ginna Station Event Evaluation and Classification EPIP 2-16, Core Damage Estimation NUREG-1228"Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents" Technology for Energy Report No.R-81-012 2-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint Nl3EIARC IC: Unexpected increase in plant radiation or airborne concentration.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
Basis:InlightofReactorCavitySealfailure,incidents attwodifferent PWRsandlossofwaterintheSpentFuelPit/FuelTransferCanalataBWRalloccurring since1984,explicitcoverageofthesetypesofeventsviaEALs&#xb9;1and&#xb9;2isappropriate giventheirpotential forincreased dosestoplantstaKClassification asanUnusualEventiswarranted asaprecursor toamoreseriousevent.Thespentfuelpoollowwaterlevelalarmsetpointof20in.belowtopofpoolisactuatedbyLC-661.Thedefinition of"...cannotberestoredandmaintained above..."allowstheoperatortovisuallyobservethelowwaterlevelcondition, ifpossible, andtoattemptwaterlevelrestoration instructions aslongaswaterlevelremainsabovethetopofirradiated fuel.Waterlevelrestoration instructions forlossofrefueling cavitywaterlevelduringrefueling areperformed inaccordance withtheRF-65seriesofprocedures.
Basis: In light of Reactor Cavity Seal failure, incidents at two different PWRs and loss of water in the Spent Fuel Pit/Fuel Transfer Canal at a BWR all occurring since 1984, explicit coverage of these types of events via EALs&#xb9;1 and&#xb9;2 is appropriate given their potential for increased doses to plant staK Classification as an Unusual Event is warranted as a precursor to a more serious event.The spent fuel pool low water level alarm setpoint of 20 in.below top of pool is actuated by LC-661.The definition of"...cannot be restored and maintained above..." allows the operator to visually observe the low water level condition, if possible, and to attempt water level restoration instructions as long as water level remains above the top of irradiated fuel.Water level restoration instructions for loss of refueling cavity water level during refueling are performed in accordance with the RF-65 series of procedures.
Whenthefueltransfercanalisdirectlyconnected tothespentfuelpoolandreactorcavity,therecouldexistthepossibility ofuncovering irradiated fuelinthefueltransfercanal.Therefore, thisEALisapplicable forconditions i'whichirradiated fuelisbeingtransferred toandfromtheRPVandspentfuelpool.2-14T OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG
When the fuel transfer canal is directly connected to the spent fuel pool and reactor cavity, there could exist the possibility of uncovering irradiated fuel in the fuel transfer canal.Therefore, this EAL is applicable for conditions i'which irradiated fuel is being transferred to and from the RPV and spent fuel pool.2-14 T OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==


AU2.1BasisReference(s):
AU2.1 Basis Reference(s):
1.ER-SFP.1"LossofSpentFuelPitCooling"2.AR-K-293.RF-65series2-15 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel2.3Refueling Accidents orOtherRadiation Monitors2.4.2AlertConfirmed sustained alarmonanyofthefollowing radiation monitorsresulting fromanuncontrolled fuelhandlingprocess:~R-2Containment AreaMonitor~R-5SpentFuelPit~R-12Containment NobleGasNUMARCIC:Majordamagetoirradiated fuelorlossofwaterlevelthathasorwillresultintheuncovering ofirradiated fueloutsidethereactorvessel.FPBloss/potential loss:N/AModeApplicability:
1.ER-SFP.1"Loss of Spent Fuel Pit Cooling" 2.AR-K-29 3.RF-65 series 2-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.2 Alert Confirmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:~R-2 Containment Area Monitor~R-5 Spent Fuel Pit~R-12 Containment Noble Gas NUMARC IC: Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.FPB loss/potential loss: N/A Mode Applicability:
AllBasis:NUREG-0818, "Emergency ActionLevelsforLightWaterReactors,"
All Basis: NUREG-0818,"Emergency Action Levels for Light Water Reactors," forms the basis for this EAL.This EAL is defined by the specific area where irradiated fuel is located such as reactor cavity, reactor vessel, or spent fuel pool.NUREG/CR-4982,"Severe Accident in Spent Fuel Pools in Support, of Generic Safety Issue 82," July 1987, indicates that even if corrective actions are not taken, no prompt fatalities are predicted, and that risk of injury is low.In addition, NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" presents the following in its discussion: "In the event of a serious accident involving decayed spent fuel, protective actions would be needed for personnel on site, while offsite doses (assuming an exclusion area radius of one mile from the plant site)would be well below the Environmental Protecti'on Agency's Protective Action Guides.Accordingly, it is important to be able to properly survey and monitor for Kr-85 in the event of an accident with'decayed spent fuel." 2-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 W An"uncontrolled fuel handling process" is defined as any event or activity related to the movement of irradiated fuel which results in unexpected or uncontrolled conditions.
formsthebasisforthisEAL.ThisEALisdefinedbythespecificareawhereirradiated fuelislocatedsuchasreactorcavity,reactorvessel,orspentfuelpool.NUREG/CR-4982, "SevereAccidentinSpentFuelPoolsinSupport,ofGenericSafetyIssue82,"July1987,indicates thatevenifcorrective actionsarenottaken,nopromptfatalities arepredicted, andthatriskofinjuryislow.Inaddition, NRCInformation NoticeNo.90-08,"KR-85HazardsfromDecayedFuel"presentsthefollowing initsdiscussion:
This terminology has been specifically added to exclude anticipated increases in area radiation levels as a result of actions performed in accordance with approved procedures during refueling operations.
"Intheeventofaseriousaccidentinvolving decayedspentfuel,protective actionswouldbeneededforpersonnel onsite,whileoffsitedoses(assuming anexclusion arearadiusofonemilefromtheplantsite)wouldbewellbelowtheEnvironmental Protecti'on Agency'sProtective ActionGuides.Accordingly, itisimportant tobeabletoproperlysurveyandmonitorforKr-85intheeventofanaccidentwith'decayedspentfuel."2-16 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1WAn"uncontrolled fuelhandlingprocess"isdefinedasanyeventoractivityrelatedtothemovementofirradiated fuelwhichresultsinunexpected oruncontrolled conditions.
Thus, an Alert Classification for this event is appropriate.
Thisterminology hasbeenspecifically addedtoexcludeanticipated increases inarearadiation levelsasaresultofactionsperformed inaccordance withapprovedprocedures duringrefueling operations.
Escalation, if appropriate, would occur via Emergency Coordinator judgment in EAL Category 9.0.The basis for the Containment Area Monitor setpoint (50 mR/hr)and Spent Fuel Pit monitor setpoint (25 mH/hr)are a spent fuel handling accident and is, therefore, appropriate for this EAL.PEG  
Thus,anAlertClassification forthiseventisappropriate.
Escalation, ifappropriate, wouldoccurviaEmergency Coordinator judgmentinEALCategory9.0.ThebasisfortheContainment AreaMonitorsetpoint(50mR/hr)andSpentFuelPitmonitorsetpoint(25mH/hr)areaspentfuelhandlingaccidentandis,therefore, appropriate forthisEAL.PEG


==Reference:==
==Reference:==


AA2.1BasisReference(s):
AA2.1 Basis Reference(s):
1.2.3.P-9Radiation Monitoring SystemNUREG-0818, "Emergency ActionLevelsforLightWaterReactors,"
1.2.3.P-9 Radiation Monitoring System NUREG-0818,"Emergency Action Levels for Light Water Reactors," NUREG/CR-4982,"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" 2-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel'.3 Refueling Accidents or Other Radiation Monitors 2.4.3 Alert Report of visual observation of irradiated fuel uncovered MBCARC IC: Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.FPB loss/potential loss: N/A Mode Applicability:
NUREG/CR-4982, "SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82"2-17 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev12.0ReactorFuel'.3Refueling Accidents orOtherRadiation Monitors2.4.3AlertReportofvisualobservation ofirradiated fueluncovered MBCARCIC:Majordamagetoirradiated fuelorlossofwaterlevelthathasorwillresultintheuncovering ofirradiated fueloutsidethereactorvessel.FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL is defined by the specific areas where irradiated fuel is located such as reactor cavity, or spent fuel pool.There is no indication that water level in the spent fuel pool or refueling cavity has dropped to the level of the fuel other than by visual observation.
Basis:ThisEALisdefinedbythespecificareaswhereirradiated fuelislocatedsuchasreactorcavity,orspentfuelpool.Thereisnoindication thatwaterlevelinthespentfuelpoolorrefueling cavityhasdroppedtothelevelofthefuelotherthanbyvisualobservation.
Since there is no level indicating system in the fuel transfer canal, visual observation of loss of water level would also be required.SuQicient time exists to take corrective actions for these conditions and there is little potential for substantial fuel damage.NUREG/CR-4982"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" indicates that even if corrective actions are not taken, no prompt fatalities are predicted and the risk of injury is low.In addition, NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" presents the following it its discussion: "In the event of a serious accident involving decayed spent fuel, protective actions would be n'ceded for personnel on site, while oQ'site doses (assuming an exclusion area radius of one mile from the plant site)would be well below the Environmental Protection Agency's Protective Action Guides.Accordingly, it is important to be able to properly survey 2-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 and monitor for Kr-85 in the event of an accident with decayed spent fuel.Thus, an Alert Classification for this event is appropriate.
Sincethereisnolevelindicating systeminthefueltransfercanal,visualobservation oflossofwaterlevelwouldalsoberequired.
Escalation, if appropriate, would occur via radioactivity release category 5.0 or Emergency Coordinator judgment in EAL Category 9.0.This EAL applies to spent fuel requiring water coverage and is not intended to address spent fuel which is licensed for dry storage.PEG  
SuQicient timeexiststotakecorrective actionsfortheseconditions andthereislittlepotential forsubstantial fueldamage.NUREG/CR-4982 "SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82"indicates thatevenifcorrective actionsarenottaken,nopromptfatalities arepredicted andtheriskofinjuryislow.Inaddition, NRCInformation NoticeNo.90-08,"KR-85HazardsfromDecayedFuel"presentsthefollowing ititsdiscussion:
"Intheeventofaseriousaccidentinvolving decayedspentfuel,protective actionswouldben'cededforpersonnel onsite,whileoQ'sitedoses(assuming anexclusion arearadiusofonemilefromtheplantsite)wouldbewellbelowtheEnvironmental Protection Agency'sProtective ActionGuides.Accordingly, itisimportant tobeabletoproperlysurvey2-18 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1andmonitorforKr-85intheeventofanaccidentwithdecayedspentfuel.Thus,anAlertClassification forthiseventisappropriate.
Escalation, ifappropriate, wouldoccurviaradioactivity releasecategory5.0orEmergency Coordinator judgmentinEALCategory9.0.ThisEALappliestospentfuelrequiring watercoverageandisnotintendedtoaddressspentfuelwhichislicensedfordrystorage.PEG


==Reference:==
==Reference:==


AA2.2BasisReference(s):
AA2.2 Basis Reference(s):
1.2.P-9Radiation Monitoring SystemNUREG/CR-4982 "SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82".NRCInformation NoticeNo.90-08,"KR-85HazardsfromDecayedFuel"2-19 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Thereactorvesselprovidesavolumeforthecoolantwhichcoversthereactorcore.Thereactorvesselandassociated pressurepiping(reactorcoolantsystem)togetherprovideabarriertolimitthereleaseofradioactive materialshouldthereactorfuelcladdingintegrity fail.TherearethreeRCSparameters whichareindicative ofconditions whichmayposeathreattoRCSorfuelcladdingintegrity:
1.2.P-9 Radiation Monitoring System NUREG/CR-4982"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82".NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" 2-19 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor vessel provides a volume for the coolant which covers the reactor core.The reactor vessel and associated pressure piping (reactor coolant system)together provide a barrier to limit the release of radioactive material should the reactor fuel cladding integrity fail.There are three RCS parameters which are indicative of conditions which may pose a threat to RCS or fuel cladding integrity:
SCfLtlRR*
SCfLtlRR*(>>T l l 1ST'fi tl)RCSl tg indications are utilized to indicate potential pipe cracks which may propagate to an extent threatening fuel clad, RCS and containment integrity.
(>>Tll1ST'fitl)RCSltgindications areutilizedtoindicatepotential pipecrackswhichmaypropagate toanextentthreatening fuelclad,RCSandcontainment integrity.
RCS leakage of a degree requiring ECCS to maintain RCS inventory poses a direct threat to fuel clad integrity.
RCSleakageofadegreerequiring ECCStomaintainRCSinventory posesadirectthreattofuelcladintegrity.
Reactor vessel water level is also directly related to the status of adequate core cooling, and therefore fuel cladding integrity.
Reactorvesselwaterlevelisalsodirectlyrelatedtothestatusofadequatecorecooling,andtherefore fuelcladdingintegrity.
n A subset of RCS leakage, excessive primary to secondary leakage in conjunction with unisolable secondary releases to environment may result in losses of containment integrity as well as threaten fuel clad integrity for more severe SG tube ruptures.Al fRCS A ll gl f d t ll dl that the inventory control systems are inadequate in maintaining RCS pressure and inventory against mass loss through a leak.
nAsubsetofRCSleakage,excessive primarytosecondary leakageinconjunction withunisolable secondary releasestoenvironment mayresultinlossesofcontainment integrity aswellasthreatenfuelcladintegrity formoresevereSGtuberuptures.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1.1 Unusual Event 3.1 RCS Leakage Unidentified or pressure boundary leakage>10 gpm OR Identified leakage>25 gpm NUMARC IC: RCS leakage when greater than 200'F FPB loss/potential loss: N/A Mode Applicability:
AlfRCSAllglfdtlldlthattheinventory controlsystemsareinadequate inmaintaining RCSpressureandinventory againstmasslossthroughaleak.
Power operation, hot shutdown Basis: The conditions of this EAL may be a precursor of more serious conditions and, as a result, is considered to be a potential degradation of the level of safety of the plant.The 10 gpm value for the.unidentified leakage and pressure boundary leakage was selected because it is observable with normal Control Room indications.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.1.1UnusualEvent3.1RCSLeakageUnidentified orpressureboundaryleakage>10gpmORIdentified leakage>25gpmNUMARCIC:RCSleakagewhengreaterthan200'FFPBloss/potential loss:N/AModeApplicability:
Smaller values must be determined through time-consuming surveillance tests (e.g., mass balances).
Poweroperation, hotshutdownBasis:Theconditions ofthisEALmaybeaprecursor ofmoreseriousconditions and,asaresult,isconsidered tobeapotential degradation ofthelevelofsafetyoftheplant.The10gpmvalueforthe.unidentified leakageandpressureboundaryleakagewasselectedbecauseitisobservable withnormalControlRoomindications.
The 25 gpm value for identified leakage is set at a higher value because of the significance of identified leakage in comparison to unidentified or pressure boundary leakage.Only operating modes in which there is fuel in the reactor coolant system and the system is pressurized are specified.
Smallervaluesmustbedetermined throughtime-consuming surveillance tests(e.g.,massbalances).
PEG  
The25gpmvalueforidentified leakageissetatahighervaluebecauseofthesignificance ofidentified leakageincomparison tounidentified orpressureboundaryleakage.Onlyoperating modesinwhichthereisfuelinthereactorcoolantsystemandthesystemispressurized arespecified.
PEG


==Reference:==
==Reference:==


SU5.1BasisReference(s):
SU5.1 Basis Reference(s):
None  
None  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.1RCSLeakage3.1.2AlertPrimarysystemleakage>46gpmMMARCIC:N/AFPBloss/potential loss:RCSpotential lossModeApplicability:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.2 Alert Primary system leakage>46 gpm MMARC IC: N/A FPB loss/potential loss: RCS potential loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALisbasedontheinability tomaintainnormalliquidinventory withintheReactorCoolantSystem(RCS)bynormaloperation oftheChemicalandVolumeControlSystemwhichisconsidered astwopositivedisplacement chargingpumpsdischarging tothechargingheader.PEG
Power operation, hot shutdown Basis: This EAL is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG  


==Reference:==
==Reference:==


RCS2.2BasisReference(s):
RCS2.2 Basis Reference(s):
1.FSARTable9.3.63-3 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.1.3SiteAreaEmergency 3.1RCSLeakageRVLIScannotbemaintained
1.FSAR Table 9.3.6 3-3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1.3 Site Area Emergency 3.1 RCS Leakage RVLIS cannot be maintained
>43%withnoRCPsrunningORWiththereactorvesselheadremoved,itisreportedthatwaterlevelinthereactorvesselisdroppinginanuncontrolled mannerandcoreuncoveryislikelyNUINARCIC:Lossofreactorvesselwaterlevelhasorwilluncoverfuelinthereactorvessel.FPBloss/potential loss:Fuelcladpotential loss,RCSlossModeApplicability:
>43%with no RCPs running OR With the reactor vessel head removed, it is reported that water level in the reactor vessel is dropping in an uncontrolled manner and core uncovery is likely NUINARC IC: Loss of reactor vessel water level has or will uncover fuel in the reactor vessel.FPB loss/potential loss: Fuel clad potential loss, RCS loss Mode Applicability:
Basis:ThereactorvesselwaterlevelusedinthisEAListhetopofactivefuel(TAF).Thisvaluecorresponds tothelevelwhichisusedinCSFSTstoindicatechallenge tocorecoolingandlossofthefuelcladbarrier.Thisistheminimumwaterleveltoassurecorecoolingwithoutfurtherdegradation oftheclad.Severecoredamagecanoccurandreactorcoolantsystempressureboundaryintegrity maynotbeassuredifreactorvesselwaterlevelisnotmaintained abovethatcorresponding toRVLISat43%.RVLISdynamicrangeindications arenotutilizedinthisEALsincetheRCPswouldnotberunningunderconditions wherevessellevelisapproaching TAF.Thus,declaration ofaSiteAreaEmergency iswarranted undertheconditions specified bythisEAL.Escalation toaGeneralEmergency wouldbeviaradioactivity releasecategory5.0.
Basis: The reactor vessel water level used in this EAL is the top of active fuel (TAF).This value corresponds to the level which is used in CSFSTs to indicate challenge to core cooling and loss of the fuel clad barrier.This is the minimum water level to assure core cooling without further degradation of the clad.Severe core damage can occur and reactor coolant system pressure boundary integrity may not be assured if reactor vessel water level is not maintained above that corresponding to RVLIS at 43%.RVLIS dynamic range indications are not utilized in this EAL since the RCPs would not be running under conditions where vessel level is approaching TAF.Thus, declaration of a Site Area Emergency is warranted under the conditions specified by this EAL.Escalation to a General Emergency would be via radioactivity release category 5.0.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==


SS5.1FC4.1BasisReference(s):
SS5.1 FC4.1 Basis Reference(s):
1.FR-C.1"Response toInadequate CoreCooling" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0ReactorCoolantSystem8.2PrimarytoSecondary Leakage8.2.1UnusualEventReleaseofsecondary sidetoatmosphere withprimarytosecondary leakage>0.1gpmpersteamgenerator NUlVIARCIC:N/AFPBloss/potential loss:Containment lossModeApplicability:
1.FR-C.1"Response to Inadequate Core Cooling" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Reactor Coolant System 8.2 Primary to Secondary Leakage 8.2.1 Unusual Event Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator NUlVIARC IC: N/A FPB loss/potential loss: Containment loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses SGtubeleaksindicative ofalossofcontainment.
Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of containment.
Secondary sidereleasestoatmosphere includethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmospheric reliefvalvesthatcannotbeisolatedonceisolation hasbeendirected.
Secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed.by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.For small leaks, not exceeding the normal charging capacity threshold in RCS leakage EAL 3.1.2, this EAL results in an Unusual Event.For larger leaks, RCS leakage EAL 3.2.2 would result in a Site Area Emergency.
bytheEOPs.Asteamgenerator whichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Forsmallleaks,notexceeding thenormalchargingcapacitythreshold inRCSleakageEAL3.1.2,thisEALresultsinanUnusualEvent.Forlargerleaks,RCSleakageEAL3.2.2wouldresultinaSiteAreaEmergency.
For SG tube ruptures which may involve multiple steam generators or unisolable secondary line breaks, SG tube rupture EAL 4.2.1 would also result in a Site Area Emergency.
ForSGtuberuptureswhichmayinvolvemultiplesteamgenerators orunisolable secondary linebreaks,SGtuberuptureEAL4.2.1wouldalsoresultinaSiteAreaEmergency.
PEG  
PEG


==Reference:==
==Reference:==


PC4.1BasisReference(s):
PC4.1 Basis Reference(s):
1.Technical Specifications Section3.1.5.2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.2PrimarytoSecondary Leakage3.2.2SiteAreaEmergency Unisolable releaseofsecondary sidetoatmosphere withprimarytosecondary leakage)46gpmMMARCICN/AFPBloss/potential loss:RCSpotential loss,Containment lossModeApplicability:
1.Technical Specifications Section 3.1.5.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.2 Site Area Emergency Unisolable release of secondary side to atmosphere with primary to secondary leakage)46 gpm MMARC IC N/A FPB loss/potential loss: RCS potential loss, Containment loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses SGtubeleaksindicative ofalossofbothRCSandcontainment barriers.
Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of both RCS and containment barriers.Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.Primary to secondary leakage)46 gpm is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.For primary to secondary leakage)46 gpm in the absence of any secondary to atmosphere release, an Alert would be declared based on EAL 3.1.2, This EAL represents the loss of both RCS and containment barriers and therefore warrants declaration of a Site Area Emergency.
Unisolable secondary sidereleasestoatmosphere includethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmospheric reliefvalvesthatcannotbeisolatedonceisolation hasbeendirectedbytheEOPs.Asteamgenerator whichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Primarytosecondary leakage)46gpmisbasedontheinability tomaintainnormalliquidinventory withintheReactorCoolantSystem(RCS)bynormaloperation oftheChemicalandVolumeControlSystemwhichisconsidered astwopositivedisplacement chargingpumpsdischarging tothechargingheader.Forprimarytosecondary leakage)46gpmintheabsenceofanysecondary toatmosphere release,anAlertwouldbedeclaredbasedonEAL3.1.2,ThisEALrepresents thelossofbothRCSandcontainment barriersandtherefore warrantsdeclaration ofaSiteAreaEmergency.
PEG  
PEG


==Reference:==
==Reference:==


PC4.1+RCS2.2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
PC4.1+RCS2.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.Technical Specifications Section3.1.5.22.E-3"SteamGenerator TubeRupture"3.FSARTable9.3.6 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.2PrimarytoSecondary Leakage3.2.3SiteAreaEmergency Releaseofsecondary sidetoatmosphere withprimarytosecondary leakage>0.1gpmpersteamgenerator ANDCoolantactivity)300pCi/ccofI-131MMARCIC:N/AFPBloss/potential loss:Fuelcladloss,Containment lossModeApplicability:
1.Technical Specifications Section 3.1.5.2 2.E-3"Steam Generator Tube Rupture" 3.FSAR Table 9.3.6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.3 Site Area Emergency Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator AND Coolant activity)300 pCi/cc of I-131 MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, Containment loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses SGtubeleaksindicative ofalossofcontainment inconjunction withalossoffuelcladding.
Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of containment in conjunction with a loss of fuel cladding.Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.A coolant activity)300 pCi/cc of I-131 indicates a loss of fuel cladding.Refer to EAL N2.1.2 basis This condition represents a loss of both primary containment with the loss of fuel cladding and thus warrants declaration of a Site Area Emergency.
Unisolable secondary sidereleasestoatmosphere includethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmospheric reliefvalvesthatcannotbeisolatedonceisolation hasbeendirectedbytheEOPs.Asteamgenerator whichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Acoolantactivity)300pCi/ccofI-131indicates alossoffuelcladding.
PEG  
RefertoEALN2.1.2basisThiscondition represents alossofbothprimarycontainment withthelossoffuelcladdingandthuswarrantsdeclaration ofaSiteAreaEmergency.
PEG


==Reference:==
==Reference:==


PC4.1+FC2.1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
PC4.1+FC2.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.Technical Specifications Section3.1.43-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev13.0ReactorCoolantSystem3.3RCSSubcooling 3.3.1AlertRCSsubcooling
1.Technical Specifications Section 3.1.4 3-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert RCS subcooling
<EOPFig.MINSUBCOOLING duetoRCSleakageNUINARCIC:N/AFPBloss/potential loss:RCSlossModeApplicability:
<EOP Fig.MIN SUBCOOLING due to RCS leakage NUINARC IC: N/A FPB loss/potential loss: RCS loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses conditions whereleakagefromtheRCSisgreaterthanavailable inventory controlcapacitysuchthatalossofsubcooling hasoccurred.
Power operation, hot shutdown Basis: This EAL addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through the leak.Loss of the RCS barrier warrants declaration of an Alert.PEG  
Thelossofsubcooling isthefundamental indication thattheinventory controlsystemsareinadequate inmaintaining RCSpressureandinventory againstthemasslossthroughtheleak.LossoftheRCSbarrierwarrantsdeclaration ofanAlert.PEG


==Reference:==
==Reference:==


RCS2.1BasisReference(s):
RCS2.1 Basis Reference(s):
1.E-O,ReactorTripOrSafetyInjection 3-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Thecontainment structure isanatmospheric vaporcontainment system.ItformsaGssionproductbarrierdesignedtocontaintheradioactive fissionproductsgenerated fromanypostulated accidentsoastoprecludeexceeding offsiteexposurelimits.Thecontainment structure isalowleakagesystemhousingthereactorvessel,thereactorcoolantpiping,steamgenerators andotherbranchconnections ofthereactorprimarysystem.Thecontainment isequippedwithisolation valvesforsystemswhichpenetrate thecontainment boundary.
1.E-O, Reactor Trip Or Safety Injection 3-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The containment structure is an atmospheric vapor containment system.It forms a Gssion product barrier designed to contain the radioactive fission products generated from any postulated accident so as to preclude exceeding offsite exposure limits.The containment structure is a low leakage system housing the reactor vessel, the reactor coolant piping, steam generators and other branch connections of the reactor primary system.The containment is equipped with isolation valves for systems which penetrate the containment boundary.These valves automatically actuate to isolate systems under emergency conditions.
Thesevalvesautomatically actuatetoisolatesystemsunderemergency conditions.
There are three containment parameters which are indicative of conditions which may pose a threat to containment integrity or indicate degradation of RCS or reactor fuel clad integrity.
Therearethreecontainment parameters whichareindicative ofconditions whichmayposeathreattocontainment integrity orindicatedegradation ofRCSorreactorfuelcladintegrity.
~i n I Abnormally high containment pressure or failure of containment cooling systems following a LOCA are indicative of potential losses of the containment barrier integrity.
~inIAbnormally highcontainment pressureorfailureofcontainment coolingsystemsfollowing aLOCAareindicative ofpotential lossesofthecontainment barrierintegrity.
The existence of an unisolable CI or CVI line break outside containment constitutes a loss of containment integrity as well as a loss of RCS boundary.Inconsistent containment response to a known LOCA is also indicative of containment loss in conjunction with RCS barrier breach.Should a loss of fuel cladding integrity occur under either of these conditions, the potential for release of large amounts of radioactive materials to the environment exists.m r wi h n 1 SGtube ruptures in conjunction with a secondary system line break resulting in release to the environment constitutes losses of both RCS and containment integrity.
Theexistence ofanunisolable CIorCVIlinebreakoutsidecontainment constitutes alossofcontainment integrity aswellasalossofRCSboundary.
Primary to secondary leakage in excess of Technical Specifications in conjunction with fuel clad damage and secondary system leakage to the environment constitutes losses of fuel clad, RCS and containment integrity.
Inconsistent containment responsetoaknownLOCAisalsoindicative ofcontainment lossinconjunction withRCSbarrierbreach.Shouldalossoffuelcladdingintegrity occurundereitheroftheseconditions, thepotential forreleaseoflargeamountsofradioactive materials totheenvironment exists.mrwihn1SGtuberupturesinconjunction withasecondary systemlinebreakresulting inreleasetotheenvironment constitutes lossesofbothRCSandcontainment integrity.
This condition provides the potential for release of large amounts of radioactive materials to the environment.
Primarytosecondary leakageinexcessofTechnical Specifications inconjunction withfuelcladdamageandsecondary systemleakagetotheenvironment constitutes lossesoffuelclad,RCSandcontainment integrity.
~m i 1 n r'The existence of combustible'gas concentrations in containment pose a severe threat to containment integrity and are indicative of severely degraded reactor core and RCS conditions.
Thiscondition providesthepotential forreleaseoflargeamountsofradioactive materials totheenvironment.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
~mi1nr'Theexistence ofcombustible'gas concentrations incontainment poseaseverethreattocontainment integrity andareindicative ofseverelydegradedreactorcoreandRCSconditions.
 
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.1Containment Integrity Status4.1.1UnusualEventBothdoorsopenoncontainment airlock.ORInability toclosecontainment pressurerelieforpurgevalveswhichresultsinaradiological releasepathwaytotheenvironment NUMARCIC:N/AFPBloss/potential loss:Containment lossModeApplicability:
===4.1 Containment===
Poweroperation, hotshutdownBasis:ThisEALaddresses anindication thatunambiguously indicates lossofthecontainment barrierunderconditions whencontainment integrity isrequired.
Integrity Status 4.1.1 Unusual Event Both doors open on containment airlock.OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment NUMARC IC: N/A FPB loss/potential loss: Containment loss Mode Applicability:
Itisimportant tonotehowever,thatlossofcontainment duetobothairlockdoorsbeingopeniseventdependent.
Power operation, hot shutdown Basis: This EAL addresses an indication that unambiguously indicates loss of the containment barrier under conditions when containment integrity is required.It is important to note however, that loss of containment due to both airlock doors being open is event dependent.
Uponrecognition, shiftpersonnel wouldrapidlyrespondinanattempttoreestablish containment integrity.
Upon recognition, shift personnel would rapidly respond in an attempt to reestablish containment integrity.
Ifthedoorscannotbereclosed, anylossoftheRCSbarrierthatoccurswiththedoorsopenwouldappearasaninconsistent LOCAresponse.
If the doors cannot be reclosed, any loss of the RCS barrier that occurs with the doors open would appear as an inconsistent LOCA response.Therefore, this event is not used as a definitive indicator of loss of the primary containment barrier for purposes of defining higher classification EALs.Rather it is left to the Emergency Coordinator's judgment whether such a loss has occurred.'EG  
Therefore, thiseventisnotusedasadefinitive indicator oflossoftheprimarycontainment barrierforpurposesofdefininghigherclassification EALs.RatheritislefttotheEmergency Coordinator's judgmentwhethersuchalosshasoccurred.
'EG


==Reference:==
==Reference:==


PC7.1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
PC7.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.1Containment Integrity Status/4.1.2SiteAreaEmergency 4Rapiduncontrolled decreaseincontainment pressurefollowing initialincreaseORLossofprimarycoolantinsidecontainment withcontainment pressureorsumplevelresponsenotconsistent withLOCAconditions MBMRCIC:N/AFPBloss/potential loss:RCSloss,Containment lossModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
Poweroperation, hotshutdownBasis:Rapidunexplained lossofpressure(i.e.,notattributable tocontainment sprayorFanCoolingUnitsorcondensation effects)following aninitialpressureincreaseindicates alossofbothRCSandcontainment integrity.
 
Containment pressureandsumplevelsshouldincreaseasaresultofth'massandenergyreleaseintocontainment fromaLOCA.Thus,sumplevelorpressurenotincreasing indicates containment bypass(V-sequence) andalossofcontainment integrity.
===4.1 Containment===
ThisEALindicates lossofbothRCSandcontainment andtherefore warrantsdeclaration ofaSiteAreaEmergency.
Integrity Status/4.1.2 Site Area Emergency 4 Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions MBMRC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:
PEG
Power operation, hot shutdown Basis: Rapid unexplained loss of pressure (i.e., not attributable to containment spray or Fan Cooling Units or condensation effects)following an initial pressure increase indicates a loss of both RCS and containment integrity.
Containment pressure and sump levels should increase as a result of th'mass and energy release into containment from a LOCA.Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.
This EAL indicates loss of both RCS and containment and therefore warrants declaration of a Site Area Emergency.
PEG  


==Reference:==
==Reference:==


PC2.1PC2.2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
PC2.1 PC2.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.Alarmresponseprocedure, AR-C-18,Revision62.Alarmresponseprocedure, AR-C-19,Revision43.R.E.GinnaUpdatedFSAR,Figure6.2-3through6.2-5 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.1Containment Integrity Status4.1.3SiteAreaEmergency Either:CIorCVIvalve(s)notclosedwhenrequiredfollowing confirmed LOCAORInability toisolateanyprimarysystemdischarging outsidecontainment ANDRadiological releasepathwaytotheenvironment existsMMARCIC:N/AFPBloss/potential loss:RCSloss,Containment lossModeApplicability:
1.Alarm response procedure, AR-C-18, Revision 6 2.Alarm response procedure, AR-C-19, Revision 4 3.R.E.Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
Poweroperation, hotshutdownBasis:ThisEALisintendedtoaddressincomplete containment isolation thatallowsdirectreleasetotheenvironment.
 
Itrepresents alossofboththeRCSandcontainment barrierandtherefore warrantsdeclaration ofaSiteAreaEmergency.
===4.1 Containment===
FailureofCIorCVIvalvestoisolateisintendedtoaddressincomplete containment isolation thatallowsdirectreleasetotheenvironment.
Integrity Status 4.1.3 Site Area Emergency Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists MMARC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:
Itrepresents alossofboththeRCSandcontainment barrier.Confirmation ofaIOCAshouldbebasedondiagnostic activities consistent withE-0"ReactorTriporSafetyInjection."
Power operation, hot shutdown Basis: This EAL is intended to address incomplete containment isolation that allows direct release to the environment.
"Inability toisolateanyprimarysystemdischarging outsidecontainment" isintendedtoaddressotherprimarysystems,eitherdirectorindirect, whichtheinability toisolateindicatelossofbothRCSandcontainment.
It represents a loss of both the RCS and containment barrier and therefore warrants declaration of a Site Area Emergency.
PEG
Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment.
It represents a loss of both the RCS and containment barrier.Confirmation of a I OCA should be based on diagnostic activities consistent with E-0"Reactor Trip or Safety Injection.""Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment.
PEG  


==Reference:==
==Reference:==
Line 453: Line 368:
PC3.1  
PC3.1  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.FR-2.1"Response toHighContainment Pressure" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment
1.FR-2.1"Response to High Containment Pressure" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
'4.lContainment Integrity Status4.1.4GeneralEmergency Safetyinjection signalduetoLOCAwithlessthanminimumoperablecontainment heatremovalequipment, Table4.3ANDAnyindicators offuelcladloss,Table4.1Table4.3Minimum0erableContainment HeatRemovalEuimentCNMTPressureRecircFans0erableSraPumsReuired<28psigN/A>28psigTable4.1FuelCladLossIndicators 1.Coolantactivity>300p.Ci/ccofI-1312.Containment radmonitorR-29/R-30 reading>100H/hr3.LetdownMonitorR-9reading>10H/hr4.REDpathinF-0.2,CORECOOLINGMMARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSloss,Containment potential lossModeApplicability:
'4.l Containment Integrity Status 4.1.4 General Emergency Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Table 4.3 Minimum 0 erable Containment Heat Removal E ui ment CNMT Pressure Recirc Fans 0 erable S ra Pum sRe uired<28 psig N/A>28 psig Table 4.1 Fuel Clad Loss Indicators 1.Coolant activity>300 p.Ci/cc of I-131 2.Containment rad monitor R-29/R-30 reading>100 H/hr 3.Letdown Monitor R-9 reading>10 H/hr 4.RED path in F-0.2, CORE COOLING MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALrepresents apotential lossofcontainment inconjunction withlossesofbothRCSandfuelclad.
Power operation, hot shutdown Basis: This EAL represents a potential loss of containment in conjunction with losses of both RCS and fuel clad.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Apotential lossofcontainment isconsidered toexistinthatthecontainment heatremovaVdepressurization systems(e.g.,containment sprays,Recirc.Fans,butnotincluding containment ventingstrategies) areeitherlostorperforming inadegradedmanner,asindicated byplantparameters suchascontainment
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 A potential loss of containment is considered to exist in that the containment heat removaVdepressurization systems (e.g., containment sprays, Recirc.Fans, but not including containment venting strategies) are either lost or performing in a degraded manner, as indicated by plant parameters such as containment pressure, pressurizer level and steam line pressure in excess of the setpoints at which the equipment was supposed to have actuated.RCS is also assumed to be lost in this condition due to exceeding safety injection initiation setpoints:
: pressure, pressurizer levelandsteamlinepressureinexcessofthesetpoints atwhichtheequipment wassupposedtohaveactuated.
containment pressure ()4 psig)or low pressurizer
RCSisalsoassumedtobelostinthiscondition duetoexceeding safetyinjection initiation setpoints:
(<1723 psig).Table 4.1 presents fuel clad loss indicators which represent 2-5%clad failures.Refer to EAL 0's 2.1.2, 2.2.2, and 2.3.2 for bases of these indicators.
containment pressure()4psig)orlowpressurizer
PEG  
(<1723psig).Table4.1presentsfuelcladlossindicators whichrepresent 2-5%cladfailures.
RefertoEAL0's2.1.2,2.2.2,and2.3.2forbasesoftheseindicators.
PEG


==Reference:==
==Reference:==


PC2.5+FC2.1,FC5.1andFC6.1BasisReference(s):
PC2.5+FC2.1, FC5.1 and FC6.1 Basis Reference(s):
l.2.3.4.5.6.7.8.Technical Specifications, Table3.5-4,pg.3.5-17R.E.GinnaUFSAR,Section6.2.2.1.2.4, pg.6.2-28Technical Specifications, Article5.2.1,pg.5.2-1FR-Z.1,ResponsetoHighContainment
l.2.3.4.5.6.7.8.Technical Specifications, Table 3.5-4, pg.3.5-17 R.E.Ginna UFSAR, Section 6.2.2.1.2.4, pg.6.2-28 Technical Specifications, Article 5.2.1, pg.5.2-1 FR-Z.1, Response to High Containment Pressure, Revision 3 R.E.Ginna UFSAR, Section 6.2.2.1, pg.6.2-24b R.E.Ginna UFSAR, Section 6.2.2.2, pg.6.2-32 and Figure 6.2-11 EPIP 2-16, Core Damage Estimation P-9, Radiation Monitoring System, Revision 67, Section 2.2.2.6, pg.P-9:2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
: Pressure, Revision3R.E.GinnaUFSAR,Section6.2.2.1,pg.6.2-24bR.E.GinnaUFSAR,Section6.2.2.2,pg.6.2-32andFigure6.2-11EPIP2-16,CoreDamageEstimation P-9,Radiation Monitoring System,Revision67,Section2.2.2.6,pg.P-9:2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.1Containment Integrity Status4.1.5GeneralEmergency Either:Rapiduncontrolled decreaseincontainment pressurefollowing initialincreaseORLossofprimarycoolantinsidecontainment withcontainment pressureorsumplevelresponsenotconsistent withLOCAconditions ANDAnyindicators offuelcladdamage,Table4.2Table4.2FuelCladDamageIndicators ORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300pCi/ccofI-131Containment radmonitorR-29/R-30 reading>100EhrLetdownMonitorR-9reading>10R/hrMMARCIC:N/AFPBloss/potential loss:Fuelcladpotential loss/loss, RCSloss,Containment lossModeApplicability:
Poweroperation, hotshutdownBasis:ThisEALindicates lossofbothRCSandcontainment withlossorpotential lossofthefuelcladdingandtherefore warrantsdeclaration ofaGeneralEmergency.,
4-10


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Rapidunexplained lossofpressure(i.e.,notattributable tocontainment sprayorFanCoolingUnitsorcondensation effects)following aninitialpressureincreaseindicates alossofbothRCSandcontainment integrity.
===4.1 Containment===
Containment pressureandsumplevelsshouldincreaseasaresultofthemassandenergyreleaseintocontainment fromaLOCA.Thus,sumplevelorpressurenotincreasing indicates containment bypass(V-sequence) andalossofcontainment integrity.
Integrity Status 4.1.5 General Emergency Either: Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Damage Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 pCi/cc of I-131 Containment rad monitor R-29/R-30 reading>100 Ehr Letdown Monitor R-9 reading>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad potential loss/loss, RCS loss, Containment loss Mode Applicability:
Table4.2presentsfuelcladlossandpotential lossindicators:
Power operation, hot shutdown Basis: This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency., 4-10
~ORANGEorREDpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basisCoolantactivity>300p,Ci/ccofI-131:RefertoEAL&#xb9;2.1.2basis~Containment radmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10H/hr:RefertoEAL&#xb9;2.2.2basisPEG
 
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Rapid unexplained loss of pressure (i.e., not attributable to containment spray or Fan Cooling Units or condensation effects)following an initial pressure increase indicates a loss of both RCS and containment integrity.
Containment pressure and sump levels should increase as a result of the mass and energy release into containment from a LOCA.Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.
Table 4.2 presents fuel clad loss and potential loss indicators:
~ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL&#xb9;1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL&#xb9;1.2.1 basis Coolant activity>300 p,Ci/cc of I-131: Refer to EAL&#xb9;2.1.2 basis~Containment rad monitor reading>100 R/hr: Refer to EAL&#xb9;2.3.2 basis~Letdown Monitor R-9 reading>10 H/hr: Refer to EAL&#xb9;2.2.2 basis PEG


==Reference:==
==Reference:==


PC2.1/PC2.2+
PC2.1/PC2.2+
FC1.2,FC1.3,FC2.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):
FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
l.2.3.45.6.7.8.9.10.Alarmresponseprocedure, AR-C-18,Revision6Alarmresponseprocedure, AR-C-19,Revision4R.E.GinnaUpdatedFSAR,Figure6.2-3through6.2-5EPIP2-16,CoreDamageEstimation CSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequate CoreCooling,Revision7FR-C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"Radiation Monitoring System"4-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.1Containment Integrity Status4.1.6GeneralEmergency Either:"CIorCVIvalve(s)notclosedwhenrequiredfollowing confirmed LOCAORInability toisolateanyprimarysystemdischarging outsidecontainment ANDRadiological releasepathwaytotheenvironment existsANDAnyindicators offuelcladdamage,Table4.2Table4.2FuelCladDamaeIndicators ORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300p,Ci/ccofI-131Containment radmonitorR-29/R-30 reading>100R/hrLetdownMonitorR-9reading>10R/hrMMARCIC:N/AFPBloss/potential loss:Fuelcladloss/potential loss,RCSloss,Containment lossModeApplicability:
l.2.3.4 5.6.7.8.9.10.Alarm response procedure, AR-C-18, Revision 6 Alarm response procedure, AR-C-19, Revision 4 R.E.Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiation Monitoring System" 4-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
Poweroperation, hotshutdownBasis:ThisEALindicates lossofbothRCSandcontainment withlossorpotential lossofthefuelcladdingandtherefore warrantsdeclaration ofaGeneralEmergency.
 
FailureofCIorCVIvalvestoisolateisintendedtoaddressincomplete containment isolation thatallowsdirectreleasetotheenvironment.
===4.1 Containment===
Itrepresents alossofboththeRCSandcontainment barrier.4-12 OSSI-92-402A-4-REG GinnaEAITechnical BasesDocument, Rev1"Inability toisolateanyprimarysystemdischarging outsidecontainment" isintendedtoaddressotherprimarysystems,eitherdirectorindirect, whichtheinability toisolateindicatelossofbothRCSandcontainment Table4.2presentsfuelcladlossandpotential lossindicators:
Integrity Status 4.1.6 General Emergency Either: " CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 p,Ci/cc of I-131 Containment rad monitor R-29/R-30 reading>100 R/hr Letdown Monitor R-9 reading>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:
~ORANGEpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basis~Coolantactivity>300pCi/ccofI-131:RefertoEAL&#xb9;2.1.2basisContainment radmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10H/hr:RefertoEAL&#xb9;2.2.2basisPEG
Power operation, hot shutdown Basis: This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.
Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment.
It represents a loss of both the RCS and containment barrier.4-12 OSSI-92-402A-4-REG Ginna EAI Technical Bases Document, Rev 1"Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment Table 4.2 presents fuel clad loss and potential loss indicators:
~ORANGE path in F-0.2, Core Cooling: Refer to EAL&#xb9;1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL&#xb9;1.2.1 basis~Coolant activity>300 pCi/cc of I-131: Refer to EAL&#xb9;2.1.2 basis Containment rad monitor reading>100 R/hr: Refer to EAL&#xb9;2.3.2 basis~Letdown Monitor R-9 reading>10 H/hr: Refer to EAL&#xb9;2.2.2 basis PEG


==Reference:==
==Reference:==


PC3.1+FC1.2,FC1.3,FC2.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):
PC3.1+FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
1.2.3.45.6.7.8.9.10.FR-2.1"Response toHighContainment Pressure" CSFSTF-0.2,"CoreCooling"FR-C.l,"Response toInadequate CoreCooling"EPIP2-16,CoreDamageEstimation CSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequate CoreCooling,Revision7FR;C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"Radiatio'n Monitoring System"4-13 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Contaixunent 4.2SGTubeRupturew/Secondary Release4.2.1SiteAreaEmergency Unisolable secondary sidelinebreakwithSGtuberuptureasidentified inE-3"SteamGenerator TubeRupture"NMGQtCIC:N/AFPBloss/potential loss:RCSloss,Containment lossModeApplicability:
1.2.3.4 5.6.7.8.9.10.FR-2.1"Response to High Containment Pressure" CSFST F-0.2,"Core Cooling" FR-C.l,"Response to Inadequate Core Cooling" EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR;C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiatio'n Monitoring System" 4-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Contaixunent 4.2 SG Tube Rupture w/Secondary Release 4.2.1 Site Area Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" NMGQtC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALisintendedtoaddressthefullspectrumofSteamGenerator (SG)tuberuptureeventsinconjunction withalossofcontainment duetoasignificant secondary linebreak.ThisEALaddresses rupturedSG(s)withanunisolable secondary linebreakcorresponding tothelossof2of3fissionproductbarriers(RCSbarrierandcontainment barrier).
Power operation, hot shutdown Basis: This EAL is intended to address the full spectrum of Steam Generator (SG)tube rupture events in conjunction with a loss of containment due to a significant secondary line break.This EAL addresses ruptured SG(s)with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier).This allows the direct release of radioactive fission and activation products to the environment.
Thisallowsthedirectreleaseofradioactive fissionandactivation productstotheenvironment.
Resultant offsite dose rates are a function of many variables.
Resultant offsitedoseratesareafunctionofmanyvariables.
Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.
Examplesinclude:coolantactivity, actualleakrate,SGcarryover,iodinepartitioning, andmeteorology.
The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), if available.
Theindications utilizedshouldbeconsistent withthediagnostic activities oftheemergency operating procedures (EOPs),ifavailable.
This should include indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG.Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam, and/or SG sampling system.Determination of the"uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action.This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the affected SG 4-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 to the environment.
Thisshouldincludeindication ofreduction inprimarycoolantinventory, increased secondary radiation levels,andanuncontrolled orcompletedepressurization oftherupturedSG.Secondary radiation increases shouldbeobservedviaradiation monitoring ofcondenser airejectordischarge, SGblowdown, mainsteam,and/orSGsamplingsystem.Determination ofthe"uncontrolled" depressurization oftherupturedSGshouldbebasedonindication thatthepressuredecreaseintherupturedsteamgenerator isnotafunctionofoperatoraction.Thisshouldpreventdeclaration basedonadepressurization thatresultsfromanEOPinducedcooldownoftheRCSthatdoesnotinvolvetheprolonged releaseofcontaminated secondary coolantfromtheaffectedSG4-14 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1totheenvironment.
This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.PEG  
ThisEALencompasses steambreaks,feedbreaks,andstuckopensafetyorreliefvalves.PEG


==Reference:==
==Reference:==


RCS3.1BasisReference(s):
RCS3.1 Basis Reference(s):
1.E-3"SteamGenerator TubeRupture"4-15 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.2SGTubeRupturew/Secondary Release4.2.2GeneralEmergency Unisolable secondary sidelinebreakwithSGtuberuptureasidentified inE-3"SteamGenerator TubeRupture"ANDAnyindicators offuelcladdamage,Table4.2Table4.2FuelCladDamaeIndicators ORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300p.Ci/ccofI-131Containment radmonitorR-29/R-30 reading>100R/hrLetdownMonitorR-9reading>10R/hrNUMARCIC:N/AFPBloss/potential loss:Fuelcladloss/potential loss,RCSloss,Containment lossModeApplicability:
1.E-3"Steam Generator Tube Rupture" 4-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.2 SG Tube Rupture w/Secondary Release 4.2.2 General Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 p.Ci/cc of I-131 Containment rad monitor R-29/R-30 reading>100 R/hr Letdown Monitor R-9 reading>10 R/hr NUMARC IC: N/A FPB loss/potential loss: Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALisintendedtoaddressthefullspectrumofSteamGenerator (SG)tuberuptureeventsinconjunction withalossofcontainment duetoasignificant secondary linebreakwithactualorpotential lossofthefuelcladintegrity.
Power operation, hot shutdown Basis: This EAL is intended to address the full spectrum of Steam Generator (SG)tube rupture events in conjunction with a loss of containment due to a significant secondary line break with actual or potential loss of the fuel clad integrity.
ThisEALaddresses rupturedSG(s)withanunisolable secondary linebreakcorresponding tothelossof2of3fissionproductbarriers(RCSbarrierandcontainment barrier)withtheactualorpotential lossofthethird(fuelcladding).
This EAL addresses ruptured SG(s)with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier)with the actual or potential loss of the third (fuel cladding).
Thisallowsthedirectreleaseofradioactive fissionandactivation productstotheenvironment.
This allows the direct release of radioactive fission and activation products to the environment.
Resultant offsitedoseratesareafunctionofmanyvariables.
Resultant offsite dose rates are a function of many variables.
Examplesinclude:coolantactivity, actualleakrate,SGcarryover,iodinepartitioning, andmeteorology.
Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.
4-16 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Theindications utilizedshouldbeconsistent withthediagnostic activities oftheemergency operating procedures (EOPs),ifavailable.
4-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), if available.
Thisshouldinclude.indication ofreduction inprimarycoolantinventory, increased secondary radiation levels,andanuncontrolled orcompletedepressurization oftherupturedSG.Secondary radiation increases shouldbeobservedviaradiation monitoring ofcondenser airejectordischarge, SGblowdown, mainsteam,.and/orSGsamplingsystem.Determination ofthe"uncontrolled" depressurization oftherupturedSGshouldbebasedonindication thatthepressuredecreaseintherupturedsteamgenerator isnotafunctionofoperatoraction.Thisshouldpreventdeclaration basedonadepressurization thatresultsfromanEOPinducedcooldownoftheRCSthatdoesnotinvolvetheprolonged releaseofcontaminated secondary coolantfromtheafFectedSGtotheenvironment.
This should include.indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG.Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam,.and/or SG sampling system.Determination of the"uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action.This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the afFected SG to the environment.
ThisEALencompasses steambreaks,feedbreaks,andstuckopensafetyorreliefvalves.Table4.2presentsfuelcladlossandp'otential lossindicators:
This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.Table 4.2 presents fuel clad loss and p'otential loss indicators:
~ORANGEorREDpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basis~Coolantactivity>300pCi/ccofI-131:RefertoEAL&#xb9;2.1.2basis~Containment radmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10R/hr:RefertoEAL&#xb9;2.2.2basisThiscondition represents alossofbothRCSandprimarycontainment withthelossorpotential lossoffuelcladdingandthuswarrantsdeclaration ofaGeneralEmergency.
~ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL&#xb9;1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL&#xb9;1.2.1 basis~Coolant activity>300 pCi/cc of I-131: Refer to EAL&#xb9;2.1.2 basis~Containment rad monitor reading>100 R/hr: Refer to EAL&#xb9;2.3.2 basis~Letdown Monitor R-9 reading>10 R/hr: Refer to EAL&#xb9;2.2.2 basis This condition represents a loss of both RCS and primary containment with the loss or potential loss of fuel cladding and thus warrants declaration of a General Emergency.
PEG
PEG  


==Reference:==
==Reference:==


RCS3.1+FC1.2,FC1.3,FC2.1,FC3.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):
RCS 3.1+FC1.2, FC1.3, FC2.1, FC3.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
1.2.3.45.6.'7.8.Technical Specifications Section3.1.5.2EPIP2-16,CoreDamageEstimation CSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequate CoreCooling,Revision7FR-C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"Radiation Monitoring System"4-17 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev14.0Containment 4.3Combustible GasConcentrations 4.3.1GeneralEmergency
1.2.3.4 5.6.'7.8.Technical Specifications Section 3.1.5.2 EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiation Monitoring System" 4-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment
>4%hydrogenconcentration incontainment MJMARCIC:N/AFPBloss/potential loss:Fuelcladloss,RCSloss,Containment potential lossModeApplicability:
 
Poweroperation, hotshutdownBasis:Existence ofanexplosive mixture(4%hydrogen) meansahydrogenandoxygenconcentration ofatleastthelowerdeflagration limitcurveexists.Whenhydrogenandoxygenconcentrations reachorexceedthedeflagration limits,imminentlossofthecontainment barrierexists.Togeneratesuchlevelsofcombustible gas,lossofthefuelcladandRCSbarriersmusthaveoccurred.
===4.3 Combustible===
ThisEALrepresents lossofbothfuelcladand,RCSwiththepotential lossofcontainment andtherefore warrantsdeclaration ofaGeneralEmergency.
Gas Concentrations 4.3.1 General Emergency>4%hydrogen concentration in containment MJMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
PEG
Power operation, hot shutdown Basis: Existence of an explosive mixture (4%hydrogen)means a hydrogen and oxygen concentration of at least the lower deflagration limit curve exists.When hydrogen and oxygen concentrations reach or exceed the deflagration limits, imminent loss of the containment barrier exists.To generate such levels of combustible gas, loss of the fuel clad and RCS barriers must have occurred.This EAL represents loss of both fuel clad and,RCS with the potential loss of containment and therefore warrants declaration of a General Emergency.
PEG  


==Reference:==
==Reference:==


PC2.4BasisReference(s):
PC2.4 Basis Reference(s):
1.FR-Z.1"Response toHighContainment Pressure" 4-18 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0ManyEALsare'asedonactualorpotential degradation offissionproductbarriersbecauseoftheincreased potential foro&#xc3;siteradioactivity release.Degradation offissionproductbarriersthough,isnotalwaysapparentvianon-radiological symptoms.
1.FR-Z.1"Response to High Containment Pressure" 4-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Many EALs are'ased on actual or potential degradation of fission product barriers because of the increased potential for o&#xc3;site radioactivity release.Degradation of fission product barriers though, is not always apparent via non-radiological symptoms.Therefore, direct indication of increased radiological effluents or area radiation levels are appropriate symptoms for emergency classification.
Therefore, directindication ofincreased radiological effluents orarearadiation levelsareappropriate symptomsforemergency classification.
At lower levels, abnormal radioactivity releases may be indicative of a failure of containment systems or precursors to more significant releases.At higher release rates, offsite radiological conditions may result which require offsite protective actions.Increased area radiation levels in plant may also be indicative of the failure of containment systems or preclude access to plant vital equipment necessary to ensure plant safety.There are two basic indications of radioactivity release rates and one for area radiation levels which warrant emergency classifications.
Atlowerlevels,abnormalradioactivity releasesmaybeindicative ofafailureofcontainment systemsorprecursors tomoresignificant releases.
Di iii ii f Bl i ii'i'g systems provides a rapid assessment mechanism to determine releases in excess of classifiable limits.P.Projected offsite doses (based on effluent monitor readings)or actual offsite field measurements indicating doses or dose rates above classifiable limits.: Sustained general area radiation levels in excess of those indicating loss of control of radioactive materials or those levels which may preclude access to vital plant areas also warrant emergency classification.
Athigherreleaserates,offsiteradiological conditions mayresultwhichrequireoffsiteprotective actions.Increased arearadiation levelsinplantmayalsobeindicative ofthefailureofcontainment systemsorprecludeaccesstoplantvitalequipment necessary toensureplantsafety.Therearetwobasicindications ofradioactivity releaseratesandoneforarearadiation levelswhichwarrantemergency classifications.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.1 Unusual Event A valid reading on any monitors Table 5.1 column"NUE" for)60 min.unless sample analysis can confirm release rates<2 x technical specifications within this time period.Table 5.1 Effluent Monitor Classification Thresholds Monitor NUE Alert R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)
DiiiiiifBliii'i'gsystemsprovidesarapidassessment mechanism todetermine releasesinexcessofclassifiable limits.P.Projected offsitedoses(basedoneffluentmonitorreadings) oractualoffsitefieldmeasurements indicating dosesordoseratesaboveclassifiable limits.:Sustained generalarearadiation levelsinexcessofthoseindicating lossofcontrolofradioactive materials orthoselevelswhichmayprecludeaccesstovitalplantareasalsowarrantemergency classification.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.1EffluentMonitors5.1.1UnusualEventAvalidreadingonanymonitorsTable5.1column"NUE"for)60min.unlesssampleanalysiscanconfirmreleaserates<2xtechnical specifications withinthistimeperiod.Table5.1EffluentMonitorClassification Thresholds MonitorNUEAlertR-11R-12R-13R-14R-15R-18R-12A(7/9)
R-14A(7/9)
R-14A(7/9)
R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00p,Ci/cc0.533p,Ci/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33p,Ci/cc115.00p,Ci/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrNU1KARCIC:Anyunplanned releaseofgaseousorliquidradioactivity totheenvironment thatexceedstwotimestheradiological Technical Specifications for60minutesorlonger.FPBloss/potential loss:N/AModeApplicability:
R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 p,Ci/cc 0.533 p,Ci/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 p,Ci/cc 115.00 p,Ci/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr NU1KARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0Basis:The"valueshown"foreachmonitoristwotimesthecalculated Technical Specification releaseratesasspecified inP-9section2.4.Unplanned releasesinexcessoftwotimesthesitetechnical specifications thatcontinuefor60minutesorlongerrepresent anuncontrolled situation andhence,apotential degradation inthelevelofsafety.Thefinalintegrated dose(whichisverylowintheUnusualEventemergency class)isnottheprimaryconcernhere;itisthedegradation inplantcontrolimpliedbythefactthatthereleasewasnotisolatedwithin60minutes.Therefore, itisnotintendedthatthereleasebeaveragedover60minutes.Forexample,areleaseof4timesT/Sfor30minutesdoesnotexceedthisinitiating condition.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis: The"value shown" for each monitor is two times the calculated Technical Specification release rates as specified in P-9 section 2.4.Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.The final integrated dose (which is very low in the Unusual Event emergency class)is not the primary concern here;it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes.Therefore, it is not intended that the release be averaged over 60 minutes.For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.
Further,theEmergency Coordinator shouldnotwaituntil60minuteshaselapsed,butshoulddeclaretheeventassoonasitisdetermined thatthereleasedurationhasorwilllikelyexceed60minutes.Monitorindications arecalculated onthebasisofthemethodology ofthesiteOffsiteDoseCalculation Manual(ODCM).Annualaveragemeteorology isused.Validmeansthataradiation monitorreadinghasbeenconfirmed bytheoperators tobecorrect.PEG
Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes.Monitor indications are calculated on the basis of the methodology of the site Offsite Dose Calculation Manual (ODCM).Annual average meteorology is used.Valid means that a radiation monitor reading has been confirmed by the operators to be correct.PEG  


==Reference:==
==Reference:==


AU1.1BasisReference(s):
AU1.1 Basis Reference(s):
1.2.3.4.5.6.EPIP2-3Emergency ReleaseRateDetermination P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.3"Calculations forNU)~CEALs"byP.S.PolfleitFileEAL.XLSRD-15.0ODCM5.3 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.1EffluentMonitors5.1.2Alert.AvalidreadingonanymonitorsTable5.1column"Alert"for>15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"Alert"withinthistimeperiod.MonitorTable5.1EfQuentMonitorClassification Thresholds NUEQE,R-11R-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)
1.2.3.4.5.6.EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3"Calculations for NU)~C EALs" by P.S.Polfleit File EAL.XLS RD-15.0 ODCM 5.3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.2 Alert.A valid reading on any monitors Table 5.1 column"Alert" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"Alert" within this time period.Monitor Table 5.1 EfQuent Monitor Classification Thresholds NUE QE, R-11 R-12 R-13 R-14 R-15 R-18 R-12 A(7/9)R-14A(7/9)
R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50pCi/cc19.0mEVhr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrTable5.2DoseProjection/
R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 pCi/cc 19.0 mEVhr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr Table 5.2 Dose Projection/
Env.Measurement Classification Thresholds TEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr 0
Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 0
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0NUINARCIC:Anyunplanned releaseofgaseousorliquidradioactivity totheenvironment thatexceeds200timesradiological Technical Specifications for15minutesorlonger.FPBloss/potential loss:N/AModeApplicability:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:
Basis:Thiseventescalates fromtheUnusualEventbyescalating themagnitude ofthereleasebyafactorof100.Prorating the500mR/yrcriterion forbothtime(8766hr/yr)andthe200multiplier, theassociated siteboundarydoseratewouldbe10mR/hr.Therequiredreleasedurationwasreducedto15minutesinrecognition oftheincreased severity.
Basis: This event escalates from the Unusual Event by escalating the magnitude of the release by a factor of 100.Prorating the 500 mR/yr criterion for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.The required release duration was reduced to 15 minutes in recognition of the increased severity.Monitor indications are calculated on the basis of the methodology of the EPIP 2-18 Control Room Dose Assessment.
Monitorindications arecalculated onthebasisofthemethodology oftheEPIP2-18ControlRoomDoseAssessment.
Annual average meteorology is used.As previously stated;the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits, rounded down to 10 mR/hr.The values for the gaseous effluent radiation monitors are based upon not exceeding 10 mR/hr at the site boundary as a result of the release.The conversion factors are based upon the mixture of noble gas present in reactor coolant during the V25/82 tube rupture-normal operations.
Annualaveragemeteorology isused.Aspreviously stated;the10mR/hrvalueisbasedonaproration of200timesthe500mR/yrbasisofthe10CFR20non-occupational MPClimits,roundeddownto10mR/hr.Thevaluesforthegaseouseffluentradiation monitorsarebaseduponnotexceeding 10mR/hratthesiteboundaryasaresultoftherelease.Theconversion factorsarebaseduponthemixtureofnoblegaspresentinreactorcoolantduringtheV25/82tuberupture-normaloperations.
Since there is no high range monitor associated with liquid e6luent monitor R-18 and the 200x Technical Specification value is beyond it's upper scale, an indication of"offscale hi" is conservatively used.Valid means that a radiation monitor reading has been confirmed by the operators to be correct.  
Sincethereisnohighrangemonitorassociated withliquide6luentmonitorR-18andthe200xTechnical Specification valueisbeyondit'supperscale,anindication of"offscale hi"isconservatively used.Validmeansthataradiation monitorreadinghasbeenconfirmed bytheoperators tobecorrect.  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0PEG
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG


==Reference:==
==Reference:==


AA1.1BasisReference(s):
AA1.1 Basis Reference(s):
1.2.3.45.EPIP2-3Emergency ReleaseRateDetermination P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.3"Calculations forNUMARCEALs"byP.S.PolfleitFileEAL.XLS OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.1EffluentMonitors5.1.3SiteAreaEmergency AvalidreadingonanymonitorsTable5.1column"SAE"for)15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"SAE"withinthistimeperiod.MonitorTable5.1EfHuentMonitorClassification Thresholds AlertR-11R-12R-13R-14R-15R-18R-12A(7/9)
1.2.3.4 5.EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3"Calculations for NUMARC EALs" by P.S.Polfleit File EAL.XLS OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.3 Site Area Emergency A valid reading on any monitors Table 5.1 column"SAE" for)15 min.unless dose assessment can confirm releases are below Table 5.2 column"SAE" within this time period.Monitor Table 5.1 EfHuent Monitor Classification Thresholds Alert R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)
R-14A(7/9)
R-14A(7/9)
R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50p,Ci/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mEUhr23.8mR/hrTable5.2DoseProjection/
R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 p,Ci/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mEUhr 23.8 mR/hr Table 5.2 Dose Projection/
Env.Measurement Classification Thresholds AlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0MBCARCIC:Boundarydoseresulting fromanactualorimminentreleaseofgaseousradioactivity exceeds100mRemTEDEor500mRCDEThyroidfortheactualorprojected durationoftherelease.FPBloss/potential loss:N/AModeApplicability:
Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 MBCARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.FPB loss/potential loss: N/A Mode Applicability:
Basis:Thevaluesshownweredetermined utilizing EPIP2-18"ControlRoomDoseAssessment" basedupona100mRwholebodyexposure.
Basis: The values shown were determined utilizing EPIP 2-18"Control Room Dose Assessment" based upon a 100 mR whole body exposure.The calculations made the assumption of neutral stability and an 8 mph wind speed.These conditions represent annual average meteorology.
Thecalculations madetheassumption ofneutralstability andan8mphwindspeed.Theseconditions represent annualaveragemeteorology.
The most restrictive x/Q values at the 0-0.5 mile distance were used.EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of 1E-4.The 100 mR integrated dose is based on the proposed 10CFR20 annual average population exposure.This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes.It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class description.
Themostrestrictive x/Qvaluesatthe0-0.5miledistancewereused.EPIP2-18specifies thatwholebodydoseislimitingwithrespecttoemergency classification andprotective actionrecommendations basedupontheassumption ofanoblegastoiodineratioof1E-4.The100mRintegrated doseisbasedontheproposed10CFR20annualaveragepopulation exposure.
The 500 mR integrated child thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.Integrated doses are generally not monitored in real-time.
Thisvaluealsoprovidesadesirable gradient(oneorderofmagnitude) betweentheAlert,SiteAreaEmergency, andGeneralEmergency classes.Itisdeemedthatexposures lessthanthislimitarenotconsistent withtheSiteAreaEmergency classdescription.
In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 100 mR/hour whole body or 500 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).
The500mRintegrated childthyroiddosewasestablished inconsideration ofthe1:5ratiooftheEPAProtective ActionGuidelines forwholebodythyroid.Integrated dosesaregenerally notmonitored inreal-time.
Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.Valid means that a radiation monitor reading has been con6rmed by the operators to be correct.
Inestablishing theemergency actionlevels,adurationofonehourisassumed,basedonasiteboundarydoseof100mR/hourwholebodyor500mR/hourchildthyroid,whichever ismorelimiting(dependsonsourcetermassumptions).
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG
AlthoughEPIP2-18providesforR-3V32releasedeterminations, thevariability ofresultsbaseduponthenumberofARV'sand/orSV'sprecludes theuseofanysinglemonitordefaultvalueforthesemonitors.
Validmeansthataradiation monitorreadinghasbeencon6rmedbytheoperators tobecorrect.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0PEG


==Reference:==
==Reference:==


AS1.1BasisReference(s):
AS1.1 Basis Reference(s):
1.2.3.45.P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment FSARTable2.3"Calculations forMJMARCEALs"byP.S.PolfleitFileEAL.XLSRD-15.0ODCMTables3,5and7 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.1.4GeneralEmergency 5.1EQ1uentMonitorsAvalidreadingonanymonitorsTable5.1column"GE"for>15min.unlessdoseassessment canconfirmreleasesarebelowTable5.2column"GE"withinthistimeperiod.Table5.1EfQuentMonitorClassification Thresholds MonitorR-11R-12R-13R-14R-15R-18R-12A(7/9)
1.2.3.4 5.P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment FSAR Table 2.3"Calculations for MJMARC EALs" by P.S.Polfleit File EAL.XLS RD-15.0 ODCM Tables 3, 5 and 7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1.4 General Emergency 5.1 EQ1uent Monitors A valid reading on any monitors Table 5.1 column"GE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"GE" within this time period.Table 5.1 EfQuent Monitor Classification Thresholds Monitor R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)
R-14A(7/9)
R-14A(7/9)
R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4SafetyNUE1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AAlertN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533p,Ci/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mEUhr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrTable5.2DoseProjection
R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety NUE 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A Alert N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 p,Ci/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mEUhr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr Table 5.2 Dose Projection
/Env.Measurement Classification Thresholds TEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr5-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0NUIVCARCIC:Boundarydoseresulting fromanactualorimminentreleaseofgaseousradioactivity exceeds1000mRemTEDEor5000mRCDEThyroidfortheactualorprojected durationofthereleaseusingactualmeteorology.
/Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 5-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUIVCARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
Basis:Thevaluesshownweredetermined utilizing EPIP2-18"ControlRoomDoseAssessment" basedupona1000mRwholebodyexposure.
Basis: The values shown were determined utilizing EPIP 2-18"Control Room Dose Assessment" based upon a 1000 mR whole body exposure.The calculations made the assumption of neutral stability and an 8 mph wind speed.These conditions represent annual average meteorology.
Thecalculations madetheassumption ofneutralstability andan8mphwindspeed.Theseconditions represent annualaveragemeteorology.
EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of lE-4.The 1000 mR whole body and the 5000 mR child thyroid integrated dose are based on the EPA protective action guidance which indicates that public protective actions are indicated if the dose exceeds 1 rem whole body or 5 rem child thyroid.This is consistent with the emergency class description for a General Emergency.
EPIP2-18specifies thatwholebodydoseislimitingwithrespecttoemergency classification andprotective actionrecommendations basedupontheassumption ofanoblegastoiodineratiooflE-4.The1000mRwholebodyandthe5000mRchildthyroidintegrated dosearebasedontheEPAprotective actionguidancewhichindicates thatpublicprotective actionsareindicated ifthedoseexceeds1remwholebodyor5remchildthyroid.Thisisconsistent withtheemergency classdescription foraGeneralEmergency.
This level constitutes the upper level of the desirable gradient for the Site Area Emergency.
Thislevelconstitutes theupperlevelofthedesirable gradientfortheSiteAreaEmergency.
Integrated doses are generally not monitored in real-time.
Integrated dosesaregenerally notmonitored inreal-time.
In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 1000 mR/hour whole body or 5000 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).
Inestablishing theemergency actionlevels,adurationofonehourisassumed,basedonasiteboundarydoseof1000mR/hourwholebodyor5000mR/hourchildthyroid,whichever ismorelimiting(dependsonsourcetermassumptions).
Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.Valid means that a radiation monitor reading has been, con6rmed by the operators to be correct.5-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG
AlthoughEPIP2-18providesforR-3V32releasedeterminations, thevariability ofresultsbaseduponthenumberofARV'sand/orSV'sprecludes theuseofanysinglemonitordefaultvalueforthesemonitors.
Validmeansthataradiation monitorreadinghasbeen,con6rmedbytheoperators tobecorrect.5-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0PEG


==Reference:==
==Reference:==


AG1.1*BasisReference(s):
AG1.1*Basis Reference(s):
l.2.3.4P-9'Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment FSARTable2.3"Calculations forMV~CEALs"byP.S.PolQeitFileEAL.XLS5-12 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.2DoseProjections/
l.2.3.4 P-9'Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment FSAR Table 2.3"Calculations for MV~C EALs" by P.S.PolQeit File EAL.XLS 5-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/
Environmental Measurements/Release Rates5.2.1UnusualEventConfirmed sampleanalysesforgaseousorliquidreleaserates>2xtechnical specifications limitsfor>60min.NUINARCIC:Anyunplanned releaseofgaseousorliquidradioactivity totheenvironment thatexceedstwotimestheradiological Technical Specifications for60minutesorlonger.FPBloss/potential loss:N/AModeApplicability:
Environmental Measurements/Release Rates 5.2.1 Unusual Event Confirmed sample analyses for gaseous or liquid release rates>2 x technical specifications limits for>60 min.NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:
Basis:Unplanned releasesinexcessoftwotimesthesitetechnical specifications thatcontinuefor60minutesorlongerrepresent anuncontrolled situation andhence,apotential degradation inthelevelofsafety.Thefinalintegrated dose(whichisverylowintheUnusualEventemergency class)isnottheprimaryconcernhere;itisthedegradation inplantcontrolimpliedbythefactthatthereleasewasnotisolatedwithin60minutes.Therefore, itisnotintendedthatthereleasebeaveragedover60minutes.Forexample,areleaseof4timesT/Sfor30minutesdoesnotexceedthisinitiating condition.
Basis: Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.The final integrated dose (which is very low in the Unusual Event emergency class)is not the primary concern here;it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes.Therefore, it is not intended that the release be averaged over 60 minutes.For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.
Further,theEmergency Coordinator shouldnotwaituntil60minuteshaselapsed,butshoulddeclaretheeventassoonasitisdetermined thatthereleasedurationhasorwilllikelyexceed60minutesPEG
Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes PEG


==Reference:==
==Reference:==


AU1.25-13 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0BasisReference(s):,
AU1.2 5-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):, 1.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 5-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/
1.Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.35-14 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.2DoseProjections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates5.2.2AlertConfirmed sampleanalysesforgaseousorliquidreleaserates)200xtechnical specifications limitsfor>15min.NUINARCIC:Anyunplanned releaseofgaseousorliquidradioactivity totheenvironment thatexceeds200timesradiological Technical Specifications for15minutesorlonger.FPBloss/potential loss:N/AModeApplicability:
Release Rates 5.2.2 Alert Confirmed sample analyses for gaseous or liquid release rates)200 x technical specifications limits for>15 min.NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:
Basis:Confirmed sampleanalysesinexcessoftwohundredtimesthesitetechnical specifications thatcontinuefor15minutesorlongerrepresent anuncontrolled situation andhence,apotential degradation inthelevelofsafety.Thiseventescalates fromtheUnusualEventbyincreasing themagnitude ofthereleasebyafactorof100overtheUnusualEventlevel(i.e.,200timesTechnical Specifications).
Basis: Confirmed sample analyses in excess of two hundred times the site technical specifications that continue for 15 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i.e., 200 times Technical Specifications).
Prorating the500mR/yrbasisofthe10CFR20non-occupational MPClimitsforbothtime(8766hr/yr)andthe200multiplier, theassociated siteboundarydoseratewouldbe10mR/hr.Therequiredreleasedurationwasreducedto15minutesinrecognition oftheincreased severity.
Prorating the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.The required release duration was reduced to 15 minutes in recognition of the increased severity.PEG  
PEG


==Reference:==
==Reference:==


AA1.25-15 OSSI-92-402A-4-RE GGinnaEALTechnical BasesDocument, Rev0BasisReference(s):
AA1.2 5-15 OSSI-92-402A-4-RE G Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):
1.Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.35-16 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.2DoseProjections/
1.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 5-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates5.2.3AlertDoseprojections orfieldsurveysresulting fromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"Alert"atthesiteboundaryorbeyond.Table5.2DoseProjection
Release Rates 5.2.3 Alert Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"Alert" at the site boundary or beyond.Table 5.2 Dose Projection
/Env.Measurement Classification Thresholds AlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mB/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mH/hr5000mR/hrNUMARCIC:Anyunplanned releaseofgaseousorliquidradioactivity totheenvironment thatexceeds200timesradiological Technical Specifications for15minutesorlongerFPBloss/potential loss:N/AModeApplicability:
/Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mB/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mH/hr 5000 mR/hr NUMARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer FPB loss/potential loss: N/A Mode Applicability:
Basis.Offsiteintegrated dosesinexcessof10mRTEDEordoseratesinexcessof10mR/hrTEDErepresent anuncontrolled situation andhence,apotential degradation inthelevelofsafety.Thiseventescalates fromtheUnusualEventbyincreasing themagnitude ofthereleasebyafactorof100overtheUnusualEventlevel(i.e.,200timesTechnical Specifications).
Basis.Offsite integrated doses in excess of 10 mR TEDE or dose rates in excess of 10 mR/hr TEDE represent an uncontrolled situation and hence, a potential degradation in the level of safety.This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i.e., 200 times Technical Specifications).
Prorating the5-17 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0500mR/yrbasisof10CFR20forbothtime(8766hr/yr)andthe200multiplier, theassociated siteboundarydoseratewouldbe10mR/hr.Aspreviously stated,the10mR/hrvalueisbasedonaproration of200timesthe500mR/yrbasisof10CFR20,roundeddownto10mR/hr.PEG
Prorating the 5-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 500 mR/yr basis of 10CFR20 for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.As previously stated, the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of 10CFR20, rounded down to 10 mR/hr.PEG  


==Reference:==
==Reference:==


AA1.2BasisReference(s):
AA1.2 Basis Reference(s):
2.3.4Technical Specifications, Amendment No.24,Article's 3.9.1.1thru3.9.2.3EPIP2-3Emergency ReleaseRateDetermination P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment 5-18  
2.3.4 Technical Specifications, Amendment No.24, Article's 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment 5-18  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.2DoseProjections/
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates5.2.4SiteAreaEmergency Doseprojections orfieldsurveysresulting fromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"SAE"atthesiteboundaryorbeyond.Table5.2DoseProjection
Release Rates 5.2.4 Site Area Emergency Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"SAE" at the site boundary or beyond.Table 5.2 Dose Projection
/Env.Measurement Classification Thresholds TEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mH/hr500mH/hr1000mR5000mR1000mH/hr5000mH/hrNUINARCIC:Boundarydoseresulting fromanactualorimminentreleaseofgaseousradioactivity exceeds100mRemTEDEor500mRCDEThyroidfortheactualorprojected durationoftherelease.FPBloss/potential loss:N/AModeApplicability:
/Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mH/hr 500 mH/hr 1000 mR 5000 mR 1000 mH/hr 5000 mH/hr NUINARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.FPB loss/potential loss: N/A Mode Applicability:
'Basis:The100mRintegrated TEDEdoseinthisEALisbasedontheproposed10CFR20annualaveragepopulation exposure.
'Basis: The 100 mR integrated TEDE dose in this EAL is based on the proposed 10CFR20 annual average population exposure.This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes.It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class 5-19 OSSI-92-402A-4-BEG Ginna EAL Technical Bases Document, Rev 0 description.
Thisvaluealsoprovidesadesirable gradient(oneorderofmagnitude) betweentheAlert,SiteAreaEmergency, andGeneralEmergency classes.Itisdeemedthatexposures lessthanthislimitarenotconsistent withtheSiteAreaEmergency class5-19 OSSI-92-402A-4-BEG GinnaEALTechnical BasesDocument, Rev0description.
The 500 mR integrated CDE thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.In establishing the dose rate emergency action levels, a duration of one hour is assumed.Therefore, the dose rate EALs are based on a site boundary dose rate of 100 mR/hr TEDE or 500 mRlhr CDE thyroid, whichever is more limiting.PEG  
The500mRintegrated CDEthyroiddosewasestablished inconsideration ofthe1:5ratiooftheEPAProtective ActionGuidelines forwholebodythyroid.Inestablishing thedoserateemergency actionlevels,adurationofonehourisassumed.Therefore, thedoserateEALsarebasedonasiteboundarydoserateof100mR/hrTEDEor500mRlhrCDEthyroid,whichever ismorelimiting.
PEG


==Reference:==
==Reference:==


AS1.3AS1.4BasisReference(s):
AS1.3 AS1.4 Basis Reference(s):
2.3.Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.3EPIP2-3Emergency ReleaseRateDetermination P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment t5-20 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.2DoseProjections/
2.3.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment t 5-20 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/
Environmental Measurements/
Environmental Measurements/
ReleaseRates5.2.5GeneralEmergency Doseprojections orfieldsurveysresulting Romactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"GE"atthesiteboundaryorbeyond.Table5.2DoseProection/Env.Measurement Classification Thresholds AlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mH/hrN/A100mR500mR100mH/hr500mR/hr1000mR5000mR1000mH/hr5000mH/hrNUIHARCICBoundarydoseresulting fromanactualorimminentreleaseofgaseousradioactivity exceeds1000mRemTEDEor5000mRCDEThyroidfortheactualorprojected durationofthereleaseusingactualmeteorology.
Release Rates 5.2.5 General Emergency Dose projections or field surveys resulting Rom actual or imminent release which indicate doses/dose rates>Table 5.2 column"GE" at the site boundary or beyond.Table 5.2 Dose Pro ection/Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mH/hr N/A 100 mR 500 mR 100 mH/hr 500 mR/hr 1000 mR 5000 mR 1000 mH/hr 5000 mH/hr NUIHARC IC Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
Basis:TheGeneralEmergency valuesofTable5.2arebasedontheboundarydoseresulting fromanactualorimminentreleaseofgaseousradioactivity thatexceeds1000mRTEDEor5000mRCDEthyroidfortheactualorprojected durationoftherelease.The1000mRTEDEandthe5000mRCDEthyroidintegrated dosearebasedontheEPAprotective actionguidancewhich5-21 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0indicates thatpublicprotective actionsareindicated ifthedoseexceeds1remTEDEor5remCDEthyroid.Thisisconsistent withtheemergency classdescription foraGeneralEmergency.
Basis: The General Emergency values of Table 5.2 are based on the boundary dose resulting from an actual or imminent release of gaseous radioactivity that exceeds 1000 mR TEDE or 5000 mR CDE thyroid for the actual or projected duration of the release.The 1000 mR TEDE and the 5000 mR CDE thyroid integrated dose are based on the EPA protective action guidance which 5-21 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 indicates that public protective actions are indicated if the dose exceeds 1 rem TEDE or 5 rem CDE thyroid.This is consistent with the emergency class description for a General Emergency.
Thislevelconstitutes theupperlevelofthedesirable gradientfortheSiteAreaEmergency.
This level constitutes the upper level of the desirable gradient for the Site Area Emergency.
Actualmeteorology isspecifically identified sinceitgivesthemostaccuratedoseassessment.
Actual meteorology is specifically identified since it gives the most accurate dose assessment.
Actualmeteorology (including forecasts) shouldbeusedwheneverpossible.
Actual meteorology (including forecasts) should be used whenever possible.In establishing the dose rate emergency action levels, a duration of one hour is assumed.Therefore, the dose rate EALs are based on a site boundary dose rate of 1000 mR/hr TEDE or 5000 mR/hr CDE thyroid, whichever is more limiting.PEG  
Inestablishing thedoserateemergency actionlevels,adurationofonehourisassumed.Therefore, thedoserateEALsarebasedonasiteboundarydoserateof1000mR/hrTEDEor5000mR/hrCDEthyroid,whichever ismorelimiting.
PEG


==Reference:==
==Reference:==


AG1.3AG1.4~BasisReference(s):
AG1.3 AG1.4~Basis Reference(s):
2.3.4Technical Specifications, Amendment No.24,Articles3.9.1.1thru3.9.2.3EPIP2-3Emergency ReleaseRateDetermination P-9Radiation Monitoring SystemEPIP2-18ControlRoomDoseAssessment 5-22 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.3AreaRadiation Levels5.3.1UnusualEventAnysustained directARMreadings>100xalarmoroffscalehiresulting fromanuncontrolled processMMARCIC:Unexpected increaseinplantradiation orairborneconcentration.
2.3.4 Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment 5-22 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.1 Unusual Event Any sustained direct ARM readings>100 x alarm or offscale hi resulting from an uncontrolled process MMARC IC: Unexpected increase in plant radiation or airborne concentration.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
Basis:Validelevatedarearadiation levelsusuallyhavelongleadtimesrelativetothepotential forradiological releasebeyondthesiteboundary, thusimpacttopublichealthandsafetyisverylow.ItshouldbenotedthattheCASandSASdonothaveinstalled radiation monitors.
Basis: Valid elevated area radiation levels usually have long lead times relative to the potential for radiological release beyond the site boundary, thus impact to public health and safety is very low.It should be noted that the CAS and SAS do not have installed radiation monitors.Therefore, evaluation of this EAL would require survey of these areas.This EAL addresses unplanned increases in radiation levels inside the plant.These radiation levels represent a degradation in the control of radioactive material and a potential degradation in the level of safety of the plant.Area radiation levels above 100 times the alarm setpoint have been selected because they are readily identifiable on ARM instrumentation.
Therefore, evaluation ofthisEALwouldrequiresurveyoftheseareas.ThisEALaddresses unplanned increases inradiation levelsinsidetheplant.Theseradiation levelsrepresent adegradation inthecontrolofradioactive materialandapotential degradation inthelevelofsafetyoftheplant.Arearadiation levelsabove100timesthealarmsetpointhavebeenselectedbecausetheyarereadilyidentifiable onARMinstrumentation.
Since ARM setpoints are nominally set one decade over normal levels, 100 times the alarm setpoint provides an appropriate threshold for emergency classification.
SinceARMsetpoints arenominally setonedecadeovernormallevels,100timesthealarmsetpointprovidesanappropriate threshold foremergency classification.
For those ARMs whose upper range limit are less than 100 times the alarm setpoint, a value of offscale high is used.This EAL escalates to an Alert, if the increases impair the level of safe plant operation.
ForthoseARMswhoseupperrangelimitarelessthan100timesthealarmsetpoint, avalueofoffscalehighisused.ThisEALescalates toanAlert,iftheincreases impairthelevelofsafeplantoperation.
0 0 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG
00 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0PEG


==Reference:==
==Reference:==


AU2.4.BasisReference(s):
AU2.4.Basis Reference(s):
None5-24 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.3AreaRadiation Levels5.3.2AlertSustained arearadiation levels)15ma/hrineither:ControlRoomORCentralAlarmStationandSecondary AlarmStationIVUMARCIC:Releaseofradioactive materialorincreases inradiation levelswithinthefacilitythatimpedesoperation ofsystemsrequiredtomaintainsafeoperations ortoestablish ormaintaincoldshutdown.
None 5-24 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.2 Alert Sustained area radiation levels)15 ma/hr in either: Control Room OR Central Alarm Station and Secondary Alarm Station IVUMARC IC: Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:
FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL addresses increased radiation levels that impede necessary access to operating stations requiring continuous occupancy to maintain safe plant operation or perform a safe plant shutdown.Areas requiring continuous occupancy include the Control Room, the central alarm station (CAS)and the secondary security alarm station (SAS).The security alarm stations are included in this EAL because of their importance to permitting access to areas required to assure safe plant operations.
Basis:ThisEALaddresses increased radiation levelsthatimpedenecessary accesstooperating stationsrequiring continuous occupancy tomaintainsafeplantoperation orperformasafeplantshutdown.
The value of 15 mR/hr is derived from the GDC 19 value of 5 rem in 30 days with adjustment for expected occupancy times.Although Section III.D.3 of NUREG-0737,"Clarification of TMI Action Plan Requirements", provides that the 15 mR/hr value can be averaged over the 30 days, the value is used here without averaging.
Areasrequiring continuous occupancy includetheControlRoom,thecentralalarmstation(CAS)andthesecondary securityalarmstation(SAS).ThesecurityalarmstationsareincludedinthisEALbecauseoftheirimportance topermitting accesstoareasrequiredtoassuresafeplantoperations.
A 30 day duration implies an event potentially more significant than an Alert.5-25 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant.The cause or magnitude of the increase in radiation levels is not a concern of this EAL.The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine if any other EALs may be involved.For example, a dose rate of 15 mR/hr in the Control Room may be a problem in itself.However, the increase may also be indicative of high dose rates in the containment due to a LOCA.In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.
Thevalueof15mR/hrisderivedfromtheGDC19valueof5remin30dayswithadjustment forexpectedoccupancy times.AlthoughSectionIII.D.3ofNUREG-0737, "Clarification ofTMIActionPlanRequirements",
This EAL is not intended to apply to anticipated temporary radiation increases due to planned events (e.g., radwaste container movement, depleted resin transfers, etc.).PEG  
providesthatthe15mR/hrvaluecanbeaveragedoverthe30days,thevalueisusedherewithoutaveraging.
A30daydurationimpliesaneventpotentially moresignificant thananAlert.5-25 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0Itistheimpairedabilitytooperatetheplantthatresultsintheactualorpotential degradation ofthelevelofsafetyoftheplant.Thecauseormagnitude oftheincreaseinradiation levelsisnotaconcernofthisEAL.TheEmergency Coordinator mustconsiderthesourceorcauseoftheincreased radiation levelsanddetermine ifanyotherEALsmaybeinvolved.
Forexample,adoserateof15mR/hrintheControlRoommaybeaprobleminitself.However,theincreasemayalsobeindicative ofhighdoseratesinthecontainment duetoaLOCA.Inthislattercase,aSiteAreaEmergency oraGeneralEmergency maybeindicated byotherEALcategories.
ThisEALisnotintendedtoapplytoanticipated temporary radiation increases duetoplannedevents(e.g.,radwastecontainer
: movement, depletedresintransfers, etc.).PEG


==Reference:==
==Reference:==


AA3.1BasisReference(s):
AA3.1 Basis Reference(s):
1.GDC192.NUREG-0737, "Clari6cation ofTMIActionPlanRequirements",
1.GDC 19 2.NUREG-0737,"Clari6cation of TMI Action Plan Requirements", Section III.D.3 3.P-9 Radiation Monitoring System Rev.67 5-26 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.3 Alert Sustained abnor mal area radiation levels>8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.Table 5.3 Plant Areas~Reactor Containment Building~Auxiliary Building~Turbine Building~Emergency Diesel Building~Screen House~Standby Auxiliary Feedwater Building NUMARC IC: Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:
SectionIII.D.33.P-9Radiation Monitoring SystemRev.675-26 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev05.0Radioactivity Release/AreaRadiation 5.3AreaRadiation Levels5.3.3AlertSustained abnormalarearadiation levels>8R/hrwithinanyareas,Table5.3ANDAccessisrequiredtoestablish ormaintaincoldshutdown.
Basis: This EAL addresses increased radiation levels in areas requiring infrequent access in order to maintain safe plant operation or perform a safe plant shutdown.Area radiation levels at or above 8 H/hr are indicative of radiation fields which may limit personnel access or adversely affect equipment whose operation may be needed to assure adequate core cooling or shutdown the reactor.The basis of the value is described in NMPC memo File Code 5-27 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NMP31027"Exposure Guidelines For Unusual/Accident Conditions".
Table5.3PlantAreas~ReactorContainment Building~Auxiliary Building~TurbineBuilding~Emergency DieselBuilding~ScreenHouse~StandbyAuxiliary Feedwater BuildingNUMARCIC:Releaseofradioactive materialorincreases inradiation levelswithinthefacilitythatimpedesoperation ofsystemsrequiredtomaintainsafeoperations ortoestablish ormaintaincoldshutdown.
The areas selected are consistent with those listed in other EALs and represent those structures which house systems and equipment necessary for the safe operation and shutdown of the plant.It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant.The cause or magnitude of the increase in radiation levels is not a concern of this EAL.The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine if any other EAL may be involved.For example, a dose rate of 8 R/hr may be a problem in itself.However, the increase may also be indicative of high dose rates in the containment due to a LOCA.In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.
FPBloss/potential loss:N/AModeApplicability:
This EAL is not meant to apply to increases in the containment radiation monitors as these are events which are addressed in other EALs.Nor is it intended to apply to anticipated temporary radiation increases due to planned events (e.g., radwaste container movement, deplete resin transfers, etc.).PEG  
Basis:ThisEALaddresses increased radiation levelsinareasrequiring infrequent accessinordertomaintainsafeplantoperation orperformasafeplantshutdown.
Arearadiation levelsatorabove8H/hrareindicative ofradiation fieldswhichmaylimitpersonnel accessoradversely affectequipment whoseoperation maybeneededtoassureadequatecorecoolingorshutdownthereactor.Thebasisofthevalueisdescribed inNMPCmemoFileCode5-27 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev0NMP31027"Exposure Guidelines ForUnusual/Accident Conditions".
Theareasselectedareconsistent withthoselistedinotherEALsandrepresent thosestructures whichhousesystemsandequipment necessary forthesafeoperation andshutdownoftheplant.Itistheimpairedabilitytooperatetheplantthatresultsintheactualorpotential degradation ofthelevelofsafetyoftheplant.Thecauseormagnitude oftheincreaseinradiation levelsisnotaconcernofthisEAL.TheEmergency Coordinator mustconsiderthesourceorcauseoftheincreased radiation levelsanddetermine ifanyotherEALmaybeinvolved.
Forexample,adoserateof8R/hrmaybeaprobleminitself.However,theincreasemayalsobeindicative ofhighdoseratesinthecontainment duetoaLOCA.Inthislattercase,aSiteAreaEmergency oraGeneralEmergency maybeindicated byotherEALcategories.
ThisEALisnotmeanttoapplytoincreases inthecontainment radiation monitorsastheseareeventswhichareaddressed inotherEALs.Norisitintendedtoapplytoanticipated temporary radiation increases duetoplannedevents(e.g.,radwastecontainer
: movement, depleteresintransfers, etc.).PEG


==Reference:==
==Reference:==


AA3.2BasisReference(s):
AA3.2 Basis Reference(s):
1.NiagaraMohawkPowerCorporation memoFileCodeNMP31027"Exposure Guidelines ForUnusuaVAccident Conditions",
1.Niagara Mohawk Power Corporation memo File Code NMP31027"Exposure Guidelines For UnusuaVAccident Conditions", Revision 1, 3/18/93 5-28 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Loss of vital plant electrical power can compromise plant safety system operability including decay heat removal and emergency core cooling systems which may be necessary to ensure fission product barrier integrity.
Revision1,3/18/935-28 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Lossofvitalplantelectrical powercancompromise plantsafetysystemoperability including decayheatremovalandemergency corecoolingsystemswhichmaybenecessary toensurefissionproductbarrierintegrity.
The events of this category have been grouped into the following two loss of electrical power types: A P r'his category includes losses of onsite and/or o6'site AC power sources including station blackout events.fD P r'his category involves total losses of vital plant 125 vdc power sources.
Theeventsofthiscategoryhavebeengroupedintothefollowing twolossofelectrical powertypes:APr'hiscategoryincludeslossesofonsiteand/oro6'siteACpowersourcesincluding stationblackoutevents.fDPr'hiscategoryinvolvestotallossesofvitalplant125vdcpowersources.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.1 Unusual Event 6.1 Loss of AC Power Sources Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for>15 min.NUINARC IC: Loss of all offsite power to essential busses for greater than 15 minutes.FPB loss/potential loss: N/A Mode Applicability:
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.1.1UnusualEvent6.1LossofACPowerSourcesLossofabilitytosupplypowertothesafeguard busesfromoffsitecircuits751and767for>15min.NUINARCIC:Lossofalloffsitepowertoessential bussesforgreaterthan15minutes.FPBloss/potential loss:N/AModeApplicability:
Basis: Prolonged loss of all oFsite AC power reduces required redundancy and potentially degrades the level of safety of the plant by rendering the plant more vulnerable to a complete loss of AC power (station blackout).
Basis:Prolonged lossofalloFsiteACpowerreducesrequiredredundancy andpotentially degradesthelevelofsafetyoftheplantbyrendering theplantmorevulnerable toacompletelossofACpower(stationblackout).
Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.PEG  
Fifteenminuteswasselectedasathreshold toexcludetransient ormomentary powerlosses.PEG


==Reference:==
==Reference:==


SU1.1BasisReference(s):
SU1.1 Basis Reference(s):
1.RGE-6"4160VElectrical Distribution System"2.RGE-7"480VDistribution
1.RGE-6"4160V Electrical Distribution System" 2.RGE-7"480V Distribution
"
"
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.1LossofACPowerSources6.1.2AlertLossof'allsafeguards busACpowerfor>15min.NUlKARCIC:LossofalloffsitepowerandlossofallonsiteACpowertoessential bussesduringcoldshutdown, refueling ordefueledmode.FPBloss/potential loss:N/AModeApplicability:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.2 Alert Loss of'all safeguards bus AC power for>15 min.NUlKARC IC: Loss of all offsite power and loss of all onsite AC power to essential busses during cold shutdown, refueling or defueled mode.FPB loss/potential loss: N/A Mode Applicability:
ColdShutdown, Refueling, DefueledBasis:LossofallACpowercompromises allplantsafetysystemsrequiring electricpower.ThisEALisindicated by:lossofallo6'siteANDonsiteACpowertosafeguards buses14/18AND16/17forgreaterthan15minutes.Whenincoldshutdown, refueling, ordefueledmodetheeventcanbeclassified asanAlert,becauseofthesigni6cantly reduceddecayheat,lowertemperature andpressure, increasing thetimetorestoreoneoftheemergency busses,relativetothatspeci6edfortheSiteAreaEmergency EAL.Escalating totheSiteAreaEmergency, ifappropriate, isbyAbnormalRadLevels/Radiological EfHuent,orEmergency Coordinator JudgmentICs.Fifteenminuteswasselectedasathreshold toexcludetransient ormomentary powerlosses.PEG
Cold Shutdown, Refueling, Defueled Basis: Loss of all AC power compromises all plant safety systems requiring electric power.This EAL is indicated by: loss of all o6'site AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes.When in cold shutdown, refueling, or defueled mode the event can be classified as an Alert, because of the signi6cantly reduced decay heat, lower temperature and pressure, increasing the time to restore one of the emergency busses, relative to that speci6ed for the Site Area Emergency EAL.Escalating to the Site Area Emergency, if appropriate, is by Abnormal Rad Levels/Radiological EfHuent, or Emergency Coordinator Judgment ICs.Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.PEG  


==Reference:==
==Reference:==


SA1.1BasisReference(s):
SA1.1 Basis Reference(s):
1.RGE-6"4160VElectrical Distribution System" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.1.3Alert6.1LossofACPowerSourcesAvailable safeguard trainACpowerreducedtoonlyoneofthefollowing for>15min.:~EDG1A(14/18)~EDG1B(16/17)~StationAuxiliary Transformer 12A~StationAuxiliary Transformer 12B1%JMARCIC:ACpowercapability toessential bussesreducedtoasinglepowersourceforgreaterthan15minutessuchthatanyadditional singlefailurewouldresultinstationblackoutwithreactorcoolant>200'F.FPBloss/potential loss:N/AModeApplicability:
1.RGE-6"4160V Electrical Distribution System" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.3 Alert 6.1 Loss of AC Power Sources Available safeguard train AC power reduced to only one of the following for>15 min.:~EDG 1A (14/18)~EDG 1B (16/17)~Station Auxiliary Transformer 12A~Station Auxiliary Transformer 12B 1%JMARC IC: AC power capability to essential busses reduced to a single power source for greater than 15 minutes such that any additional single failure would result in station blackout with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:Thecondition indicated bythisEAListhedegradation oftheoffsitepowerwithaconcurrent failureofoneemergency generator tosupplypowertoitsemergency busses.Anotherrelatedcondition couldbethelossofalloFsitepowerandlossofonsiteemergency dieselswithonlyonetrainofemergency bussesbeingfedfromtheunitmaingenerator, orthelossofonsiteemergency dieselswithonlyonetrainofemergency bussesbeingfedfromoffsitepower.Thesubsequent lossofthissinglepowersourcewouldescalatetheeventtoaSiteAreaEmergency.
Power operation, hot shutdown Basis: The condition indicated by this EAL is the degradation of the offsite power with a concurrent failure of one emergency generator to supply power to its emergency busses.Another related condition could be the loss of all oFsite power and loss of onsite emergency diesels with only one train of emergency busses being fed from the unit main generator, or the loss of onsite emergency diesels with only one train of emergency busses being fed from offsite power.The subsequent loss of this single power source would escalate the event to a Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.RGE-6"4160VElectrical Distribution" 2.RGE-7"480vDistribution" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.1LossofACPowerSources6.1.4SiteAreaEmergency Lossofallsafeguards busACpowerfor>15min.NUINARCIC:LossofalloffsitepowerandlossofallonsiteACpowertoessential busseswithreactorcoolant>200'F.FPBloss/potential loss:N/AModeApplicability:
1.RGE-6"4160V Electrical Distribution" 2.RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.4 Site Area Emergency Loss of all safeguards bus AC power for>15 min.NUINARC IC: Loss of all offsite power and loss of all onsite AC power to essential busses with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:LossofallACpowercompromises allplantsafetysystemsrequiring electricpower.ThisEALisindicated by:lossofalloffsiteANDonsiteACpowertosafeguards buses14/18AND16/17forgreaterthan15minutes.Prolonged lossofallACpowerwillcausecoreuncoveryandlossofcontainment integrity, thusthiseventcanescalatetoaGeneralEmergency.
Power operation, hot shutdown Basis: Loss of all AC power compromises all plant safety systems requiring electric power.This EAL is indicated by: loss of all offsite AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes.Prolonged loss of all AC power will cause core uncovery and loss of containment integrity, thus this event can escalate to a General Emergency.
Thetimedurationshouldbeselectedtoexcludetransient ormomentary powerlosses,butshouldnotexceed15minutes.PEG
The time duration should be selected to exclude transient or momentary power losses, but should not exceed 15 minutes.PEG  


==Reference:==
==Reference:==


SS1.1BasisReference(s):
SS1.1 Basis Reference(s):
1.RGE-6"4160VElectrical Distribution" 2.RGE-7"480vDistribution" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.1.5GeneralEmergency 6.1LossofACPowerSourcesLossofallsafeguards busACpowerANDeither:Powerrestoration toanysafeguards busisnotlikelyin54hrsORActualorimminententryintoORANGEorREDpathonF-0.2,"CORECOOLING"NUMARCIC:Prolonged lossofalloffsitepowerandprolonged lossofallonsiteACpowerwithreactorcoolant>200'F.FPBloss/potential loss:N/AModeApplicability:
1.RGE-6"4160V Electrical Distribution" 2.RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.5 General Emergency 6.1 Loss of AC Power Sources Loss of all safeguards bus AC power AND either: Power restoration to any safeguards bus is not likely in 5 4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2,"CORE COOLING" NUMARC IC: Prolonged loss of all offsite power and prolonged loss of all onsite AC power with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:LossofallACpowercompromises allplantsafetysystemsrequiring electricpower.Prolonged lossofallACpowerwillleadtolossoffuelclad,RCS,andcontainment.
Power operation, hot shutdown Basis: Loss of all AC power compromises all plant safety systems requiring electric power.Prolonged loss of all AC power will lead to loss of fuel clad, RCS, and containment.
AlthoughthisEALmaybeviewedasredundant totheRPVWaterLevelEALs,itsinclusion isnecessary tobetterassuretimelyrecognition andemergency response.
Although this EAL may be viewed as redundant to the RPV Water Level EALs, its inclusion is necessary to better assure timely recognition and emergency response.This EAL is specified to assure that in the unlikely event of prolonged station blackout, timely recognition of the seriousness of the event occurs and that declaration of a General Emergency occurs as early as is appropriate, based on a reasonable assessment of the event trajectory.
ThisEALisspecified toassurethatintheunlikelyeventofprolonged stationblackout, timelyrecognition oftheseriousness oftheeventoccursandthatdeclaration ofaGeneralEmergency occursasearlyasisappropriate, basedonareasonable assessment oftheeventtrajectory.
The likelihood of restoring at least one emergency bus should be based on a realistic appraisal of the situation since a delay in an upgrade decision based on only a chance of mitigating the event could result in a loss of valuable time in preparing and implementing public protective actions.
Thelikelihood ofrestoring atleastoneemergency busshouldbebasedonarealistic appraisal ofthesituation sinceadelayinanupgradedecisionbasedononlyachanceofmitigating theeventcouldresultinalossofvaluabletimeinpreparing andimplementing publicprotective actions.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 In addition, under these conditions, fission product barrier monitoring capability may be degraded.Although it may be difBcult to predict when power can be restored, the Emergency Coordinator should declare a General Emergency based on two major considerations:
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Inaddition, undertheseconditions, fissionproductbarriermonitoring capability maybedegraded.
1.Are there any present indications that core cooling is already degraded to the point that Loss or Potential Loss of fission product barriers is imminent?2.If there are no present indications of such core cooling degradation, how likely is it that power can be restored in time to assure that a loss of two barriers with a potential loss of the third barrier can be prevented?
AlthoughitmaybedifBculttopredictwhenpowercanberestored, theEmergency Coordinator shoulddeclareaGeneralEmergency basedontwomajorconsiderations:
Thus, indication of continuing core cooling degradation must be based on fission product barrier monitoring with particular emphasis on Emergency Coordinator judgment as it relates to imminent loss or potential loss of fission product barriers and degraded ability to monitor fission product barriers.The time to restore AC power is based on site blackout coping analysis performed in conformance with 10CFR50.63 and Regulatory Guide 1.155,"Station Blackout", with appropriate allowance for offsite emergency response.PEG  
1.Arethereanypresentindications thatcorecoolingisalreadydegradedtothepointthatLossorPotential Lossoffissionproductbarriersisimminent?
2.Iftherearenopresentindications ofsuchcorecoolingdegradation, howlikelyisitthatpowercanberestoredintimetoassurethatalossoftwobarrierswithapotential lossofthethirdbarriercanbeprevented?
Thus,indication ofcontinuing corecoolingdegradation mustbebasedonfissionproductbarriermonitoring withparticular emphasisonEmergency Coordinator judgmentasitrelatestoimminentlossorpotential lossoffissionproductbarriersanddegradedabilitytomonitorfissionproductbarriers.
ThetimetorestoreACpowerisbasedonsiteblackoutcopinganalysisperformed inconformance with10CFR50.63 andRegulatory Guide1.155,"StationBlackout",
withappropriate allowance foroffsiteemergency response.
PEG


==Reference:==
==Reference:==


SG1.1BasisReference(s):
SG1.1 Basis Reference(s):
1.2.3.4F-0.2,"CORECOOLING,"
1.2.3.4 F-0.2,"CORE COOLING," NRC letter to Dr.Mecredy dated V30/92"RE Ginna Nuclear Power Plant Station Blackout Analysis (TAC M68548)RGE-6"4160v Electrical Distribution System" RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2.1 Unusual Event 6.2 Loss of DC Power Sources<105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.MMARC IC: Unplanned loss of required DC power during cold shutdown or refueling mode for greater than 15 minutes.FPB loss/potential loss: N/A Mode Applicability:
NRClettertoDr.MecredydatedV30/92"REGinnaNuclearPowerPlantStationBlackoutAnalysis(TACM68548)RGE-6"4160vElectrical Distribution System"RGE-7"480vDistribution" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.2.1UnusualEvent6.2LossofDCPowerSources<105vdcbusvoltageindications on125vdcbatteries 1Aand1Bfor>15min.MMARCIC:Unplanned lossofrequiredDCpowerduringcoldshutdownorrefueling modeforgreaterthan15minutes.FPBloss/potential loss:N/AModeApplicability:
Cold Shutdown, Refueling Basis: The purpose of this EAL is to recognize a loss of DC power compromising the ability to monitor and control the removal of decay heat during cold shutdown or refueling operations.
ColdShutdown, Refueling Basis:ThepurposeofthisEAListorecognize alossofDCpowercompromising theabilitytomonitorandcontroltheremovalofdecayheatduringcoldshutdownorrefueling operations.
This EAL is intended to be anticipatory in as much as the operating crew may not have necessary indication and control of equipment needed to respond to the loss.The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment.
ThisEALisintendedtobeanticipatory inasmuchastheoperating crewmaynothavenecessary indication andcontrolofequipment neededtorespondtotheloss.Thebusvoltageisbasedontheminimumbusvoltagenecessary fortheoperation ofsafetyrelatedequipment.
This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.PEG  
Thisvoltagevalueincorporates amarginofatleast15minutesofoperation beforetheonsetofinability tooperateloads.PEG


==Reference:==
==Reference:==


SU7.1BasisReference(s):
SU7.1 Basis Reference(s):
1.RGE-9"Instrument BusandDCPowerSystem" OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev16.0Electrical Failures6.2.2SiteAreaEmergency 6.2LossofDCPowerSources>105vdcbusvoltageindications on125vdcbatteries 1Aand1B.for>15min.NUINARCIC:LossofallvitalDCpowerwithreactorcoolant>200'F.FPBloss/potential loss:N/AModeApplicability:
1.RGE-9"Instrument Bus and DC Power System" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2.2 Site Area Emergency 6.2 Loss of DC Power Sources>105 vdc bus voltage indications on 125 vdc batteries 1A and 1B.for>15 min.NUINARC IC: Loss of all vital DC power with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:LossofallDCpowercompromises abilitytomonitorandcontrolplantsafetyfunctions.
Power operation, hot shutdown Basis: Loss of all DC power compromises ability to monitor and control plant safety functions.
Prolonged lossofallDCpowerwillcausecoreuncovering andlossofcontainment integrity whenthereissignificant decayheatandsensibleheatinthereactorsystem.Escalation toaGeneralEmergency wouldoccurbyotherEALcategories.
Prolonged loss of all DC power will cause core uncovering and loss of containment integrity when there is significant decay heat and sensible heat in the reactor system.Escalation to a General Emergency would occur by other EAL categories.
Fifteenminuteswasselectedasathreshold toexcludetransient ormomentary powerlosses.Thebusvoltageisbasedontheminimumbusvoltagenecessary fortheoperation ofsafetyrelatedequipment.
Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment.
Thisvoltagevalueincorporates amarginofatleast15minutesofoperation beforetheonsetofinability tooperateloads.PEG
This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.PEG  


==Reference:==
==Reference:==


SS3.1BasisReference(s):
SS3.1 Basis Reference(s):
1.RGE-9"Instrument BusandDCPowerSystem"6-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Numerousplantsystemrelatedequipment failureeventswhichwarrantemergency classification, basedupontheirpotential toposeactualorpotential threatstoplantsafety,havebeenidentified inthiscategory.
1.RGE-9"Instrument Bus and DC Power System" 6-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Numerous plant system related equipment failure events which warrant emergency classification, based upon their potential to pose actual or potential threats to plant safety, have been identified in this category.The events of this category have been grouped into the following event types: T'Only one EAL falls under this event type related to the failure of the plant to be brought to the required plant operating condition required by technical specifications.
Theeventsofthiscategoryhavebeengroupedintothefollowing eventtypes:T'OnlyoneEALfallsunderthiseventtyperelatedtothefailureoftheplanttobebroughttotherequiredplantoperating condition requiredbytechnical specifications.
m il r r n r 1 m v i n This category includes events which are indicative of losses of operability of safety systems such as ECCS, isolation functions, Control Room habitability or cold and hot shutdown capabilities.
milrrnr1mvinThiscategoryincludeseventswhichareindicative oflossesofoperability ofsafetysystemssuchasECCS,isolation functions, ControlRoomhabitability orcoldandhotshutdowncapabilities.
fn'nA1 n''li Certain events which degrade the plant operators ability to effectively assess plant conditions or communicate with essential personnel within or external to the plant warrant emergency classification.
fn'nA1n''liCertaineventswhichdegradetheplantoperators abilitytoeffectively assessplantconditions orcommunicate withessential personnel withinorexternaltotheplantwarrantemergency classification.
Under this event type are losses of annunciators and/or communication equipment.
Underthiseventtypearelossesofannunciators and/orcommunication equipment.
7-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.1 Technical Speci6cation Requirements
7-1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.1Technical Speci6cation Requirements 7.1.1Unusual'Event Plantisnotbroughttorequiredoperating modewithinTechnical Specifications LCOActionStatement Time.1%UAIARCIC:Inability toreachrequiredshutdownwithinTechnical Specification Limits.FPBloss/potential loss:N/AModeApplicability:
 
Poweroperation, hotshutdownBasis:LimitingConditions ofOperation (LCOs)requiretheplanttobebroughttoarequiredshutdownmodewhentheTechnical Specification requiredconfiguration cannotberestored.
====7.1.1 Unusual'Event====
Depending onthecircumstances, thismayormaynotbeanemergency orprecursor toamoreseverecondition.
Plant is not brought to required operating mode within Technical Specifications LCO Action Statement Time.1%UAIARC IC: Inability to reach required shutdown within Technical Specification Limits.FPB loss/potential loss: N/A Mode Applicability:
Inanycase,theinitiation ofplantshutdownrequiredbythesiteTechnical Specification requiresaonehourreportunder10CFR50.72 (b)non-emergency events.Theplantiswithinitssafetyenvelopewhenbeingshutdownwithintheallowable actionstatement timeintheTechnical Specifications.
Power operation, hot shutdown Basis: Limiting Conditions of Operation (LCOs)require the plant to be brought to a required shutdown mode when the Technical Specification required configuration cannot be restored.Depending on the circumstances, this may or may not be an emergency or precursor to a more severe condition.
Animmediate Notification ofanUnusualEventisrequiredwhentheplantisnotbroughttotherequiredoperating modewithintheallowable actionstatement timeintheTechnical Specifications.
In any case, the initiation of plant shutdown required by the site Technical Specification requires a one hour report under 10CFR50.72 (b)non-emergency events.The plant is within its safety envelope when being shut down within the allowable action statement time in the Technical Specifications.
Declaration ofanUnusualEventisbasedonthetimeatwhichtheLCO-specified actionstatement timeperiodelapsesunderthesiteTechnical Specifications andisnotrelatedtohowlongacondition mayhaveexisted.OtherrequiredTechnical Specification shutdowns thatinvolveprecursors tomoreseriouseventsareaddressed byotherEALs.7-2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG
An immediate Notification of an Unusual Event is required when the plant is not brought to the required operating mode within the allowable action statement time in the Technical Specifications.
Declaration of an Unusual Event is based on the time at which the LCO-specified action statement time period elapses under the site Technical Specifications and is not related to how long a condition may have existed.Other required Technical Specification shutdowns that involve precursors to more serious events are addressed by other EALs.7-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==


SU2.1BasisReference(s):
SU2.1 Basis Reference(s):
1.Technical Specifications Section3.07-3 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.2SystemFailuresorControlRoomEvacuation 7.2.1UnusualEventReportofmainturbinefailureresulting incasingpenetration ordamagetoturbinesealsorgenerator seals.NUMARCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/AModeApplicability:
1.Technical Specifications Section 3.0 7-3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.1 Unusual Event Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.NUMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:
PowerOperation, hotshutdownBasis:ThisEALisintendedtoaddressmainturbinerotatingcomponent failuresofsuf6cient magnitude tocauseobservable damagetotheturbinecasingortothesealsoftheturbinegenerator.
Power Operation, hot shutdown Basis: This EAL is intended to address main turbine rotating component failures of suf6cient magnitude to cause observable damage to the turbine casing or to the seals of the turbine generator.
Ofmajorconcernisthepotential forleakageofcombustible fluids(lubricating oils)andgases(hydrogen cooling)totheplantenvirons.
Of major concern is the potential for leakage of combustible fluids (lubricating oils)and gases (hydrogen cooling)to the plant environs.Actual fires and flammable gas build up are appropriately classified through other EALs.This EAL is consistent with the definition of an Unusual Event while maintaining the anticipatory nature desired and recognizing the risk to non-safety related equipment.
Actualfiresandflammable gasbuildupareappropriately classified throughotherEALs.ThisEALisconsistent withthedefinition ofanUnusualEventwhilemaintaining theanticipatory naturedesiredandrecognizing therisktonon-safety relatedequipment.
PEG  
PEG


==Reference:==
==Reference:==


HU1.6BasisReference(s):
HU1.6 Basis Reference(s):
None7-4 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.2SystemFailuresorControlRoomEvacuation 7.2.2AlertTurbinefailuregenerated missilesresultinanyvisiblestructural damagetoplantvitalequipment NUINARCIC:Naturalanddestructive phenomena affecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
None 7-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.2 Alert Turbine failure generated missiles result in any visible structural damage to plant vital equipment NUINARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
PowerOperations, HotShutdownBasis:ThisEALaddresses thethreattosafetyrelatedequipment imposedbymissilesgenerated bymainturbinerotatingcomponent failures.
Power Operations, Hot Shutdown Basis: This EAL addresses the threat to safety related equipment imposed by missiles generated by main turbine rotating component failures.The involved equipment includes safety-related equipment, their controls, and their power supplies.This EAL is consistent with the definition of an ALERT in that, if missiles have damaged or penetrated areas containing safety-related equipment, the potential exists for substantial degradation of the level of safety of the plant.PEG  
Theinvolvedequipment includessafety-related equipment, theircontrols, andtheirpowersupplies.
ThisEALisconsistent withthedefinition ofanALERTinthat,ifmissileshavedamagedorpenetrated areascontaining safety-relatedequipment, thepotential existsforsubstantial degradation ofthelevelofsafetyoftheplant.PEG


==Reference:==
==Reference:==


HA1.6BasisReference(s):
HA1.6 Basis Reference(s):
None7-5 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.2SystemFailuresorControlRoomEvacuation 7.2.3AlertEntryintoAP-CR.1"ControlRoomInaccessability" MMARCIC:Controlroomevacuation hasbeeninitiated.
None 7-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.3 Alert Entry into AP-CR.1"Control Room Inaccessability" MMARC IC: Control room evacuation has been initiated.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
AllBasis:WiththeControlRoomevacuated, additional support,monitoring anddirection throughtheTechnical SupportCenterand/orotheremergency operations centerisnecessary.
All Basis: With the Control Room evacuated, additional support, monitoring and direction through the Technical Support Center and/or other emergency operations center is necessary.
Inability toestablish plantcontrolfromoutsidetheControlRoomwillescalatethiseventtoaSiteAreaEmergency.
Inability to establish plant control from outside the Control Room will escalate this event to a Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


HA5.1BasisReference(s):
HA5.1 Basis Reference(s):
1.AP-CR.1ControlRoomInaccessibility 7-6 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures17.2SystemFailuresorControlRoomEvacuation 7.2.4AlertReactorcoolanttemperature cannotbemaintained
1.AP-CR.1 Control Room Inaccessibility 7-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 1 7.2 System Failures or Control Room Evacuation 7.2.4 Alert Reactor coolant temperature cannot be maintained
<200'FNUINARCIC:Inability tomaintainplantincoldshutdown.
<200'F NUINARC IC: Inability to maintain plant in cold shutdown.FPB loss/potential loss: N/A Mode Applicability:
FPBloss/potential loss:N/AModeApplicability:
Cold Shutdown, Refueling Basis: h This EAL addresses complete loss of functions required for core cooling during refueling and cold shutdown modes.Escalation to Site Area Emergency or General Emergency would be through other EALs.A reactor coolant temperature increase that approaches or exceeds the cold shutdown technical specification limit warrants declaration of an Alert irrespective of the availability of technical specification required functions to maintain cold shutdown.The concern of this EAL is the loss of ability to maintain the plant in cold shutdown which is defined by reactor coolant temperature and not the operability of equipment which supports removal of heat from the reactor.PEG  
ColdShutdown, Refueling Basis:hThisEALaddresses completelossoffunctions requiredforcorecoolingduringrefueling andcoldshutdownmodes.Escalation toSiteAreaEmergency orGeneralEmergency wouldbethroughotherEALs.Areactorcoolanttemperature increasethatapproaches orexceedsthecoldshutdowntechnical specification limitwarrantsdeclaration ofanAlertirrespective oftheavailability oftechnical specification requiredfunctions tomaintaincoldshutdown.
TheconcernofthisEAListhelossofabilitytomaintaintheplantincoldshutdownwhichisdefinedbyreactorcoolanttemperature andnottheoperability ofequipment whichsupportsremovalofheatfromthereactor.PEG


==Reference:==
==Reference:==


SA3.17-7 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
SA3.1 7-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.AP-RHR.1"LossofRHR"2.Technical Specifications Section1.23,AP-RHR-2"LossofRHRWhileOperating atReducedRCSInventory Conditions" 7-8 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1'7.0Equipment Failures7.2SystemFailuresorControlRoomEvacuation 7.2.5SiteAreaEmergency ControlRoomevacuation ANDCorecoolingcannotbeestablished perAP-CR.1"ControlRoomInaccessibility" in~20min.MJMARCIC:Controlroomevacuation hasbeeninitiated andcontrolofcorecoolingcannotbeestablished.
1.AP-RHR.1"Loss of RHR" 2.Technical Specifications Section 1.2 3, AP-RHR-2"Loss of RHR While Operating at Reduced RCS Inventory Conditions" 7-8 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.5 Site Area Emergency Control Room evacuation AND Core cooling cannot be established per AP-CR.1"Control Room Inaccessibility" in~20 min.MJMARC IC: Control room evacuation has been initiated and control of core cooling cannot be established.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALindicates thatexpeditious transferofsafetysystemshasnotoccurredbutfissionproductbarrierdamagemaynotyetbeindicated.
Basis: This EAL indicates that expeditious transfer of safety systems has not occurred but fission product barrier damage may not yet be indicated.
Thetimeintervalfortransferisbasedonanalysisorassessments astohowquicklycontrolmustbereestablished withoutcoreuncovering and/orcoredamage.Thedesigncriteriafortheremoteshutdownequipment specifies thatcontrolofsafetysystemsmustbeabletobeachievedwithoutresulting incoreuncoveryorcoredamage.REGNPSAppendixRsubmittal indicates 20minutesisthemaximumtimeforwhichcontrolofplantsafetysystemsshouldoccurunderworstcaseconditions.
The time interval for transfer is based on analysis or assessments as to how quickly control must be reestablished without core uncovering and/or core damage.The design criteria for the remote shutdown equipment specifies that control of safety systems must be able to be achieved without resulting in core uncovery or core damage.REGNPS Appendix R submittal indicates 20 minutes is the maximum time for which control of plant safety systems should occur under worst case conditions.
Therefore, 20minutesiswithinthedesigncriteriaoftheremoteshutdownequipment.
Therefore, 20 minutes is within the design criteria of the remote shutdown equipment.
Incoldshutdownandrefueling modes,operatorconcernisdirectedtowardmaintaining corecoolingsuchasisdiscussed inGenericLetter88-17,"LossofDecayHeatRemoval."
In cold shutdown and refueling modes, operator concern is directed toward maintaining core cooling such as is discussed in Generic Letter 88-17,"Loss of Decay Heat Removal." In power operation, and hot shutdown modes, operator concern is primarily directed toward maintaining critical safety functions and thereby assuring fission product barrie'r integrity.
Inpoweroperation, andhotshutdownmodes,operatorconcernisprimarily directedtowardmaintaining criticalsafetyfunctions andtherebyassuringfissionproductbarrie'rintegrity.
7-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG
7-9 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG


==Reference:==
==Reference:==


HS2.1BasisReference(s):
HS2.1 Basis Reference(s):
1.AP-CR.1ControlRoomInaccessibility 2.AppendixRSection6.4.5page6-353.GenericLetter88-17,"LossofDecayHeatRemoval."
1.AP-CR.1 Control Room Inaccessibility 2.Appendix R Section 6.4.5 page 6-35 3.Generic Letter 88-17,"Loss of Decay Heat Removal." 7-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications
7-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.3LossofIndications
/Alarms/Communication Capability 7.3.1 Unusual Event Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation Table 7.3 Vital Control Room Panels A AA B C D E F 0 NUINARC IC: Unplanned loss of most or all safety system annunciation or indication in the control room for greater than 15 minutes with reactor coolant temperature
/Alarms/Communication Capability 7.3.1UnusualEventUnplanned lossofannunciators orindications onanyControlRoomPanels,Table7.3for>15min.ANDIncreased surveillance isrequiredforsafeplantoperation Table7.3VitalControlRoomPanelsAAABCDEF0NUINARCIC:Unplanned lossofmostorallsafetysystemannunciation orindication inthecontrolroomforgreaterthan15minuteswithreactorcoolanttemperature
>2OO'F.FPB loss/potential loss: N/A Mode Applicability:
>2OO'F.FPBloss/potential loss:N/AModeApplicability:
Power operation, hot shutdown Basis: This EAL recognizes the difhculty associated with monitoring changing plant conditions without the use of a major portion of the annunciation or indication equipment.
Poweroperation, hotshutdownBasis:ThisEALrecognizes thedifhculty associated withmonitoring changingplantconditions withouttheuseofamajorportionoftheannunciation orindication equipment.
Recognition of the availability of computer based indication equipment is considered (PPCS and SAS)."Unplanned" loss of annunciators or indicators excludes scheduled maintenance and testing activities.
Recognition oftheavailability ofcomputerbasedindication equipment isconsidered (PPCSandSAS)."Unplanned" lossofannunciators orindicators excludesscheduled maintenance andtestingactivities.
It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use of judgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions.
Itisnotintendedthatplantpersonnel performadetailedcountoftheinstrumentation lostbuttheuseofjudgmentbytheShiftSupervisor asthethreshold fordetermining theseverityoftheplantconditions.
This judgment 7-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 is supported by the specific opinion of the Shik Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to, safely operate the plant.It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is included in this EAL due to difficulty associated with assessment of plant conditions.
Thisjudgment7-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1issupported bythespecificopinionoftheShikSupervisor thatadditional operating personnel willberequiredtoprovideincreased monitoring ofsystemoperation to,safelyoperatetheplant.Itisfurtherrecognized thatmostplantdesignsprovideredundant safetysystemindication poweredfromseparateuninterruptable powersupplies.
The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status.This will be addressed by their specific Technical Specification.
Whilefailureofalargeportionofannunciators ismorelikelythanafailureofalargeportionofindications, theconcernisincludedinthisEALduetodifficulty associated withassessment ofplantconditions.
The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.
Thelossofspecific, orseveral,safetysystemindicators shouldremainafunctionofthatspecificsystemorcomponent operability status.Thiswillbeaddressed bytheirspecificTechnical Specification.
If the shutdown is not in compliance with the Technical Specification action, the Unusual Event is based on EAL 7.1.1, Inability to Reach Required Shutdown Within Technical Specification Limits.Annunciators or indicators for this EAL must include those identified in the Abnormal Operating procedures, in the Emergency Operating Procedures, and in other EALs (e.g., area, process, and/or effluent rad monitors, etc.).Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.Due to the limited number of safety systems in operation during cold shutdown, refueling, and defueled modes, this EAL is not applicable during these modes of operation.
Theinitiation ofaTechnical Specification imposedplantshutdownrelatedtotheinstrument losswillbereportedvia10CFR50.72.
This Unusual Event will be escalated to an Alert if a transient is in progress during the loss of annunciation or indication.
Iftheshutdownisnotincompliance withtheTechnical Specification action,theUnusualEventisbasedonEAL7.1.1,Inability toReachRequiredShutdownWithinTechnical Specification Limits.Annunciators orindicators forthisEALmustincludethoseidentified intheAbnormalOperating procedures, intheEmergency Operating Procedures, andinotherEALs(e.g.,area,process,and/oreffluentradmonitors, etc.).Fifteenminuteswasselectedasathreshold toexcludetransient ormomentary powerlosses.Duetothelimitednumberofsafetysystemsinoperation duringcoldshutdown, refueling, anddefueledmodes,thisEALisnotapplicable duringthesemodesofoperation.
PEG  
ThisUnusualEventwillbeescalated toanAlertifatransient isinprogressduringthelossofannunciation orindication.
PEG


==Reference:==
==Reference:==


SU3.1BasisReference(s):
SU3.1 Basis Reference(s):
None7-12 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.3LossofIndications
None 7-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications
/Alarms/Communication Capability 7.3.2UnusualEventLossofallcommunications capability affecting theabilitytoeither:Performroutineoperations ORNotifyoffsiteagenciesorpersonnel NUMARCIC:Unplanned lossofallonsiteoroffsitecommunications capabilities.
/Alarms/Communication Capability 7.3.2 Unusual Event Loss of all communications capability affecting the ability to either: Perform routine operations OR Notify offsite agencies or personnel NUMARC IC: Unplanned loss of all onsite or offsite communications capabilities.
FPBloss/potential loss:~N/AModeApplicability:
FPB loss/potential loss:~N/A Mode Applicability:
Basis:ThepurposeofthisEAListorecognize alossofcommunications capability thateitherdefeatstheplantoperations staffabilitytoperformroutinetasksnecessary forplantope'rations ortheabilitytocommunicate problemswithoffsiteauthorities.
Basis: The purpose of this EAL is to recognize a loss of communications capability that either defeats the plant operations staff ability to perform routine tasks necessary for plant ope'rations or the ability to communicate problems with offsite authorities.
Thelossofoffsitecommunications abilityisexpectedtobesignificantly morecomprehensive thanthecondition addressed by10CFR50.72.
The loss of offsite communications ability is expected to be significantly more comprehensive than the condition addressed by 10CFR50.72.
Theonsitecommunications lossmustencompass thelossofallmeansofroutinecommunications (i.e.,phones,soundpoweredphonesystems,pagepartysystem,and'radios/walkie talkies).
The onsite communications loss must encompass the loss of all means of routine communications (i.e., phones, sound powered phone systems, page party system, and'radios/walkie talkies).The offsite communications loss must encompass the loss of all means of communications with offsite authorities.
Theoffsitecommunications lossmustencompass thelossofallmeansofcommunications withoffsiteauthorities.
This should include ENS, Bell lines, FAX transmissions, and dedicated phone systems.This EAL is intended to be used only when extraordinary means are being utilized to make communications possible (relaying of information from radio transmissions, individuals being sent to offsite locations, etc.).7-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1.PEG  
ThisshouldincludeENS,Belllines,FAXtransmissions, anddedicated phonesystems.ThisEALisintendedtobeusedonlywhenextraordinary meansarebeingutilizedtomakecommunications possible(relaying ofinformation fromradiotransmissions, individuals beingsenttooffsitelocations, etc.).7-13 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1.PEG


==Reference:==
==Reference:==


SU6.1BasisReference(s):
SU6.1 Basis Reference(s):
1.A-56,"Communication SystemsatGinnaStation"7-14 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.3LossofIndications
1.A-56,"Communication Systems at Ginna Station" 7-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications
/Alarms/Communication Capability 7.3.3AlertUnplanned lossofannunciators orindications onanyControlRoomPanels,.Table7.3for>15min.ANDIncreased surveillance isrequiredforsafeplantoperation ANDeither:Aplanttransient inprogressORPPCSandSASareunavailable Table7.3VitalControlRoomPanelsAABCDEFGNUMARCIC:Unplanned lossofmostorallsafetysystemannunciation orindication incontrolroomwitheither(1)asignificant transient inprogress, or(2)compensatory non-alarming indicators areunavailable withreactorcoolant>200'F.FPBloss/potential loss:N/AModeApplicability:
/Alarms/Communication Capability 7.3.3 Alert Unplanned loss of annunciators or indications on any Control Room Panels,.Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation AND either: A plant transient in progress OR PPCS and SAS are unavailable Table 7.3 Vital Control Room Panels AA B C D E F G NUMARC IC: Unplanned loss of most or all safety system annunciation or indication in control room with either (1)a significant transient in progress, or (2)compensatory non-alarming indicators are unavailable with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALrecognizes thedifBculty associated withmonitoring changingplant'onditions withouttheuseofamajorportionoftheannunciation orindication equipment duringatransient.
Power operation, hot shutdown Basis: This EAL recognizes the difBculty associated with monitoring changing plant'onditions without the use of a major portion of the annunciation or indication equipment during a transient.
Recognition oftheavailability ofcomputerbasedindication equipment isconsidered (PPCS,SAS,etc.)."Unplanned" lossofannunciators orindicators doesnotincludescheduled maintenance andtestingactivities.
Recognition of the availability of computer based indication equipment is considered (PPCS, SAS, etc.)."Unplanned" loss of annunciators or indicators does not include scheduled maintenance and testing activities.
7-15 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Itisnotintendedthatplantpersonnel performadetailedcountoftheinstrumentation lostbuttheuseofjudgmentbytheShiftSupervisor asthethreshold fordetermining theseverityoftheplantconditions.
7-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use of judgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions.
Thisjudgmentissupported bythespecificopinionoftheShiftSupervisor thatadditional operating personnel willberequiredtoprovideincreased monitoring ofsystemoperation tosafelyoperatetheplant.Itisfurtherrecognized thatmostplantdesignsprovideredundant safetysystemindication poweredfromseparateuninterruptable powersupplies.
This judgment is supported by the specific opinion of the Shift Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to safely operate the plant.It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is Uicluded in this EAL due to difFiculty associated with assessment of plant conditions.
Whilefailureofalargeportionofannunciators ismorelikelythanafailureofalargeportionofindications, theconcernisUicludedinthisEALduetodifFiculty associated withassessment ofplantconditions.
The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status, This will be addressed by the specific Technical Specification.
Thelossofspecific, orseveral,safetysystemindicators shouldremainafunctionofthatspecificsystemorcomponent operability status,Thiswillbeaddressed bythespecificTechnical Specification.
The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.
Theinitiation ofaTechnical Specification imposedplantshutdownrelatedtotheinstrument losswillbereportedvia10CFR50.72.
Annunciators or indicators for this EAL includes those identified in the Abnormal Operating Procedures, in the Emergency Operating Procedures, and in other EALs (e.g., area, process, and/or effluent rad monitors, etc.)."Significant transient" includes response to automatic or manually initiated functions such as trips, runbacks involving greater than 25%thermal power change, ECCS injections, or thermal power oscillations of 10%or greater.If both a major portion of the annunciation system and all computer monitoring are unavailable to the extent that the additional operating personnel are required to monitor indications, the Alert is required.Due to the limited number of safety systems in operation during cold shutdown, refueling and defueled modes, no EAL is indicated during these modes of operation.
Annunciators orindicators forthisEALincludesthoseidentified intheAbnormalOperating Procedures, intheEmergency Operating Procedures, andinotherEALs(e.g.,area,process,and/oreffluentradmonitors, etc.)."Significant transient" includesresponsetoautomatic ormanuallyinitiated functions suchastrips,runbacksinvolving greaterthan25%thermalpowerchange,ECCSinjections, orthermalpoweroscillations of10%orgreater.Ifbothamajorportionoftheannunciation systemandallcomputermonitoring areunavailable totheextentthattheadditional operating personnel arerequiredtomonitorindications, theAlertisrequired.
This Alert will be escalated to a Site Area Emergency if the operating crew cannot monitor the transient in progress, PEG  
Duetothelimitednumberofsafetysystemsinoperation duringcoldshutdown, refueling anddefueledmodes,noEALisindicated duringthesemodesofoperation.
ThisAlertwillbeescalated toaSiteAreaEmergency iftheoperating crewcannotmonitorthetransient inprogress, PEG


==Reference:==
==Reference:==


SA4.1BasisReference(s):
SA4.1 Basis Reference(s):
None7-16 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev17.0Equipment Failures7.3LossofIndications
None 7-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications
/Alarms/Communication Capability 7.3.4SiteAreaEmergency Lossofannunciators orindications onanyControlRoomPanels,Table7.3ANDCompletelossofabilitytomonitorallcriticalsafetyfunctionstatusANDAplanttransient inprogressTable7.3VitalControlRoomPanelsAAABCDE'GNUIKARCIC:Inability tomonitorasignificant transient inprogresswithreactorcoolant>200DFFPBloss/potential loss:N/AModeApplicability:
/Alarms/Communication Capability 7.3.4 Site Area Emergency Loss of annunciators or indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Table 7.3 Vital Control Room Panels A AA B C D E'G NUIKARC IC: Inability to monitor a significant transient in progress with reactor coolant>200 DF FPB loss/potential loss: N/A Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALrecognizes theinability oftheControlRoomstafftomonitortheplantresponsetoatransient.
Power operation, hot shutdown Basis: This EAL recognizes the inability of the Control Room staff to monitor the plant response to a transient.
ASiteAreaEmergency isconsidered toexistiftheControlRoomstaffcannotmonitorsafetyfunctions neededforprotection ofthepublic.Annunciators forthisEALshouldbelimitedtoincludethoseidentified intheAbnormalOperating Procedures, intheCSFST'sandEmergency Operating Procedures, andinotherEALs(e.g.,rad"monitors, etc.)."Significant transient" includesresponsetoautomatic ormanuallyinitiated functions suchasscrams,runbacksinvolving greaterthan25lothermal7-17 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1powerchange,ECCSinjections, orthermalpoweroscillations of10%orgreater.Indications neededtomonitorcriticalsafetyfunctions necessary for'rotection ofthepublicmustincludeControlRoomindications, computergenerated indications anddedicated annunciation capability.
A Site Area Emergency is considered to exist if the Control Room staff cannot monitor safety functions needed for protection of the public.Annunciators for this EAL should be limited to include those identified in the Abnormal Operating Procedures, in the CSFST's and Emergency Operating Procedures, and in other EALs (e.g., rad"monitors, etc.)."Significant transient" includes response to automatic or manually initiated functions such as scrams, runbacks involving greater than 25 lo thermal 7-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 power change, ECCS injections, or thermal power oscillations of 10%or greater.Indications needed to monitor critical safety functions necessary for'rotection of the public must include Control Room indications, computer generated indications and dedicated annunciation capability.
Thespecificindications shouldbethoseusedtodetermine suchfunctions astheabilitytoshutdownthereactor,maintainthecorecooledandinaeoolablegeometry, toremoveheatfromthecore,tomaintainthereactorcoolantsystemintact,andtomaintaincontainment intact."Planned" actionsareexcludedfromtheEALsincethelossofinstrumentation ofthismagnitude isofsuchsignificance duringatransient thatthecauseofthelossisnotanameliorating factor.PEG
The specific indications should be those used to determine such functions as the ability to shut down the reactor, maintain the core cooled and in a eoolable geometry, to remove heat from the core, to maintain the reactor coolant system intact, and to maintain containment intact."Planned" actions are excluded from the EAL since the loss of instrumentation of this magnitude is of such significance during a transient that the cause of the loss is not an ameliorating factor.PEG  


==Reference:==
==Reference:==


SS6.1BasisReference(s):
SS6.1 Basis Reference(s):
None7-18 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Hazardsarethosenon-plant systemrelatedeventswhichcandirectlyorindirectly impactplantoperation orreactorplantandpersonnel safety.Theeventsofthiscategoryhavebeengroupedintothefollowing types:PMtgpldt*dtptpintotheProtected Areaaswellasbombthreatsandsabotageattempts.
None 7-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Hazards are those non-plant system related events which can directly or indirectly impact plant operation or reactor plant and personnel safety.The events of this category have been grouped into the following types: PM tgp ld t*d tp t p into the Protected Area as well as bomb threats and sabotage attempts.Also addressed are actual security compromises threatening loss of physical control of the plant.Pl p lg ll tt*d t p l d reactor safety.Appropriate for classification are fires within the site Protected Area or which may affect operability of vital equipment.
Alsoaddressed areactualsecuritycompromises threatening lossofphysicalcontroloftheplant.Plplglltt*dtpldreactorsafety.Appropriate forclassification arefireswithinthesiteProtected Areaorwhichmayaffectoperability ofvitalequipment.
E M-d t tg-t Ml occurring events which can cause damage to plant facilities such as aircraft crashes, missile impacts, toxic or flammable gas leaks or explosions from whatever source.E t t', tqd d which have potential to cause damage to plant structures or equipment significant enough to threaten personnel or plant safety.
EM-dttg-tMloccurring eventswhichcancausedamagetoplantfacilities suchasaircraftcrashes,missileimpacts,toxicorflammable gasleaksorexplosions fromwhateversource.Ett',tqddwhichhavepotential tocausedamagetoplantstructures orequipment significant enoughtothreatenpersonnel orplantsafety.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.1 Unusual Event 8.1 Security Threats Bomb device or other indication of attempted sabotage discovered within plant Protected Area.OR Any security event which represents a potential degradation in the level of safety of the plant.MMARC IC: Confirmed security event which indicates a potential degradation in the level of safety of the plant.FPB loss/potential loss: N/A Mode Applicability:
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.1.1UnusualEvent8.1SecurityThreatsBombdeviceorotherindication ofattempted sabotagediscovered withinplantProtected Area.ORAnysecurityeventwhichrepresents apotential degradation inthelevelofsafetyoftheplant.MMARCIC:Confirmed securityeventwhichindicates apotential degradation inthelevelofsafetyoftheplant.FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL is based on the REGNPS Security Contingency Plan.Security events which do not represent at least a potential degradation in the level of safety of the plant, are reported under 10CFR73.71 or in some cases under 10CFR50.72, The plant Protected Area boundary is within the security isolation zone and is defined in the security plan.Bomb devices discovered within the plant vital area would result in EAL escalation.
Basis:ThisEALisbasedontheREGNPSSecurityContingency Plan.Securityeventswhichdonotrepresent atleastapotential degradation inthelevelofsafetyoftheplant,arereportedunder10CFR73.71 orinsomecasesunder10CFR50.72, TheplantProtected Areaboundaryiswithinthesecurityisolation zoneandisdefinedinthesecurityplan.Bombdevicesdiscovered withintheplantvitalareawouldresultinEALescalation.
PEG  
PEG


==Reference:==
==Reference:==


HU4.1HU4.2BasisReference(s):
HU4.1 HU4.2 Basis Reference(s):
1.REGNPSSecurityContingency Plan OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.1.2Alert8.1SecurityThreatsIntrusion intoplantProtected Areabyanadversary.
1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.2 Alert 8.1 Security Threats Intrusion into plant Protected Area by an adversary.
ORAnysecurityeventwhichrepresents anactualsubstantial degradation ofthelevelofsafetyoftheplant.MMARCIC:Securityeventinaplantprotected area.FPBloss/potential loss:N/AModeApplicability:
OR Any security event which represents an actual substantial degradation of the level of safety of the plant.MMARC IC: Security event in a plant protected area.FPB loss/potential loss: N/A Mode Applicability:
Basis:Thisclassofsecurityeventsrepresents anescalated threattoplantsafetyabovethatcontained intheUnusualEvent,ForthepurposesofthisEAL,theintrusion byunauth'orized personnel insidetheProtected Areaboundarycanbeconsidered asignificant securitythreat.Intrusion intoavitalareabyunauthorized personnel willescalatethiseventtoaSiteAreaEmergency.
Basis: This class of security events represents an escalated threat to plant safety above that contained in the Unusual Event, For the purposes of this EAL, the intrusion by unauth'orized personnel inside the Protected Area boundary can be considered a significant security threat.Intrusion into a vital area by unauthorized personnel will escalate this event to a Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


HA4.1HA4.2BasisReference(s):
HA4.1 HA4.2 Basis Reference(s):
1.REGNPSSecurityContingency Plan8.3 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.1.3SiteAreaEmergency 8.1SecurityThreats.Intrusion intoaplantsecurityvitalareabyanadversary.
1.REGNPS Security Contingency Plan 8.3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.3 Site Area Emergency 8.1 Security Threats.Intrusion into a plant security vital area by an adversary.
ORAnysecurityeventwhichrepresents actualorlikelyfailuresofplantsystemsneededtoprotectthepublic.MMARCIC:Securityeventinaplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
OR Any security event which represents actual or likely failures of plant systems needed to protect the public.MMARC IC: Security event in a plant vital area.FPB loss/potential loss: N/A Mode Applicability:
Basis:Thisclassofsecurityeventsrepresents anescalated threattoplantsafetyabovethatcontained intheAlertinthatunauthorized personnel haveprogressed fromtheProtected Areatothevitalarea.PEG
Basis: This class of security events represents an escalated threat to plant safety above that contained in the Alert in that unauthorized personnel have progressed from the Protected Area to the vital area.PEG  


==Reference:==
==Reference:==


HS1.1HS1.2BasisReference(s):
HS1.1 HS1.2 Basis Reference(s):
1.REGNPSSecurityContingency Plan OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.1.4GeneralEmergency 8.1SecurityThreatsSecurityeventwhichresultsin:LossofplantcontrolfromtheControlRoomORLossofremoteshutdowncapability NUMARCICSecurityeventresulting inlossofabilitytoreachandmaintaincoldshutdown.
1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.4 General Emergency 8.1 Security Threats Security event which results in: Loss of plant control from the Control Room OR Loss of remote shutdown capability NUMARC IC Security event resulting in loss of ability to reach and maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:
FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL encompasses conditions under which unauthorized personnel have taken physical control of vital areas required to reach and maintain safe shutdown.PEG  
Basis:ThisEALencompasses conditions underwhichunauthorized personnel havetakenphysicalcontrolofvitalareasrequiredtoreachandmaintainsafeshutdown.
PEG


==Reference:==
==Reference:==


HG1.1HG1.2BasisReference(s):
HG1.1 HG1.2 Basis Reference(s):
1.REGNPSSecurityContingency Plan OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1~8.0Hazards8.2.1UnusualEvent8.2FireorExplosion Confirmed fireinanyplantarea,Table8.2or8.3notextinguished in<15min.ofControlRoomnotification:
1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1~8.0 Hazards 8.2.1 Unusual Event 8.2 Fire or Explosion Confirmed fire in any plant area, Table 8.2 or 8.3 not extinguished in<15 min.of Control Room notification:
Table8.2PlantAreas~TurbineBuilding~TSCServiceBuilding~Contaminated StorageBuildingTable8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseNUIYIARCICFirewithinprotected areaboundarynotextinguished within15minutesofdetection.
Table 8.2 Plant Areas~Turbine Building~TSC Service Building~Contaminated Storage Building Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUIYIARC IC Fire within protected area boundary not extinguished within 15 minutes of detection.
FPBloss/potential loss:N/AModeApplicability:
FPB loss/potential loss: N/A Mode Applicability:
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Basis:ThepurposeofthisEAListoaddressthemagnitude andextentoffiresthatmaybepotentially significant precursors todamagetosafetysystems.Thisexcludessuchitemsasfireswithinadministration buildings, waste-basket fires,andothersmallfiresofnosafetyconsequence.
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis: The purpose of this EAL is to address the magnitude and extent of fires that may be potentially significant precursors to damage to safety systems.This excludes such items as fires within administration buildings, waste-basket fires, and other small fires of no safety consequence.
PEG
PEG  


==Reference:==
==Reference:==


HU2.1BasisReference(s):
HU2.1 Basis Reference(s):
1.SitePlotPlan OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.2.2Alert8.2FireorExplosion Fireorexplosion inanyplantarea,Table8.2orTable8.3whichresultsinEITHER:~visibledamagetoplantequipment orstructures neededforsafeplantoperation OR~whichaffectssafetysystemoperability asindicated bydegradedsystemperformance Table8.2PlantAreas~TurbineBuilding~TSC~ServiceBuilding~Contaminated StorageBuildingTable8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseNUIKARCIC:Fireorexplosion affecting theoperability ofplantsafetysystemsrequiredtoestablish ormaintainsafeshutdown.
1.Site Plot Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.2.2 Alert 8.2 Fire or Explosion Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:~visible damage to plant equipment or structures needed for safe plant operation OR~which affects safety system operability as indicated by degraded system performance Table 8.2 Plant Areas~Turbine Building~TSC~Service Building~Contaminated Storage Building Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUIKARC IC: Fire or explosion affecting the operability of plant safety systems required to establish or maintain safe shutdown.FPB loss/potential loss: N/A Mode Applicability:
FPBloss/potential loss:N/AModeApplicability:
All OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis: The listed areas contain functions and systems required for the safe shutdown of the plant.The REGNPS safe shutdown analysis was consulted for equipment and plant areas required for the applicable mode.With regard to explosions, only those explosions of suQicient force to damage permanent structures or equipment required for safe operation, or which results in degraded performance of safety systems within the identified plant areas should be considered.
All OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Basis:Thelistedareascontainfunctions andsystemsrequiredforthesafeshutdownoftheplant.TheREGNPSsafeshutdownanalysiswasconsulted forequipment andplantareasrequiredfortheapplicable mode.Withregardtoexplosions, onlythoseexplosions ofsuQicient forcetodamagepermanent structures orequipment requiredforsafeoperation, orwhichresultsindegradedperformance ofsafetysystemswithintheidentified plantareasshouldbeconsidered.
As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to nearby structures and materials.
Asusedhere,anexplosion isarapid,violent,unconfined combustion, oracatastrophic failureofpressurized equipment, thatpotentially impartssignificant energytonearbystructures andmaterials.
No attempt is made in this EAL to assess the actual magnitude of the damage.The wording of this EAL does not imply that an assessment of safety system performance is intended to be performed, rather that as a result of the event, safety system parameter symptoms are degraded as a result of the event.The declaration of an Alert and the activation of the TSC will provide the Emergency Coordinator with the resources needed to perform damage assessments.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.ThewordingofthisEALdoesnotimplythatanassessment ofsafetysystemperformance isintendedtobeperformed, ratherthatasaresultoftheevent,safetysystemparameter symptomsaredegradedasaresultoftheevent.Thedeclaration ofanAlertandtheactivation oftheTSCwillprovidetheEmergency Coordinator withtheresources neededtoperformdamageassessments.
The Emergency Coordinator also needs to consider any security aspects of the explosions.
TheEmergency Coordinator alsoneedstoconsideranysecurityaspectsoftheexplosions.
PEG  
PEG


==Reference:==
==Reference:==


HA2.1BasisReference(s):
HA2.1 Basis Reference(s):
1.SitePlotPlan OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.3.1UnusualEvent8.3Man-MadeEventsVehiclecrashintoorprojectile whichimpactsplantstructures orsystemswithinProtected AreaboundaryNUIKARCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/A~ModeApplicability:
1.Site Plot Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.1 Unusual Event 8.3 Man-Made Events Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary NUIKARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A~Mode Applicability:
Basis:TheProtected Areaboundaryiswithinthesecurityisolation zoneandisdefinedinthesitesecurityplan.ThisEALaddresses suchitemsasplane,helicopter, train,barge,carortruckcrash,orimpactofotherprojectiles thatmaypotentially damageplantstructures containing functions andsystemsrequiredforsafeshutdownoftheplant.Ifthecrashisconfirmed toaffectaplantvitalarea,theeventmaybeescalated toAlert.PEG
Basis: The Protected Area boundary is within the security isolation zone and is defined in the site security plan.This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of other projectiles that may potentially damage plant structures containing functions and systems required for safe shutdown of the plant.If the crash is confirmed to affect a plant vital area, the event may be escalated to Alert.PEG  


==Reference:==
==Reference:==


HU1.4BasisReference(s):
HU1.4 Basis Reference(s):
1.SitePlotPlan8-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.3.2UnusualEvent8.3Man-MadeEventsReportbyplantpersonnel ofanexplosion withinProtected Areaboundaryresulting invisibledamagetopermanent structures orequipment NUINARCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/AModeApplicability:
1.Site Plot Plan 8-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.2 Unusual Event 8.3 Man-Made Events Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment NUINARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:
Basis:TheProtected Areaboundaryiswithinthesecurityisolation zoneandisdefinedinthesitesecurityplan.ForthisEAL,onlythoseexplosions ofsufBcient forcetodamagepermanent structures orequipment withintheProtected Areashouldbeconsidered.
Basis: The Protected Area boundary is within the security isolation zone and is defined in the site security plan.For this EAL, only those explosions of sufBcient force to damage permanent structures or equipment within the Protected Area should be considered.
Asusedhere,anexplosion isarapid,violent,unconfined combustion, oracatastrophic failureofpressurized equipment, thatpotentially impartssignificant energytonearbystructures andmaterials.
As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to near by structures and materials.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.Theoccurrence oftheexplosion withreportsofevidenceofdamage(e.g.,deformation, scorching) issufficient fordeclaration.
No attempt is made in this EAL to assess the actual magnitude of the damage.The occurrence of the explosion with reports of evidence of damage (e.g., deformation, scorching) is sufficient for declaration.
TheEmergency Coordinator alsoneedstoconsideranysecurityaspectsoftheexplosion.
The Emergency Coordinator also needs to consider any security aspects of the explosion.
PEG
PEG  


==Reference:==
==Reference:==


HU1.5BasisReference(s):
HU1.5 Basis Reference(s):
1.SitePlotPlan8-11 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.3.3UnusualEvent8.3Man-MadeEventsReportordetection oftoxicorflammable gasesthatcouldenterorhaveenteredwithintheProtected AreaboundaryinamountsthatcouldafFectthe~healthofplantpersonnel orsafeplantoperation ORReportbylocal,countyorstateofficials forpotential evacuation ofsitepersonnel basedonoffsiteeventNUMARCIC:Releaseoftoxicorflammable gasesdeemeddetrimental tosafeoperation oftheplant.FPBloss/potential loss:N/AModeApplicability:
1.Site Plot Plan 8-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.3 Unusual Event 8.3 Man-Made Events Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could afFect the~health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event NUMARC IC: Release of toxic or flammable gases deemed detrimental to safe operation of the plant.FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALisbasedonreleasesinconcentrations withinthesiteboundarythat=willafFectthehealthofplantpersonnel orafFecting thesafeoperation oftheplantwiththeplantbeingwithintheevacuation areaofanofFsiteevent(i.e.,tankertruckaccidentreleasing toxicgases,etc.).Theevacuation areaisasdetermined fromtheDOTEvacuation TablesforSelectedHazardous Materials, intheDOTEmergency ResponseGuideforHazardous Materials.
Basis: This EAL is based on releases in concentrations within the site boundary that=will afFect the health of plant personnel or afFecting the safe operation of the plant with the plant being within the evacuation area of an ofFsite event (i.e., tanker truck accident releasing toxic gases, etc.).The evacuation area is as determined from the DOT Evacuation Tables for Selected Hazardous Materials, in the DOT Emergency Response Guide for Hazardous Materials.
Shouldanexplosion occurwithinaspecified plantarea,anAlertwouldbedeclaredbasedonEAL8.2.2.,PEG
Should an explosion occur within a specified plant area, an Alert would be declared based on EAL 8.2.2., PEG  


==Reference:==
==Reference:==


HU3.1HU3.28-12 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocumentRev 1BasisReference(s):
HU3.1 HU3.2 8-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases DocumentRev 1 Basis Reference(s):
None8-13  
None 8-13  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.3.4Alert8.3Man-MadeEventsVehiclecrashorprojectile impactwhichprecludes personnel accesstoordamagesequipment inplantvitalareas,Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseNUINARCIC:Naturalanddestructive phenomena afFecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.4 Alert 8.3 Man-Made Events Vehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUINARC IC: Natural and destructive phenomena afFecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALaddresses eventsthatmayhaveresultedinaplantvitalareabeingsubjected toforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpreted asmandating alengthydamageassessment priortoclassification.
Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.ThisEALaddresses suchitemsasplane,helicopter, train,barge,carortruckcrash,orimpactofprojectiles intoaplantvitalarea.8-14 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG
No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of projectiles into a plant vital area.8-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==


HA1.5BasisReference(s):
HA1.5 Basis Reference(s):
None8-15 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.3.5Alert8.3Man-MadeEventsReportordetection oftoxicorflammable gaseswithinaplantarea,Table8.3,inconcentrations thatwillbelifethreatening toplantpersonnel orprecludeaccesstoequipment neededforsafeplantoperation Table8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseMMARCIC:Releaseoftoxicorflammable gaseswithinafacilitystructure whichjeopardizes operation ofsystemsrequiredtomaintainsafeoperations ortoestablish ormaintaincoldshutdown.
None 8-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.5 Alert 8.3 Man-Made Events Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Release of toxic or flammable gases within a facility structure which jeopardizes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:
FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL is based on gases that have entered a plant structure precluding access to equipment necessary for the safe operation of the plant.This EAL applies to buildings and areas contiguous to plant vital areas or other significant buildings or areas.The intent of this EAL is not to include buildings (i.e., warehouses) or other areas that are not contiguous or immediately adjacent to plant vital areas.It is appropriate that increased monitoring be done to ascertain whether consequential damage has occurred.8-16 OSSI-92-402A-4-REG Ginna EAL Tech'nical Bases Document, Rev 1 PEG
Basis:ThisEALisbasedongasesthathaveenteredaplantstructure precluding accesstoequipment necessary forthesafeoperation oftheplant.ThisEALappliestobuildings andareascontiguous toplantvitalareasorothersignificant buildings orareas.TheintentofthisEALisnottoincludebuildings (i.e.,warehouses) orotherareasthatarenotcontiguous orimmediately adjacenttoplantvitalareas.Itisappropriate thatincreased monitoring bedonetoascertain whetherconsequential damagehasoccurred.
8-16 OSSI-92-402A-4-REG GinnaEALTech'nical BasesDocument, Rev1PEG


==Reference:==
==Reference:==


HA3.1HA3.2BasisReference(s):
HA3.1 HA3.2 Basis Reference(s):
None8-17 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.1UnusualEvent8.4NaturalEventsEarthquake feltinplantbyanyoperatorANDConfirmation ofearthquake ofanintensity
None 8-17 OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.1 Unusual Event 8.4 Natural Events Earthquake felt inplant by any operator AND Confirmation of earthquake of an intensity)0.01 g per SC-5"Earthquake Emergency Plan".MMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:
)0.01gperSC-5"Earthquake Emergency Plan".MMARCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/AModeApplicability:
Basis: REGNPS seismic instrumentation actuates at 0.01 g.Damage to some portions of the site may occur but it should not affect ability of safety functions to operate.Methods of detection can be based on instrumentation validated by a reliable source, operator assessment, or indication received from outside agencies.As de6ned in the EPRI-sponsored"Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989, a"felt earthquake" is: "An earthquake of suQicient intensity such that: (a)the inventory ground motion is felt at the nuclear plant site and recognized as an earthquake based on a consensus of Control Room operators on duty at the time, and (b)for plants with operable seismic instrumentation, the seismic switches of the plant are activated.
Basis:REGNPSseismicinstrumentation actuatesat0.01g.Damagetosomeportionsofthesitemayoccurbutitshouldnotaffectabilityofsafetyfunctions tooperate.Methodsofdetection canbebasedoninstrumentation validated byareliablesource,operatorassessment, orindication receivedfromoutsideagencies.
For most plants with seismic instrumentation, the seismic switches are set at an acceleration of about 0.01 g." PEG  
Asde6nedintheEPRI-sponsored "Guidelines forNuclearPlantResponsetoanEarthquake",
datedOctober1989,a"feltearthquake" is:"Anearthquake ofsuQicient intensity suchthat:(a)theinventory groundmotionisfeltatthenuclearplantsiteandrecognized asanearthquake basedonaconsensus ofControlRoomoperators ondutyatthetime,and(b)forplantswithoperableseismicinstrumentation, theseismicswitchesoftheplantareactivated.
Formostplantswithseismicinstrumentation, theseismicswitchesaresetatanacceleration ofabout0.01g."PEG


==Reference:==
==Reference:==


HU1.18-18 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1BasisReference(s):
HU1.1 8-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.SC-5Earthquake Emergency Plan2.EPRIdocument, "Guidelines forNuclearPlantResponsetoanEarthquake",
1.SC-5 Earthquake Emergency Plan 2.EPRI document,"Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989 8-19 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.2 Unusual Event Report by plant personnel of tornado within plant Protected Area boundary M;5hVKC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:
datedOctober19898-19 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4NaturalEvents8.4.2UnusualEventReportbyplantpersonnel oftornadowithinplantProtected AreaboundaryM;5hVKCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL is based on the assumption that a tornado striking (touching down)within the Protected Area boundary may have potentially damaged plant structures containing functions or systems required for safe shutdown of the plant.If such damage is con6rmed visually or by other in-plant indications, the event may be escalated to Alert.PEG  
Basis:ThisEALisbasedontheassumption thatatornadostriking(touching down)withintheProtected Areaboundarymayhavepotentially damagedplantstructures containing functions orsystemsrequiredforsafeshutdownoftheplant.Ifsuchdamageiscon6rmedvisuallyorbyotherin-plantindications, theeventmaybeescalated toAlert.PEG


==Reference:==
==Reference:==


HU1.2BasisReference(s):
HU1.2 Basis Reference(s):
None8-20 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.3UnusualEvent8.4NaturalEventsDeerCreekfloodingoverentranceroadbridge(handrail)ORLakelevel>252ftORScreenHouseSuctionBaywaterlevel<15ft(low-lowlevelalarm)MMARCIC:Naturalanddestructive phenomena affecting theprotected area.FPBloss/potential loss:N/AModeApplicability:
None 8-20 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.3 Unusual Event 8.4 Natural Events Deer Creek flooding over entrance road bridge (hand rail)OR Lake level>252 ft OR Screen House Suction Bay water level<15 ft (low-low level alarm)MMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:
Basis:Thiscovershighandlowlakewaterlevelconditions thatcouldbeprecursors ofmoreseriousevents.Deercreekfloodingoverentranceroadbridgemayprecludeemergency responsepersonnel accessandegress.Lakewaterlevel>252ft.corresponds toplantdesignlevels.ScreenHouseSuctionBaylevel<15R.corresponds tothelow-lowlevelalarmpointandwhichrequiresloadreduction below50%.PEG
Basis: This covers high and low lake water level conditions that could be precursors of more serious events.Deer creek flooding over entrance road bridge may preclude emergency response personnel access and egress.Lake water level>252 ft.corresponds to plant design levels.Screen House Suction Bay level<15 R.corresponds to the low-low level alarm point and which requires load reduction below 50%.PEG  


==Reference:==
==Reference:==


HU1.7BasisReference(s):
HU1.7 Basis Reference(s):
1.2.3.SC-4HighWater(Flood)Emergency PlanSC-4.1LowScreenhouse WaterLevelInteroffice Memo"Screenhouse PumpBayWaterLevel"datedV24/94toTerryWhitefromWilliamRapinandJeffreyWayland8-21 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.4Alert8.4NaturalEventsEarthquake feltinplantbyanyplantoperations personnel AND~Confirmation ofearthquake ofanintensity
1.2.3.SC-4 High Water (Flood)Emergency Plan SC-4.1 Low Screenhouse Water Level Interoffice Memo" Screenhouse Pump Bay Water Level" dated V24/94 to Terry White from William Rapin and Jeffrey Wayland 8-21 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.4 Alert 8.4 Natural Events Earthquake felt inplant by any plant operations personnel AND~Confirmation of earthquake of an intensity)0.08 g per SC-5"Earthquake Emergency Plan" NUIYGMC IC: Natural and destructive phenomena afFecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
)0.08gperSC-5"Earthquake Emergency Plan"NUIYGMCIC:Naturalanddestructive phenomena afFecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.
Basis:ThisEALaddresses eventsthatmayhaveresultedinaplantvitalareabeingsubjected toforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpreted asmandating alengthydamageassessment priortoclassification.
No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL is based on the FSAR design basis operating earthquake of 0.08 g.Seismic events of this magnitude can cause damage to plant safety functions.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.ThisEALisbasedontheFSARdesignbasisoperating earthquake of0.08g.Seismiceventsofthismagnitude cancausedamagetoplantsafetyfunctions.
PEG  
PEG


==Reference:==
==Reference:==


HAl.lBasisReference(s):
HAl.l Basis Reference(s):
1.SC-5"Earthquake Emergency Plan"8-22  
1.SC-5"Earthquake Emergency Plan" 8-22  


OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.5Alert8.4NaturalEv'entsSustained winds>75mphOR,Tornadostrikesaplantvitalarea,Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseMMARCIC:Naturalanddestructive phenomena affecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.5 Alert 8.4 Natural Ev'ents Sustained winds>75 mph OR , Tornado strikes a plant vital area, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALaddresses eventsthatmayhaveresultedinaplantvitalareabeingsubjected toforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpreted asmandating alengthydamageassessment priortoclassification.
Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.ThisEALisbasedontheFSARassumed"severeenvironmental loading"condition of75mph.Windloadsofthismagnitude cancausedamagetosafetyfunctions.
No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL is based on the FSAR assumed"severe environmental loading" condition of 75 mph.Wind loads of this magnitude can cause damage to safety functions.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1PEG
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==


HA1.2BasisReference(s):
HA1.2 Basis Reference(s):
1.RGEFSARSection3.3.2.1.4 8-24 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.6Alert8.4NaturalEventsAnynaturaleventwhichresultsinareportofvisiblestructural damageorassessment byControlRoompersonnel ofactualdamagetoequipment neededforsafeplantoperation, Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainment Building~Auxiliary Building~Intermediate Building~Emergency DieselBuilding~StandbyAuxiliary Feedwater Building~ScreenHouseMMARCIC:Naturalanddestructive phenomena affecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
1.RGE FSAR Section 3.3.2.1.4 8-24 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.6 Alert 8.4 Natural Events Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALaddresses eventsthatmayhaveresultedinaplantvitalareabeingsubjected toforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpreted asmandating alengthydamageassessment priortoclassification.
Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.ThisEALspecifies areasinwhichstructures containing systemsandfunctions requiredforsafeshutdownoftheplantarelocated.8-25 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1'PEG
No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL specifies areas in which structures containing systems and functions required for safe shutdown of the plant are located.8-25 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'PEG  


==Reference:==
==Reference:==


HA1.3BasisReference(s):
HA1.3 Basis Reference(s):
None8-26 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Hazards8.4.VAlert8.4NaturalEventsFloodwateraccumulating onscreenhouseoperating floorOR'akelevel>253ftORScreenHouseSuctionBaywaterlevel<13ftNUMARCIC:Naturalanddestructive phenomena affecting theplantvitalarea.FPBloss/potential loss:N/AModeApplicability:
None 8-26 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.V Alert 8.4 Natural Events Flood water accumulating on screen house operating floor OR'ake level>253 ft OR Screen House Suction Bay water level<13 ft NUMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALaddresses eventsthatmayhaveresultedinaplantvitalareabeingsubjected tolevelsbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpreted asmandating alengthydamageassessment priortoclassification.
Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to levels beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.
NoattemptismadeinthisEALtoassesstheactualmagnitude ofthedamage.This.EALcovershighandlowlakewaterlevelconditions thatexceedlevelswhichthreatenvitalequipment.
No attempt is made in this EAL to assess the actual magnitude of the damage.This.EAL covers high and low lake water level conditions that exceed levels which threaten vital equipment.
Floodwateraccumulating onthescreenhouseoperating floororlakelevels>253ft.corresponds tolevelsthreatening vitalequipment.
Flood water accumulating on the screen house operating floor or lake levels>253 ft.corresponds to levels threatening vital equipment.
ScreenHouseSuctionBaylevel<13ft.corresponds tothelevelbelowwhichthemotordrivenfirewater pumpsuctionbowlsareuncovered.
Screen House Suction Bay level<13 ft.corresponds to the level below which the motor driven firewater pump suction bowls are uncovered.
PEG
PEG  


==Reference:==
==Reference:==


HA1.78-27 OSSI-92-402A-4-REG'inna EALTechnical BasesDocument, Rev1BasisReference(s):
HA1.7 8-27 OSSI-92-402A-4-REG'inna EAL Technical Bases Document, Rev 1 Basis Reference(s):
1.SC-4HighWater(Flood)Emergency Plan2.SC-4.1LowScreenhouse WaterLevel3.Interof6ce Memo"Screenhouse PumpBayWaterLevel"dated1/24/94toTerryWhitefromWilliamRapinandJeffreyWayland8-28 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1TheEALsdefinedincategories 1.0through8.0specifythepredetermined symptomsoreventswhichareindicative ofemergency orpotential emergency conditions, andwhichwarrantclassification.
1.SC-4 High Water (Flood)Emergency Plan 2.SC-4.1 Low Screenhouse Water Level 3.Interof6ce Memo" Screenhouse Pump Bay Water Level" dated 1/24/94 to Terry White from William Rapin and Jeffrey Wayland 8-28 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The EALs defined in categories 1.0 through 8.0 specify the predetermined symptoms or events which are indicative of emergency or potential emergency conditions, and which warrant classification.
WhiletheseEALshavebeendeveloped toaddressthefullspectrumofpossibleemergency conditions whichmaywarrantclassification andsubsequent implementation oftheEmergency Plan,aprovision forclassification ofemergencies basedonoperator/management experience andjudgmentisstillnecessary.
While these EALs have been developed to address the full spectrum of possible emergency conditions which may warrant classification and subsequent implementation of the Emergency Plan, a provision for classification of emergencies based on operator/management experience and judgment is still necessary.
TheEALsofthiscategoryprovidetheShiftSupervisor orEmergency Coordinator thelatitudetoclassifyemergency conditions consistent withtheestablished classification
The EALs of this category provide the Shift Supervisor or Emergency Coordinator the latitude to classify emergency conditions consistent with the established classification criteria, based upon their judgment.9-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.1 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.NUINARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:
: criteria, basedupontheirjudgment.
Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Unusual Event emergency class.From a broad perspective, one area that may warrant Emergency Coordinator judgment is related to likely or actual breakdown of site specific event mitigating actions.Examples to consider include inadequate emergency response procedures, transient response either unexpected or not understood, failure or unavailability of emergency systems during an accident in excess of that assumed in accident analysis, or insufhcient availability of equipment and/or support personnel.
9-1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0Other9.1.1UnusualEventAnyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadtoorhasledtoapotential degradation ofthelevelofsafetyoftheplant.NUINARCIC:Emergency DirectorJudgmentFPBloss/potential loss:N/AModeApplicability:
PEG  
Basis:ThisEALaddresses unanticipated conditions notaddressed explicitly elsewhere butthatwarrantdeclaration ofanemergency becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheUnusualEventemergency class.Fromabroadperspective, oneareathatmaywarrantEmergency Coordinator judgmentisrelatedtolikelyoractualbreakdown ofsitespecificeventmitigating actions.Examplestoconsiderincludeinadequate emergency responseprocedures, transient responseeitherunexpected ornotunderstood, failureorunavailability ofemergency systemsduringanaccidentinexcessofthatassumedinaccidentanalysis, orinsufhcient availability ofequipment and/orsupportpersonnel.
PEG


==Reference:==
==Reference:==


HU1.3HU5.1 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1'BasisReference(s):
HU1.3 HU5.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0Other9.1.2UnusualEventAnyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadtoorhasledtoalossorpotential lossofcontainment,
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.2 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment,.Attachment A.NUbXARC IC: N/A FPB loss/potential loss: Containment loss/potential loss Mode Applicability:
.Attachment A.NUbXARCIC:N/AFPBloss/potential loss:Containment loss/potential lossModeApplicability:
Power operation, hot shutdown Basis: This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the containment barrier is lost or potentially lost.In addition, the inability to monitor, the barrier should also be incorporated in this EAL as a factor in Emergency Coordinator judgment that the barrier may be considered lost or potentially lost.PEG  
Poweroperation, hotshutdownBasis:ThisEALaddresses anyotherfactorsthataretobeusedbytheEmergency Coordinator indetermining whetherthecontainment barrierislostorpotentially lost.Inaddition, theinability tomonitor,thebarriershouldalsobeincorporated inthisEALasafactorinEmergency Coordinator judgmentthatthebarriermaybeconsidered lostorpotentially lost.PEG


==Reference:==
==Reference:==


PCS.XBasisReference(s):
PCS.X Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0Other9.1.3AlertAnyevent,asdetermined bytheShikSupervisor orEmergency Coordinator, thatcouldcauseorhascausedactualsubstantial degradation ofthelevelofsafetyoftheplant.NMGLRCIC:Emergency DirectorJudgmentFPBloss/potential loss:N/AModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.3 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.NMGLRC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:
BasisThisEALaddresses unanticipated conditions notaddressed explicitly elsewhere butthatwarrantdeclaration ofanemergency becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheAlertemergency class.PEG
Basis This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Alert emergency class.PEG  


==Reference:==
==Reference:==


HA6.1BasisReference(s):
HA6.1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0Other9.1.4AlertAnyevent,asdetermined bytheShikSupervisor orEmergency Coordinator, thatcouldleadorhasledtoalossorpotential lossofeitherfuelcladorRCSbarrier,Attachment A.NM4A'RCIC:N/AFPBloss/potential loss:Lossorpotential lossofeitherfuelcladorRCSbarrierModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.4 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to a loss or potential loss of either fuel clad or RCS barrier, Attachment A.NM4A'RC IC: N/A FPB loss/potential loss: Loss or potential loss of either fuel clad or RCS barrier Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses anyotherfactorsthataretobeusedbytheEmergency Coordinator indetermining whetherthefuelcladorRCSbarriersarelostorpotentially lost.Inaddition, theinability tomonitorthebarriersshouldalsobeconsidered inthisEALasafactorinEmergency Coordinator judgmentthatthebarriersmaybeconsidered lostorpotentially lost.PEG
Power operation, hot shutdown Basis: This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the fuel clad or RCS barriers are lost or potentially lost.In addition, the inability to monitor the barriers should also be considered in this EAL as a factor in Emergency Coordinator judgment that the barriers may be considered lost or potentially lost.PEG  


==Reference:==
==Reference:==


FC7.1RCS6.1BasisReference(s):
FC7.1 RCS6.1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0OCher9.1.5SiteAreaEmergency Asdetermined bytheShiftSupervisor orEmergency Coordinator, eventsareinprogresswhichindicateactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.Anyreleasesarenotexpectedtoresultinexposures whichexceedEPAPAGs.NUMARCIC:Emergency DirectorJudgmentFPBloss/potential loss:N/AModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 OCher 9.1.5 Site Area Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public.Any releases are not expected to result in exposures which exceed EPA PAGs.NUMARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:
Basis:ThisEALaddresses unanticipated conditions notaddressed explicitly elsewhere butthatwarrantdeclaration ofanemergency becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheemergency classdescription forSiteAreaEmergency.
Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


HS3.1BasisReference(s):
HS3.1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev18.0Other9.1.6SiteAreaEmergency Anyevent,asdetermined bytheShikSupervisor orEmergency Coordinator, thatcouldleadorhasledtoeither:Lossorpotential lossofbothfuelcladandRCSbarrier,Attachment AORLossorpotential lossofeitherfuelcladorRCSbarrierinconjunction withalossofcontainment, Attachment ANUIKARCIC:N/AFPBloss/potential loss:Lossorpotential lossofbothfuelcladandRCSbarrierORLossorpotential lossofeitherfuelcladorRCSbarrierinconjunction withalossofcontainment ModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Other 9.1.6 Site Area Emergency Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to either: Loss or potential loss of both fuel clad and RCS barrier, Attachment A OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attachment A NUIKARC IC: N/A FPB loss/potential loss: Loss or potential loss of both fuel clad and RCS barrier OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses unanticipated conditions affecting fissionproductbarrierswhicharenotaddressed explicitly elsewhere.
Power operation, hot shutdown Basis: This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere.
Declaration ofanemergency iswarranted becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheemergency classdescription forSiteAreaEmergency.
Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.
PEG
PEG  


==Reference:==
==Reference:==


FC7.1RCS6.1PC8.1BasisReference(s):
FC7.1 RCS6.1 PC8.1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0>>Other9.1.7GeneralEmergency Asdetermined bytheShiftSupervisor orEmergency Coordinator, eventsareinprogresswhichindicateactualorimminentcoredamageandthepotential
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0>>Other 9.1.7 General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential.for a large release of radioactive material in excess of EPA PAGs outside the site boundary.NUINARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:
.foralargereleaseofradioactive materialinexcessofEPAPAGsoutsidethesiteboundary.
Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the General Emergency class.Releases can reasonably be expected to exceed EPA PAG plume exposure levels outside the site boundary..PEG  
NUINARCIC:Emergency DirectorJudgmentFPBloss/potential loss:N/AModeApplicability:
Basis:ThisEALaddresses unanticipated conditions notaddressed explicitly elsewhere butthatwarrantdeclaration ofanemergency becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheGeneralEmergency class.Releasescanreasonably beexpectedtoexceedEPAPAGplumeexposurelevelsoutsidethesiteboundary.
.PEG


==Reference:==
==Reference:==


HG2.1BasisReference(s):
HG2.1 Basis Reference(s):
None OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev19.0Other9.1.8GeneralEmergency Anyevent,asdetermined bytheShiftSupervisor orEmergency Coordinator, thatcouldleadorhasledtoalossofanytwofissionproductbarriersandlossorpotential lossofthethird,Attachment A.NUIKARCIC:N/AFPBloss/potential loss:Lossofanytwofissionproductbarriersandlossorpotential lossofthethirdModeApplicability:
None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.8 General Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attachment A.NUIKARC IC: N/A FPB loss/potential loss: Loss of any two fission product barriers and loss or potential loss of the third Mode Applicability:
Poweroperation, hotshutdownBasis:ThisEALaddresses unanticipated conditions affecting fissionproductbarrierswhicharenotaddressed explicitly elsewhere.
Power operation, hot shutdown Basis: This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere.
Declaration ofanemergency iswarranted becauseconditions existwhicharebelievedbytheEmergency Coordinator tofallundertheemergency classdescription fortheGeneralEmergency class.PEG
Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for the General Emergency class.PEG  


==Reference:==
==Reference:==


FC7.1HCS6.1PC8.1BasisReference(s):
FC7.1 HCS6.1 PC8.1 Basis Reference(s):
None9-10 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1ATTACHMENT AFISSIONPRODUCTBARRIERLOSS4POTENTIAL LOSSINDICATORS FissionProductBarrierLoss/Potential LossMatrix(Rosethresholds forwhichlossorpotential isdetermined tobeimminent, classifyasthoughthethreshold(s) hasbeenexceeded)
None 9-10 OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 ATTACHMENT A FISSION PRODUCT BARRIER LOSS 4 POTENTIAL LOSS INDICATORS Fission Product Barrier Loss/Potential Loss Matrix (Rose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)Potential Loss ,ORANGE path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Core Exit Thermocouple Readings>/00'F RVLIS 5 43%w/no RCPs running Emergency Coordinator Judgment RED path in F-0.2, CORE COOLING Coolant activity>300 Ii Ci/cc of 1-131 Core Exit Thermocouple Readings>1200'F Containment rad monitor reading>100 R/hr Letdown Monitor (R-9)reading>10 R/hr Emergency Coordinator Judgment Potential Loss RED path on F-0.4, INTEGRITY RED path on F-0.3, HEAT SINK Primaiy system leakage>46 gpm Emergency Coordinator Judgment RCS subcooling
Potential Loss,ORANGEpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoreExitThermocouple Readings>/00'FRVLIS543%w/noRCPsrunningEmergency Coordinator JudgmentREDpathinF-0.2,CORECOOLINGCoolantactivity>300IiCi/ccof1-131CoreExitThermocouple Readings>1200'FContainment radmonitorreading>100R/hrLetdownMonitor(R-9)reading>10R/hrEmergency Coordinator JudgmentPotential LossREDpathonF-0.4,INTEGRITY REDpathonF-0.3,HEATSINKPrimaiysystemleakage>46gpmEmergency Coordinator JudgmentRCSsubcooling
<EOP Fig.MIN SUBCOOLING due to RCS leakage Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" Containment radiation monitor reading>10 R/hr Emergency Coordinator Judgment A-2 Fission Product Barrier Loss/Potential Loss Matrix+hose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)Potential Lose RED path F-0.5, CONTAINMENT Rapid uncontrolled decrease in Containment Pressure following initial increase Either: Core exit thermocouples
<EOPFig.MINSUBCOOLING duetoRCSleakageUnisolable secondary sidelinebreakwithSGtuberuptureasidentified inE-3"SteamGenerator TubeRupture"Containment radiation monitorreading>10R/hrEmergency Coordinator JudgmentA-2 FissionProductBarrierLoss/Potential LossMatrix+hosethresholds forwhichlossorpotential isdetermined tobeimminent, classifyasthoughthethreshold(s) hasbeenexceeded)
>1200'F OR Core exit thermocouples
Potential LoseREDpathF-0.5,CONTAINMENT Rapiduncontrolled decreaseinContainment Pressurefollowing initialincreaseEither:Coreexitthermocouples
>700'F with RVLIS<43%(no RCPs)AND Restoration procedures not effective within 15 minutes Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions, i.e.unexpected changes occur in these parameters that are not explainable due to operator actions or automatic system actions.Safety injection signal due to LOCA with<the minimum containment cooling safeguards equipment operating:
>1200'FORCoreexitthermocouples
CNMT pressure<28 psig: 2 CNMT Recirc Fans CNMT pressure 228 psig: 2 CNMT Spray Pumps OR 2 CNMT Recirc Fans and 1 CNMT Spray Pump Either.CI or CVI isolation required and CI or CVI valve(s)not closed when required OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists Containment pressure 60 psig and increasing Release of secondary side to atmosphere with primary to secondary leakage greater than tech spec allowable of 0.1 CPM per steam generator h4%hydrogen concentration in containment Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR Cl or CVI valve(s)not closed when required which results in a radiological release pathway to the environment Containment radiation monitor reading>1000 R/hr Emergency Coordinator Judgment Emergency Coordinator Judgment A-3 ATTACHIVlENT B WORD LIST/DEFINITIONS OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Actuate To put into operation; to move to action;commonly used to refer to automated, multi-faceted operations."Actuate ECCS".Adversary As applied to security EALs, an individual whose intent is to commit sabotage, disrupt Station operations or otherwise commit a crime on station property.Events are in process or have occurred which involve an actual or potential substantial degradation of the level of safety of the plant.Any releases are expected to be limited to small fractions of the EPA Protective Action Guideline exposure levels.Available The state or condition of being ready and able to be used (placed into operation) to accomplish the stated (or implied)action or function.As applied to a system, this requires the operability of necessary support systems (electrical power supplies, cooling water, lubrication, etc.).Can/Cannot be determined
>700'FwithRVLIS<43%(noRCPs)ANDRestoration procedures noteffective within15minutesLossofprimarycoolantinsidecontainment withcontainment pressureorsumplevelresponsenotconsistent withLOCAconditions, i.e.unexpected changesoccurintheseparameters thatarenotexplainable duetooperatoractionsorautomatic systemactions.Safetyinjection signalduetoLOCAwith<theminimumcontainment coolingsafeguards equipment operating:
(</>)The current value or status of an identified parameter relative to that specified can/cannot be ascertained using all available indications (direct and indirect, singly or in combination).
CNMTpressure<28psig:2CNMTRecircFansCNMTpressure228psig:2CNMTSprayPumpsOR2CNMTRecircFansand1CNMTSprayPumpEither.CIorCVIisolation requiredandCIorCVIvalve(s)notclosedwhenrequiredORInability toisolateanyprimarysystemdischarging outsidecontainment ANDRadiological releasepathwaytotheenvironment existsContainment pressure60psigandincreasing Releaseofsecondary sidetoatmosphere withprimarytosecondary leakagegreaterthantechspecallowable of0.1CPMpersteamgenerator h4%hydrogenconcentration incontainment Bothdoorsopenoncontainment airlockORInability toclosecontainment pressurerelieforpurgevalveswhichresultsinaradiological releasepathwaytotheenvironment ORClorCVIvalve(s)notclosedwhenrequiredwhichresultsinaradiological releasepathwaytotheenvironment Containment radiation monitorreading>1000R/hrEmergency Coordinator JudgmentEmergency Coordinator JudgmentA-3 ATTACHIVlENT BWORDLIST/DEFINITIONS OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1ActuateToputintooperation; tomovetoaction;commonlyusedtorefertoautomated, multi-faceted operations.
Can/Cannot be maintained above/below (c/>)The value of the identified parameter(s) is/is not able to be kept above/below specified limits.This determination includes making an evaluation that considers both current and future system performance in relation to the current value and trend of the parameter(s).
"ActuateECCS".Adversary AsappliedtosecurityEALs,anindividual whoseintentistocommitsabotage, disruptStationoperations orotherwise commitacrimeonstationproperty.
Neither implies that the parameter must actually exceed the limit before the action is taken nor that the action must be taken before the limit is reached.B-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Can/Cannot be restored above/below (c/>)The value of the identified parameter(s) is/is not able to be returned to above/below speci6ed limits after having passed those limits.This determination includes making an evaluation that considers both current and future systems performances in relation to the current value and trend of the parameter(s).
Eventsareinprocessorhaveoccurredwhichinvolveanactualorpotential substantial degradation ofthelevelofsafetyoftheplant.Anyreleasesareexpectedtobelimitedtosmallfractions oftheEPAProtective ActionGuideline exposurelevels.Available Thestateorcondition ofbeingreadyandabletobeused(placedintooperation) toaccomplish thestated(orimplied)actionorfunction.
Does not imply any specific time interval but does not permit prolonged operation beyond a limit without taking the specified action.As applied to loss of electrical power sources (ex.: Power cannot be restored to any vital bus in<4 hrs)the specified power source cannot be returned to service within the specified time.This determination includes making an evaluation that considers both current and future restoration capabilities.
Asappliedtoasystem,thisrequirestheoperability ofnecessary supportsystems(electrical powersupplies, coolingwater,lubrication, etc.).Can/Cannot bedetermined
Implies that the declaration should be made as soon as the determination is made that the power source cannot be restored within the specified time.Close To position a valve or damper so as to prevent flow of the process fluid.To make an electrical connection to supply power.Con6rm/Con6rmation To validate, through visual observation or physical inspection, that an assumed condition is as expected or required, without taking action to alter the"as found" configuration.
(</>)Thecurrentvalueorstatusofanidentified parameter relativetothatspecified can/cannot beascertained usingallavailable indications (directandindirect, singlyorincombination).
Control Take action, as necessary, to maintain the value of a specified parameter within applicable limits;to fix or adjust the time, amount, or rate of;to regulate or restrict.Decrease To become progressively less in size, amount, number, or intensity.
Can/Cannot bemaintained above/below (c/>)Thevalueoftheidentified parameter(s) is/isnotabletobekeptabove/belowspecified limits.Thisdetermination includesmakinganevaluation thatconsiders bothcurrentandfuturesystemperformance inrelationtothecurrentvalueandtrendoftheparameter(s).
Discharge Removal of a fluid/gas&om a volume or system.
Neitherimpliesthattheparameter mustactuallyexceedthelimitbeforetheactionistakennorthattheactionmustbetakenbeforethelimitisreached.B-2 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Can/Cannot berestoredabove/below (c/>)Thevalueoftheidentified parameter(s) is/isnotabletobereturnedtoabove/below speci6edlimitsafterhavingpassedthoselimits.Thisdetermination includesmakinganevaluation thatconsiders bothcurrentandfuturesystemsperformances inrelationtothecurrentvalueandtrendoftheparameter(s).
OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Enter To go into.Establish To perform actions necessary to meet a stated condition."Establish communication with the Control Room." Evacuate To remove the contents of;to remove personnel from an area.Exceeds To go or be beyond a stated or implied limit, measure, or degree.Exist To have being with respect to understood limitations or conditions.
Doesnotimplyanyspecifictimeintervalbutdoesnotpermitprolonged operation beyondalimitwithouttakingthespecified action.Asappliedtolossofelectrical powersources(ex.:Powercannotberestoredtoanyvitalbusin<4hrs)thespecified powersourcecannotbereturnedtoservicewithinthespecified time.Thisdetermination includesmakinganevaluation thatconsiders bothcurrentandfuturerestoration capabilities.
Failure A state of inability to perform a normal function.General Emergency Events are in process or have occurred which involve actual or imminent substantial core degradation or melting with potential for loss of containment integrity.
Impliesthatthedeclaration shouldbemadeassoonasthedetermination ismadethatthepowersourcecannotberestoredwithinthespecified time.CloseTopositionavalveordampersoastopreventflowoftheprocessfluid.Tomakeanelectrical connection tosupplypower.Con6rm/Con6rmation Tovalidate, throughvisualobservation orphysicalinspection, thatanassumedcondition isasexpectedorrequired, withouttakingactiontoalterthe"asfound"configuration.
Releases can be reasonably expected to exceed EPA Protective Action Guideline exposure levels oFsite for more than the immediate site area.Logic term which indicates that taking the action prescribed is contingent upon the current existence of the stated condition(s).
ControlTakeaction,asnecessary, tomaintainthevalueofaspecified parameter withinapplicable limits;tofixoradjustthetime,amount,orrateof;toregulateorrestrict.
If the identi6ed conditions do not exist, the prescribed action is not to be taken and execution of operator a'ctions must proceed promptly in accordance with subsequent instructions.
DecreaseTobecomeprogressively lessinsize,amount,number,orintensity.
B-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'ncrease To become progressively greater in size, amount, number or intensity.
Discharge Removalofafluid/gas
Indicate To point out or point to;to display the value of a process variable;to be a sign or symbol.Initiate The act of placing equipment or a system into service, either manually or automatically.
&omavolumeorsystem.
Activation of a function or protective feature (i.e.initiate a manual trip).Iajection The act of forcing a fluid into a volume or vessel.Inoperable Not able to perform it's intended function Intrusion The act of entering without authorization Failure of operability or lack of access to.Maintain Take action, as necessary, to keep the value of the specified parameter within the applicable limits.Monitor Observe and evaluate at a frequency sufBcient to remain apprised of the value, trend, and rate of change of the specified parameter.
OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1EnterTogointo.Establish Toperformactionsnecessary tomeetastatedcondition.
B-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Notify To give notice of or report the occurrence of;to make known to;to inform specified personnel; to advise;to communicate; to contact;to relay.Open To position a valve or damper so as to allow flow of the process fluid.To break an electrical connection which removes a power supply from an electrical device.To make available for entry or passage by turning back, removing, or clearing away.Operable Able to perform it's intended function Perform To carry out an action;to accomplish; to aFect;to reach an objective.
"Establish communication withtheControlRoom."EvacuateToremovethecontentsof;toremovepersonnel fromanarea.ExceedsTogoorbebeyondastatedorimpliedlimit,measure,ordegree.ExistTohavebeingwithrespecttounderstood limitations orconditions.
Primary System The pipes, valves, and other equipment which connect directly to the reactor vessel or reactor coolant system such that a reduction in reactor coolant system pressure will effect a decrease in the steam or water being discharged through an unisolated break in the system.Remove To change the location or position of.Report To describe as being in a specific state.Require To demand as necessary or essential.
FailureAstateofinability toperformanormalfunction.
8-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Take the appropriate action requires to return the value of an identified parameter to within applicable limits.Rise Describes an increase in a parameter as the result of an operator or automatic action.Sample To perform an analysis on a specified media to determine its properties.
GeneralEmergency Eventsareinprocessorhaveoccurredwhichinvolveactualorimminentsubstantial coredegradation ormeltingwithpotential forlossofcontainment integrity.
Shut down To perform operations necessary to cause equipment to cease or suspend operation; to stop."Shut down unnecessary equipment." Site Area Emergency Events are in process or have occurred which involve actual or likely major failures of plant functions needed for protection of the public.Any releases are not expected to result in exposure levels which exceed EPA Protective Action Guideline exposure levels except near the site boundary.Sustained Prolonged.
Releasescanbereasonably expectedtoexceedEPAProtective ActionGuideline exposurelevelsoFsiteformorethantheimmediate sitearea.Logictermwhichindicates thattakingtheactionprescribed iscontingent uponthecurrentexistence ofthestatedcondition(s).
Not intermittent or of transitory nature TFlp To de-energize a pump or fan motor;to position a breaker so as to interrupt or prevent the flow of current in the associated circuit;to manually activate a semi-automatic feature.I To take action to cause shutdown of the reactor by rapidly inserting a control rod or control rods (PWR).8-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Uncontrolled An evolution lacking control but is not the result of operator action.Unplanned Not as an expected result of deliberate action.Until Indicates that the associated prescribed action is to proceed only so long as the identified condition does not exist.Unusual Event Events are in process or have occurred which indicate a potential degradation of the level of safety of the plant.No releases of radioactive material requiring offsite response or monitoring are expected unless further degradation of safety systems occurs.Valid Supported or corroborated on a sound basis.Vent To open an effluent (exhaust)flowpath from an enclosed volume;to reduce pressure in an enclosed volume.Verify To conGrm a condition and take action to establish that condition if required."Verify reactor trip, verify SI pumps running." B-8 f4)pi(i'I I l~'I<<->~a)A}}
Iftheidenti6ed conditions donotexist,theprescribed actionisnottobetakenandexecution ofoperatora'ctionsmustproceedpromptlyinaccordance withsubsequent instructions.
B-4 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1'ncreaseTobecomeprogressively greaterinsize,amount,numberorintensity.
IndicateTopointoutorpointto;todisplaythevalueofaprocessvariable; tobeasignorsymbol.InitiateTheactofplacingequipment orasystemintoservice,eithermanuallyorautomatically.
Activation ofafunctionorprotective feature(i.e.initiateamanualtrip).Iajection Theactofforcingafluidintoavolumeorvessel.Inoperable Notabletoperformit'sintendedfunctionIntrusion Theactofenteringwithoutauthorization Failureofoperability orlackofaccessto.MaintainTakeaction,asnecessary, tokeepthevalueofthespecified parameter withintheapplicable limits.MonitorObserveandevaluateatafrequency sufBcient toremainapprisedofthevalue,trend,andrateofchangeofthespecified parameter.
B-5 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1NotifyTogivenoticeoforreporttheoccurrence of;tomakeknownto;toinformspecified personnel; toadvise;tocommunicate; tocontact;torelay.OpenTopositionavalveordampersoastoallowflowoftheprocessfluid.Tobreakanelectrical connection whichremovesapowersupplyfromanelectrical device.Tomakeavailable forentryorpassagebyturningback,removing, orclearingaway.OperableAbletoperformit'sintendedfunctionPerformTocarryoutanaction;toaccomplish; toaFect;toreachanobjective.
PrimarySystemThepipes,valves,andotherequipment whichconnectdirectlytothereactorvesselorreactorcoolantsystemsuchthatareduction inreactorcoolantsystempressurewilleffectadecreaseinthesteamorwaterbeingdischarged throughanunisolated breakinthesystem.RemoveTochangethelocationorpositionof.ReportTodescribeasbeinginaspecificstate.RequireTodemandasnecessary oressential.
8-6 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Taketheappropriate actionrequirestoreturnthevalueofanidentified parameter towithinapplicable limits.RiseDescribes anincreaseinaparameter astheresultofanoperatororautomatic action.SampleToperformananalysisonaspecified mediatodetermine itsproperties.
ShutdownToperformoperations necessary tocauseequipment toceaseorsuspendoperation; tostop."Shutdownunnecessary equipment."
SiteAreaEmergency Eventsareinprocessorhaveoccurredwhichinvolveactualorlikelymajorfailuresofplantfunctions neededforprotection ofthepublic.AnyreleasesarenotexpectedtoresultinexposurelevelswhichexceedEPAProtective ActionGuideline exposurelevelsexceptnearthesiteboundary.
Sustained Prolonged.
Notintermittent oroftransitory natureTFlpTode-energize apumporfanmotor;topositionabreakersoastointerrupt orpreventtheflowofcurrentintheassociated circuit;tomanuallyactivateasemi-automatic feature.ITotakeactiontocauseshutdownofthereactorbyrapidlyinserting acontrolrodorcontrolrods(PWR).8-7 OSSI-92-402A-4-REG GinnaEALTechnical BasesDocument, Rev1Uncontrolled Anevolution lackingcontrolbutisnottheresultofoperatoraction.Unplanned Notasanexpectedresultofdeliberate action.UntilIndicates thattheassociated prescribed actionistoproceedonlysolongastheidentified condition doesnotexist.UnusualEventEventsareinprocessorhaveoccurredwhichindicateapotential degradation ofthelevelofsafetyoftheplant.Noreleasesofradioactive materialrequiring offsiteresponseormonitoring areexpectedunlessfurtherdegradation ofsafetysystemsoccurs.ValidSupported orcorroborated onasoundbasis.VentToopenaneffluent(exhaust) flowpathfromanenclosedvolume;toreducepressureinanenclosedvolume.VerifyToconGrmacondition andtakeactiontoestablish thatcondition ifrequired.
"Verifyreactortrip,verifySIpumpsrunning."
B-8 f4)pi(i'IIl~'I<<->~a)A}}

Revision as of 13:00, 7 July 2018

Rev 1 to Re Ginna EALs Technical Bases.
ML17263A833
Person / Time
Site: Ginna Constellation icon.png
Issue date: 10/11/1994
From:
ROCHESTER GAS & ELECTRIC CORP.
To:
Shared Package
ML17263A834 List:
References
OSSI-92-402A-4, OSSI-92-402A-4-REG-1, NUDOCS 9411090266
Download: ML17263A833 (209)


Text

Attachm B ll DN awÃI 0'o OM Cl 0'o'4 Ul4 Qw O~DOO UMV-R.E.Ginna Emergency Action Levels Annotated Classification Criteria Based on Response to NRC RAls Category 1.0 CSFST Status Category 2.0-Reactor Fuel Category 3.0 Category 4.0 Category 5.0 Category 6.0 Category 7.0 Category 8.0 Category 9.0 Reactor Coolant System Containment Radioactivity Release Electrical Failures Equipment Failures Hazards Other R.E.Ginna Emergency Action Levels Proposed Revision 19 Based on Response to NRC RAIs Category 1.0 Category 2.0 0 Category 3.0 Category 4.0 Category 5.0 Category 6.0 Category 7.0 Category 8.0 Category 9.0 CSFST Status Reactor Fuel Reactor Coolant System Containment Radioactivity Release Elecrtical Failures Equipment Failures-Hazards Other 10/11/94 1.0 CSFST Status 1.1 Subcriticality 1.1.1 Alert[SA2]ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required Power Operations, Hot Shutdown Cate go.0 CSFST Status 1.0 CSFST Status 12 Core Cooling 1.2.1 Site Area Emergency[fpl/fl, rl][SS4]ORANGE or RED path in F-0.2, CORE COOLING Power Operations, Hot Shutdown 1.2.2 General Emergency[fl, rl, cpl]1.1.2 Site Area Emergency[SS2]RED path in F-0.1 SUBCRITICALITY AND either: Emergency boration is inoperable OR Power range not<6%within 15 min.of initiation of emergency boration Power Operations, Hot Shutdown RED path in F~-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.Power Operations, Hot Shutdown 1.1.3 General Emergency[SG2]RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either: RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown 1-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 1.0 CSFST Status 13 Heat Sink 1.3.1 Site Area Emergency[fpl, rpl][SS4]RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown Catego.0 CSFST Status 1.0 CSFST Status 1.4 Integrity 1.4.1 Alert[rpl]RED path on F-0.4, INTEGRITY Power Operations, Hot Shutdown 1-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 CSFST Status 1.0 CSFST Status 1.5 Containment 1.5.1 General Emergency[6, rl, cpl]RED path F-0.5, CONTAINMENT resulting from loss of reactor coolant Power Operations, Hot Shutdown 1-4 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Reactor Fuel 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.1 Unusual Event[SU4]Coolant sample activity:>100%%uo of 84/E bar pCi/cc total specific activity OR>0.2 pCi/cc I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded All 2.1.2 Alert[0]Coolant activity>300 pCi/cc I-131 equivalent Power operation, hot shutdown 2.1.3 Site Area Emergency[fi.rpl/rl]Coolant activity>300 pCi/cc I-131 equivalent and any of the following:

~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage~Containment radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.1 Unusual Event[SU4]Letdown Line Monitor R-9>2 R/hr All 2.2.2 Alert Letdown Line Monitor R-9>10 R/hr Power operation, hot shutdown 2.2.3 Site Area Emergency[fl, rpl]Letdown Line Monitor R-9>10 R/hr and any of the following:

~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage~Containment*radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Cate go.0 Reactor Fuel 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading>10 R/hr Power operation, hot shutdown 2.3.2 Site Area Emergency[fl, rl]Containment radiation monitor R-29/R-30 reading>100 R/hr Power operation, hot shutdown 2.8.3 General Emergency[fl, rl, cpl]Containment radiation monitor R-29/R-30 reading>1000 R/hr 2.0 Reactor Fuel 2.4 Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event[AU2]Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint All 2.4.2 Alert[AA2]Con6rmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:~R-2 Containment Area Monitor~R-5 Spent Fuel Pit~R-12 Containment Noble Gas Power operation, hot shutdown 2.4.8 Alert[AA2]Report of visual observation of irradiated fuel uncovered All 2-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot, loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0-Reactor Coolant System 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.1 Unusual Event[SU5]3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.1 Unusual Event[cl]Unidentified or pressure boundary leakage>10 gpm OR Identified leakage>25 gpm Power operation, hot shutdown 3.1.2 Alert[rpl]Primary system leakage>46 gpm Power operation, hot shutdown Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator Power operation, hot shutdown 1 3.2.2 Site Area Emergency[rpl, cl]Unisolable release of secondary side to atmosphere with primary to secondary leakage>46 gpm Power operation, hot shutdown 3.1.3 Site Area Emergency[fpl, rl][SS5]3.2.3 Site Area Emergency[fl,cl]RVLIS cannot be maintained

>43%with no RCPs running OR With the reactor vessel head removed, it is reported that water level in the reactor vessel is dropping in an.uncontrolled manner and core uncovery is likely.Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator AND Either: Coolant activity>300 pCi/cc of I-131 OR Letdown Line Monitor R-9>10 8/hr All Power operation, hot shutdown 3-1 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0 Reactor Coolant System 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert[rl]RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage Power operation, hot shutdown 3-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 4.0 Containment

4.0 Containment

4.1 Containment

Integrity Status 4.1.1 Unusual Event[cl]4.0 Containment

4.1 Containment

Integrity Status 4.1.3 Site Area Emergency[rl, cl]Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR CI or CVI valve(s)not closed when required which results in a radiological release pathway to the environment Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists Power operation, hot shutdown Power operation, hot shutdown 4.1.2 Site Area Emergency[rl, cl]Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions Power operation, hot shutdown 4.1.4 General Emergency[fl, rl, cpl]Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Power operation, hot shutdown 4-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 0 Category 4.0 Containment

4.0 Containment

4.1 Containment

Integrity Status 4.1.5 General Emergency[fpVfl, rl,cl]4.0 Containment 4.2 SG Tube Rupture w/Secondary Release 4.2.1 Site Area Emergency[rl, cl]Either: Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot'hutdown 4.1.6 General Emergency[fpVfl, rl,cl]Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" Power operation, hot shutdown 4.2.2 General Emergency[fpVfl, rl, cl]Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot shutdown Power operation, hot shutdown 4-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss

4.0 Containment

4.3 Combustible

Gas Concentrations 4.3.1 General Emergency I fl,rl,cpl]

2 4%hydrogen concentration in containment Power operation, hot shutdown Catego.0 Containment Table 4.1 Fuel Clad Loss Indicators 1.Coolant activity>300 pCi/cc of I-131 2.Containment rad monitor R-29/R-30 reading>100 R/hr 3.Letdown Monitor R-9 reading>10 R/hr 4.RED path in F-0.2, CORE COOLING Table 4.2 Fuel Clad Dama e Indicators

~ORANGE or RED path in F-0.2, CORE COOLING~RED path in F-0.3, HEAT SINK~Coolant activity>300 pCi/cc of I-131~Containment rad monitor R-29/R-30 reading>100 H/hr~Letdown Monitor R-9 reading>10 R/hr<28 psig N/A>28 psig Table 4.3 Minimum Operable Containment Heat Removal E ui ment CNMT Pressure Recirc Fans Operable Spray Pumps Re uired 4-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 6.0 Radioactivity Release 6.0 Radioactivity Release/Area Radiation 6.1 EQluent Monitors 6.1.1 Unusual Event[AU1]6.0 Radioactivity Release/Area Radiation 6.1 EQluent Monitors 6.1.4 General Emergency[AG1]A valid reading on any monitors Table 5.1 column"NUE" for>60 min.unless sample analysis can confirm release rates<2 x technical specifications within this time period.A valid reading on any monitors Table 5.1 column"GE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"GE" within this time period.All All 6.1.2 Alert[AA1]A valid reading on any monitors Table 5.1 column"Alert" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"Alert" within this time period.All 6.1.3 Site Area Emergency[AS 1]A valid reading on any monitors Table 5.1 column"SAE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"SAE" within this time period.All 5-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category o.0 Radioactivity Release 6.0 Radioactivity Release/Area Radiation 6.0 Radioactivity Release/Area Radiation 6.2 Dose Projections/

Environmental Measurements/

Release Rates 5.2 Dose Projections/

Environmental Measurements/

Release Rates 6.2.1 Unusual Event[AU1]6.2.4 Site Area Emergency[AS1]Confirmed sample analyses for gaseous or liquid release rates>2 x technical specifications limits for>60 min.All Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"SAE" at the site boundary or beyond.All 6.2.2 Alert[AA1]Confirmed sample analyses for gaseous or liquid release rates>200 x technical specifications limits for>15 min.6.2.5 General Emergency[AG1]Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"GE" at the site boundary or beyond.All 5.2.8 Alert[AA1]Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"Alert" at the site boundary or beyond.All.Table 5.3.Plant Areas~Reactor Containment Building~Auxiliary Building~Turbine Building~Emergency Diesel Building~Screen House~Standby Auxiliary Feedwater Building 5-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego o.0 Radioactivity Release 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.1'Unusual Event[AU2]Any sustained direct ARM readings>100 x alarm or oAscale hi resulting from an uncontrolled process 5.3.2 Alert[AA3]Sustained area radiation levels>15 mR/hr in either: Control Room OR Central Alarm Station and Secondary Alarm Station 5.3.3 Alert[AA3]Sustained abnormal area radiation levels>8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.All 5-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category o.0 Radioactivity Release Monitor Table 5.1 EfHuent Monitor Classification Thresholds Alert GE R-ll R-12 R-13 R-14 R-15 R-18 R-12 A(7/9)R-14A(7/9)

R-15A(7/9)

R-31/32 1ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr.23.8 mR/hr Table 5.2 Dose Pro ection/Env.Measurement Classification Thresholds Alert GE TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 5-4 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Electrical Failures 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.1 Unusual Event[SUl]Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for>15 min.All 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.4 Site Area Emergency[SS1]Loss of all safeguards bus AC power for>15 min.Power operation, hot shutdown 6.1.2 Alert[SA1]6.1.6 General Emergency[SGl]6.1.3 Alert[SA5]Loss of all safeguards bus AC power for>15 min.Cold Shutdown, Refueling, Defueled Loss of all safeguards bus AC power AND either: Power restoration to any safeguards bus is not likely in<4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2,"CORE COOLING" Available safeguard train AC power reduced to only one of the following for>15 min.:~EDG 1A (14/18)~EDG 1B (16/17)~Station Auxiliary Transformer 12A~Station Auxiliary Transformer 12B Power operation, hot shutdown Power operation, hot shutdown 6-1 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 6.0 Electrical Failures 6.0 Electrical Failures 6.2 Loss of DC Power Sources 6.2.1 Unusual Event[SU7]<105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.Cold Shutdown, Refueling 6.2.2 Site Area Emergency[SS3]>105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.Power operation, hot shutdown 6-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category.0 Equipment Failures 7.0 Equipment Failures V.1 Technical Specification%Requirements 7.1.1 Unusual Event[SU2]Plant is not brought to required operating mode within Technical Specifications LCO Action-Statement Time.Power operation, hot shutdown V.O Equipment Failures V.2 System Failures or Control Room Evacuation 7.2.1 Unusual Event[HU1]Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.Power Operations V.2.2 Alert[HA1]Turbine failure generated missiles result in any visible structural damage to plant vital equipment Power Operations, Hot Shutdown 7.2.8 Alert[HA5]Entry into AP-CR.1"Control Room Inaccessability" All 7.2.4 Alert[SA3]Reactor coolant temperature cannot be maintained

<200'F Cold Shutdown, Refueling 7-1 fyl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Cate go.0 Equipment Failures V.O Equipment Failures 7.0 Equipment Failures V.2 System Failures or Control Room Evacuation 7.3 Loss of Indications

/Alarms/Communication Capability V.2.5 Site Area Emergency[HS2]V.3.1 Unusual Event[SU3]Control Room evacuation AND Core cooling cannot be established per AP-CR.1"Control Room Inaccessibility" in<20 min.All Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation Power operation, hot shutdown 7.3.2 Unusual Event[SU6]Loss of all communications capability affecting the ability to either: Perform routine operations OR Notify offsite agencies or personnel 7-2 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0.Equipment Failures V.O Equipment Failures V.3 Loss of Indications

/Alarms/Communication Capability Table 7.3 Vital Control Room Panels V.3.3 Alert[SA4]B C D E F G Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation AND either: A plant transient in progress OR PPCS and SAS are unavailable Power operation, hot shutdown V.3.4 Site Area Emergency[SS6]Loss of annunciators or'indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Power operation, hot shutdown 7-3 fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Catego.0 Hazards 8.0 Hazards 8.1 Security Threats 8.1.1 Unusual Event[HU4]8.0 Hazards 8.1 Security Threats 8.1.4 General Emergency[HG1]Bomb device or other indication of attempted sabotage discovered within plant Protected Area.OR Any security event which represents a potential degradation in the level of safety of the plant.Security event which results in: Loss of plant control from the Control Room OR Loss of remote shutdown capability All 8.1.2 Alert[HA4]Intrusion into plant Protected Area by an adversary.

OR Any security event which represents an actual substantial degradation of the level of safety of the plant.All 8.1.3 Site Area Emergency[HS1]Intrusion into a plant security vital area by an adversary.

OR Any security event which represents actual or likely failures of plant systems needed to protect the public.All 8-1 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Hazards 8.0 Hazards 8.2 Fire or Explosion 8.2.1 Unusual Event DiU2]8.0 Hazards 8.3 Man-Made Events 8.3.1 Unusual Event DiU1]Confirmed fire in any plant area, Table 8.2 or Table 8.3 not extinguished in 5 15 min.of Control Room notification:

All Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary All 8.2.2 Alert[HA2]8.3.2 Unusual Event[HU1]Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:~visible damage to plant equipment or structures needed for safe plant operation OR~which affects safety system operability as indicated by degraded system performance Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment All 8.3.3 Unusual Event[HU3]Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could affect the health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event All 8-2 fpl-fuel clad pot.loss fl-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss Category 8.0 Hazards 8.0 Hazards 8.3 Man-Made Events 8.3.4 Alert[HA1]8.0 Hazards 8.4 Natural Events 8.4.1 Unusual Event[HU1]'ehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 All Earthquake felt inplant by any operator AND I Confirmation of earthquake of an intensity>0.01 g per SC-5"Earthquake Emergency Plan".All 8.3.5 Alert[HA3]Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation 8.4.2 Unusual Event[HU1]Report by plant personnel of tornado within plant Protected Area boundary All 8.4.3 Unusual Event[HUl]Deer Creek flooding over entrance road bridge (hand rail)OR Lake level>252 ft OR Screen House Suction Bay water level<15 ft (low-low level alarm)All 8-3~fpl-fuel clad pot.loss 6-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 8.0 Hazards 8.4 Natural Events 8.4.4 Alert[HA1]Category.0 Hazards 8.0 Hazards 8.4 Natural Events 8.4.7 Alert[HA1]Earthquake felt inplant by any plant operations personnel AND Confirmation of earthquake of an intensity)0.08 g per SC-5"Earthquake Emergency Plan" All Flood water accumulating on screen house operating floor OR Lake level>253 ft I'R Screen House Suction Bay water level<13 ft All 8.4.5 Alert[HA1]Sustained winds>75 mph OR Tornado strikes a plant vital area, Table 8.3 All 8.4.6 Alert[HAl]Table 8.2 Plant Areas~Turbine Building~TSC~Service Building~Contaminated Storage Building Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 All Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House 8-4 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 9.0 Other 9.1.1 Unusual Event Category 9.0 Other 9.0 Other 9.1.3 Alert Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.AIl 9.1.2 Unusual Event 9.1.4 Alert Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment, Attach.A.Power operation, hot shutdown Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a, loss or potential loss of either fuel clad or RCS barrier, Attach.A.Power operation, hot shutdown 9-1 fpl-fuel clad pot.loss Q-fuel clad loss rpl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss 9.0 Other 9.1.5 Site Area Emergency Category 9.0 Other 9.0 Other 9.1.V General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public.Any releases are not expected to result in exposures which exceed EPA PAGs, Attach.A.All As determined by the Shik Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential for a large release of radioactive material in excess of EPA PAGs outside the site boundary.All 9.1.6 Site Area Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to either: Loss or potential loss of both fuel clad and RCS barrier, Attach.A.OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attach.A.9.1.8 General Emergency Any event, as determined by the ShiA.Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attach.A.Power operation, hot shutdown Power operation, hot shutdown 9-2 fpl-fuel clad pot.loss 6-fuel clad loss ryl-RCS pot.loss rl-RCS loss cpl-contain.pot.loss cl-contain.loss OSSI-92-402A-4-REG fgi.J 2'gf I'innd EAL Technical Bases Document, Rev 1}Attachment C New York EAL Upgrade Project R.E.Ginna Emergency Action Levels Technical Bases Revision 1 Based on Proposed Responses to NRC RAIs 10/11/94 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document.Rev 1 PURPOSE The purpose of this document is to provide an explanation and rationale for each of the emergency action levels (EALs)included in the EAL Upgrade Program for R.E.Ginna Nuclear Power Station (REGNPS).It is also intended to facilitate the review process of the REGNPS EALs and provide historical documentation for future reference.

This document is also intended to be utilized by, those individuals responsible for implementation of EPIP-1-0"Ginna Station Event Evaluation and Classification" as a technical reference and aid in EAL interpretation.

DISCUSSION EALs are the plant-specific indications, conditions or instrument readings which are utilized to classify emergency conditions defined in the REGNPS Emergency Plan.Subsequent to the acceptance by the NRC of NUMARC/NESP-007"Methodology for Development of Emergency Action Levels" as an acceptable alternative to the NUREG 0654 EAL guidance, the four nuclear utilities in the State of New York decided to perform a joint implementation of the new methodology.

This upgrade project involved the following plants:~Nine Mile Point Unit 1 (NMPC)~Nine Mile Point Unit 2 (NMPC)James A.FitzPatrick Nuclear Power Plant (NYPA)~Indian Point Station 2 (ConEd)~Indian Point 3 Nuclear Po'wer Station (NYPA)~R.E.Ginna Nuclear Power Station (RG&E)While the upgraded EALs are site specific, an objective of the upgrade project was to ensure conformity and consistency between the sites to the extent possible.The revised EALs were derived from the Initiating Conditions and example EALs given in the REGNPS Plant-Specific EAL Guideline (PEG).The PEG is the REGNPS interpretation of the NUMARC methodology for developing EALs.The PEG identifies deletions from the NUMARC methodology by striking out words and phrases that are not applicable to REGNPS;additions are identified by underlining new words and phrases.The source of documents for PEG changes from NUNC methodology are listed in the references section of the PEG.Many of the EALs derived from the NV)~C methodology are fission product barrier based.That is, the conditions which define the EALs are OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev l based upon loss or potential loss of one or more of the three fission product barriers.The primary fission product barriers are: A.r F 1 1 in The fuel cladding is comprised of the zirconium tubes which house the ceramic uranium oxide pellets along with the end plugs which are welded into each end of the fuel rods.B.r I n m The RCS is comprised of the reactor vessel shell, vessel head, vessel nozzles and penetrations and all primary systems directly connected t'o the reactor vessel up to the first containment isolation valve.C~i~Yh i i p'fh p containment structure and all isolation valves required to maintain containment integrity under accident conditions.

The following criteria serves as the bases for event classification related to fission product barrier loss: n 1Ev n Any loss or potential loss of containment hhzf'ny loss or any potential loss of either fuel clad or RCS r n Any loss of both fuel clad and RCS or Any potential loss of both fuel clad and RCS or Any potential loss of either fuel clad or RCS with a loss of any additional barrier Loss of any two barriers with loss or potential loss of a third Those EALs-which'reference one or more of the fission product barrier IC designators (FC, RCS and PC)in the PEG Reference section of the technical bases are derived from the Fission Product Barrier Analysis.The analysis entailed an evaluation of every combination of the plant specific barrier loss/potential loss indicators applied to the above criteria.

OSSI-92-402A-4-REG Ginna EAI.Technical Bases Document, Rev I Where possible, the EALs have been made consistent with'nd utilize the conditions defined in the REGNPS Critical Safety Function Status Trees (CSFSTs).While the symptoms that drive operator actions specified in the CSFSTs are not indicative of gll possible conditions which warrant emergency classification, they do define the symptoms, independent of initiating events, for which reactor plant safety and/or fission product barrier integrity are threatened.

Where these symptoms are clearly representative of one of the PEG Initiating Conditions, they have been utilized as an EAL.This allows for rapid classification of emergency situations based on plant conditions without the need for additional evaluation or event diagnosis.

Although some of the EALs presented here are based on conditions defined in the CSFSTs, classification of emergencies using these EALs is not dependent upon Emergency Operating Procedures (EOPs)entry or execution.

The EALs can be utilized independently or in conjunction with the EOPs.To the extent possible, the EALs are symptom based.That is, the action level is defined by values of key plant operating parameters which identify emergency or potential emergency conditions.

This approach is appropriate because it allows the full scope of variations in the types of events to be classified as emergencies.

But, a purely symptom based approach is not sufBcient to address all events for which emergency classification is appropriate.

Particular events to which no predetermined symptoms can be ascribed have also been utilized as EALs since they may be indicative of potentially more serious conditions not yet fully realized.The EALs are grouped into nine categories to simplify their presentation and to promote a rapid understanding by their users.These categories are: 1.2.3.4 5.6.7.8.9.CSFST Status Reactor Fuel Reactor Coolant System Containment Radioactivity Release/Area Radiation Electrical Failures Equipment Failures Hazards Other Categories 1 through 5 are primarily symptom based.The symptoms are indicative of actual or potential degradation of either fission product barriers or personnel safety.Categories 6, 7 and 8 are event based.Electrical Failures are those events associated with losses of either AC or vital DC electrical power.Equipment Failures are abnormal and emergency events associated with vital plant system failures, while Hazards are those non-plant system related events which have affected or may affect plant safety.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document.Rev I Category 9 provides the Emergency Coordinator (ShiR Supervisor) the latitude to classify and declare emergencies based on plant symptoms or events which in his judgment warrant classification.

This judgment includes evaluation of loss or potential loss of one or more fission product barriers warranting emergency classification consistent with the NUMlARC barrier loss criteria.The fission product barrier loss and potential loss indicators are provided in Attachment A.Categories are further divided into one or more subcategories depending on the types and number of plant conditions that dictate emergency classifications.

For example, the Electrical Failures category has two subcategories whose values can be indicative of losses of electrical power sources: loss of AC power sources and loss of DC power sources.An EAL may or may not exist for each sub category at all four classification levels.Similarly, more than one EAL may exist for a sub category in a given emergency classification when appropriate (i.e.no EAL at the General Emergency level but three EALs at the Unusual Event level).For each EAL, the, following information is provided: Classification:

Unusual Event, Alert, Site Area Emergency, or General Emergency NUMARC Initiating Condition&om which the EAL was derived, if applicable.

~Fission product barrier loss/potential loss condition which the EAL represents, if applicable.

~Operating Mode Applicability:

One or more of the following plant operating conditions are listed: Power Operation, Hot Shutdown, Cold Shutdown, Refuel and Defueled EAL: Description of the condition or set of conditions which comprise the EAL~Basis: Description of the rationale for the EAL~PEG

Reference:

PEG IC(s)and example EAL(s)from which the EAL is derived~Basis Reference(s):

Source documentation from which the EAL is derived OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The identified operating modes are defined as follows Reactor shutdown margin is less than Technical Specification minimum required with coolant temperature (Tavg)at or above normal operating temperature.

Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg)less than normal operating temperature.

~Ih Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg)less than or equal to 200'F.E~f~g Reactor shutdown margin greater than or equal to Technical Specification minimum required for refueling operations and coolant temperature (Tavg)less than or equal to 140'F.Lh~lui Reactor vessel contains no irradiated fuel.These operating modes correlate to the NUMARC-007 and PEG identified operating modes as follows: hni 1B Power Operations Startup/Hot standby Hot Shutdown Cold Shutdown Refuel Defueled All Power Operations Power Operation Hot Shutdown Cold Shutdown Refuel Defueled All OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Plant Emergency Operating Procedures (EOPs)are designed to maintain and/or restore a set of critical safety functions which are prioritized for restoration efforts during accident conditions.

By monitoring the critical safety functions status, the impact of multiple events can be inherently addressed.

The critical safety functions are monitored through the use of Critical Safety Function Status Trees (CSFSTs).When certain plant parameters exceed threshold values specified by the CSFST, the plant operator is directed to one or more functional restoration and/or EOPs in an attempt to restore those parameters to within acceptable limits.The following CSFSTs are utilized to be indicative of failures or potential failures of one or more fission product barriers: '0 g Rdptt l tl'SFSTldl t l f reactivity control which may pose a threat to fuel clad and RCS'ntegrity.

C g Rdp tl I'SFSTldl l f core subcooling and thus pose a direct threat to the integrity of the reactor fuel clad and RCS.~H~ink'he Red path of this CSFST is indicative of a loss of ability to remove decay heat from the core and thus poses a direct threat to fuel clad and RCS integrity.

The Red path of this CSFST is indicative of a direct threat to RCS barrier integrity.

R dp t ftg CSFSTl l dl tl t l ff clad and RCS barrier and direct threat to the containment barrier integrity.

1-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.1 Alert ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required NUIVIARC IC: Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and immediate manual trips were not successful while in power operations or hot standby FPB loss/potential loss: N/A Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Subcriticality

-ORANGE path is entered based on failure of the intermediate range startup rate monitors to indicate negative or zero following reactor trip.This EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent requiring emergency boration.A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes control rods to be rapidly inserted into the core and brings the reactor subcritical (e.g., reactor trip button).This condition indicates failure of the automatic and manual protection systems to trip the reactor to the extent which precludes the reactor being made sub-critical.

Although a front line automatic protection system did not function in response to a plant transient, it is the continued criticality under"conditions requiring a reactor trip which poses the potential threat to fuel clad integrity and thus warranting declaration of an Alert.PEG

Reference:

SA2.1 1-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.CSFST F-0.1, Subcriticality 2."Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2-Questions and Answers, June 1993 1-3 OSSA-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.2 Site Area Emergency RED path in F-0.1 SUBCRITICALITY AND either: Emergency boration is inoperable OR Power range not<5%within 15 min.of initiation of emergency boration NUINARC IC: Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and manual scram trip was not successful and there is continued power generation.

FPB loss/potential loss: N/A Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Subcriticality

-RED path is entered based on failure of power range indication to decrease below 5%following a reactor trip.This portion of the EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent that the reactor is producing more heat load for which the safety systems were designed.A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes"control rods to be rapidly inserted into the core and brings power below that percent power associated with the ability of the safety systems to remove heat and continue to decrease." This condition indicates failure of both the automatic and manual protection systems to trip the reactor in conjunction with a failure of alternate boration systems to reduce reactor power below decay heat levels.The combination of failure ofboth front line and backup protection systems to function in response to a plant transient, along with the continued production of heat poses a direct threat to fuel clad and RCS integrity and thus warrants declaration of a Site Area Emergency.

1-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 15 minutes is specified to allow time for emergency boration to be effective and provides a discriminator between SA2.1 and SS2.1.The classification should be made as soon as it is apparent that emergency boration is not or will not be effective in reducing reactor power below 5%.PEG

Reference:

SS2.1 SS4.1 Basis Reference(s):

l.2.3.4 CSFST F-0.1, Subcriticality FR-S.1, Response to Reactor Restart/ATWS FR-S.2, Response to Loss of Core Shutdown"Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2-Questions and Answers, June 1993 1-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.3 General Emergency RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK MBRLRC IC: Failure of the Reactor Protection System to complete an automatic trip and manual trip was not successful and there is indication of an extreme challenge to the ability to cool the core.FPB loss/potential loss: N/A Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Subcriticality

-RED path is entered based on>5%reactor power following a reactor trip.CSFST Heat Sink-RED path is entered based on both:~both S/G's narrow range level<5%AND~Total feedwater flow to S/Gs<200 gpm CSFST Core Cooling-RED path is entered based on either:~Core exit thermocouples

>1200'F OR~Core exit thermocouples

>700'F AND~RVLIS level<43%w/no RCPs (TAF).1-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The combination of these conditions (reactor power>5%and Heat Sink-RED or Core Cooling RED path)indicates the ultimate heat sink function is under extreme challenge.

Additionally, the efforts to bring the reactor subcritical have been unsuccessful and, as a result, the reactor is producing more heat load for which the safety systems were designed.This situation could be the precursor for a core melt sequence.A major consideration is the inability to initially remove heat during the early stages of this sequence.If emergency feedwater flow is insufficient to remove the amount of heat required by design from at least one steam generator, an extreme challenge should be considered to exist.This equates to a HEAT Sink RED condition.

If CETs indicate>1200'F or are>700'F with RVLIS<top of active fuel a condition indicative of severe challenge to heat removal also exists.In the event this challenge exists at a time when the reactor has not been brought below the power associated with safety system design power (5%)a core melt sequence is considered to exist.In this situation, core degradation can occur rapidly.For this reason, the General Emergency declaration is intended to be anticipatory of the fission product barrier matrix declaration to permit maximum offsite intervention time.PEG

Reference:

SG2.1 Basis Reference(s):

l.2.3.3.4 CSFST F-0.3, Heat Sink CSFST F-0.1, Subcriticality CSFST F-0.2, Core Cooling FR-S.1, Response to Reactor Restart/ATWS FR-S.2, Response to Loss of Core Shutdown 1-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.1 Site Area Emergency ORANGE or RED path in F-0.2, CORE COOLING 1%JMARC IC: Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant)200'F.FPB loss/potential loss: Fuel clad potential loss, RCS loss Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Core Cooling-ORANGE path is entered based on either:~Core exit thermocouples

)700'F OR~RVLIS level (43%w/no RCPs (TAF)Either condition indicates subcooling has been lost and that some clad damage may occur.It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.Therefore a Site Area Emergency is warranted based upon the potential loss of fuel clad with loss of RCS barriers.PEG

Reference:

FC1.2 FC3-.2 FC4.1 SS4.1 Basis Reference(s):

1.CSFST F-0.2, Core Cooling 1-8 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.2 General Emergency RED path in F-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.NUINARC IC: N/A FPB loss/potential loss: Fuel clad los, S loss, Containment potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Core Cooling-RED path is entered based on either:~Core exit thermocouples

>1200'F OR~Core exit thermocouples

>700'F AND~RVLIS level<43%(TAF)Either condition indicates significant core exit superheating and core uncovery and is considered a loss of the Fuel Clad Barrier.It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.These conditions, if not mitigated, will likely lead to core melt which will in turn result in a potential loss of containment.

Therefore, declaration of a General Emergency is warranted.

Severe accident analyses (e.g., NUREG-1150) have concluded that function restoration procedures can arrest core degradation within the reactor vessel in a significant fraction of the core damage scenarios, and that the likelihood of containment failure is very small in these events.Given this, it is appropriate to provide a reasonable period to allow function restoration

'rocedures to arrest the core melt sequence.Whether or not procedures will be effective should be apparent within 15 minutes.The Emergency 1-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Coordinator should make the declaration as soon as it is determined that the procedures have not been, or will not be effective.

For the purpose of this EAL the term'effective'ith regards to functional restoration procedures means that the CSFST Core Cooling-RED path entry criterion no longer exists.PEG

Reference:

FC1.1 PC6.1 PC6.2 Basis Reference(s):

1.CSFST F-0.2, Core Cooling 1-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.3 Heat Sink 1.3.1 Site Area Emergency RED path in F-0.3, HEAT SINK NUINARC IC: Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant>200'F.FPB loss/potential loss: Fuel clad potential loss, RCS potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Heat Sink-RED path is entered based on both:~both S/0's narrow range level<5%AND~Total feedwater flow to S/Gs<200 gpm The combination of these two conditions indicates the ultimate heat sink function is under extreme challenge.

This EAL addresses loss of functions required for hot shutdown with the reactor at pressure and temperature.

Under these conditions, there is an actual major failure of a system intended for protection of the public with potential for multiple fission product barrier loss.Therefore, declaration of a Site Area Emergency is warranted.

PEG

Reference:

FC1.3 RCS1.2 SS4.1 Basis Reference(s):

1.'SFST F-0.3, Heat Sink 1-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.4 Integrity 1.4.1 Alert RED path on F-0.4, INTEGRITY NU1VCARC IC: N/A FPB loss/potential loss: RCS potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Integrity-RED path is entered based on both:~exceeding RCS cooldown rate of 100'F/hr AND~all RCS cold leg temperatures to the leR of the RCS Pressure/RCS Cold Leg Temperature Curve The combination of these'wo conditions indicates the RCS barrier is under significant challenge and should be considered a potential loss of RCS barrier.Any loss or potential loss of RCS barrier warrants declaration of an Alert.PEG

Reference:

RCS1.1 Basis Reference(s):

  • 1.CSFST F-0.4, Integrity 1-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.5 Contaixunent 1.5.1 General Emergency RED path F-0.5, CONTAINMENT NUINARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis: CSFST Containment

-RED path is entered based on exceeding containment design pressure of 60 psig.This pressure is well in excess of that expected from the design basis loss of coolant accident.This is indicative of a loss of both RCS and fuel clad boundaries in that it is not possible to reach this condition without severe core degradation (metal-water reaction)or failure to scram in combination with RCS breach.Since containment pressures at or approaching design levels is also a potential loss of containment,'this combination of conditions requires the declaration of a General Emergency.

PEG

Reference:

PC1.1 Basis Reference(s):

1.CSFST F-0.5, Containment 1-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor fuel cladding serves as the primary fission product barrier.Over the useful life of a fuel bundle, the integrity of this barrier should remain intact as long as fuel cladding integrity limits are not exceeded.Should'fuel damage occur (breach of the fuel cladding integrity) radioactive fission products are released to the reactor coolant.The magnitude of such a release is dependent upon the extent of the damage as well as the mechanism by which the damage occurred.Once released into the reactor coolant, the highly, radioactive fission products can pose significant radiological hazards inplant from reactor coolant process streams.If other fission product barriers were to fail, these radioactive fission products can pose significant offsite radiological consequences.

The following parameters/indicators are indicative of possible fuel failures: A'g a i, t 1 fi product activity is very low.Small concentrations of fission products in'he coolant are primarily from the fission of tramp uranium in the fuel cladding or minor perforations in the cladding itself.Any significant increase from these base-line levels is indicative of fuel failures.~F il F l 0'As with coolant activity, any fuel failures will release fission products to the reactor coolant.These fission products will be circulated with the reactor coolant and be detected by the failed fuel radiation detector in the RCS letdown line.i n Although not a direct indication or measurement of fuel damage, exceeding predetermined limits on containment high range radiation monitors under LOCA conditions is indicative possible fuel failures.~f lin A'r i i nM ni r'othareaand process radiation monitoring systems designed to detect fission products during refueling conditions as well as visual observation can be utilized to indicate loss or potential loss of spent fuel cladding integrity.

2-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.1 Unusual Event Coolant sample activity:)100%of 84/E bar p,Ci/cc total specific activity OR>0.2 p,Ci/gm I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded NUINARC IC: Fuel clad degradation FPB loss/potential loss: N/A Mode Applicability:

Basis: Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This EAL addresses reactor coolant samples exceeding coolant technical specifications.

PEG

Reference:

SU4.2 Basis Reference(s):

1.Technical Specifications section 3.1.4 2-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.2 Alert Coolant activity>300 p.Ci/cc I-131 equivalent IMUIKARC IC: N/A FPB loss/potential loss: Fuel clad loss Mode Applicability:

Power operation, hot shutdown Basis: Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This amount of coolant activity corresponds to about 2%to 5%fuel clad damage.When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.Therefore, declaration of an Alert is warranted.

PEG

Reference:

FC2.1 Basis Reference(s):

None 2-3

, OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.3 Site Area Emergency Coolant activity>300 pCi/cc I-131 equivalent and any of the following:

~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS potential loss/loss Node Applicability:

Power operation, hot shutdown Basis: This EAL addresses combinations of fuel clad loss with RCS loss and potential loss indicators.

300 pCi/cc I-131 equivalent coolant activity corresponds to about 2%to 5%fuel clad damage.When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:

RED path on F-0.4, INTEGRITY:

RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.RCS subcooling

<EOP Fig.MIN SUBCOOLING:

This indicator addresses'conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the.fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage>46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG

Reference:

FC2.1+RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):

1.2.3.4 5.EPIP-2-16"Core Damage Estimation" CSFST F-0.4 Integrity E-O, Reactor Trip or Safety Injection Technical Specifications Section 3.1.5.2 FSAR Table 9.3.6 2-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.1 Unusual Event Letdown Line Monitor R-9>2 R/hr NUMARC IC: Fuel clad degradation FPB loss/potential loss: N/A Mode Applicability:

Basis: Elevated letdown line activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.This radiation level (2 H/hr)corresponds to 1%fuel failure (bases for the Technical Specifications coolant activity limits).Therefore, declaration of an Unusual Event is warranted.

PEG

Reference:

SU4.1 Basis Reference(s):

1.Technical Specifications section 3.1.4 2.P-9"Radiation Monitoring System" 3.EPIP 2-16 section 6.2.l.b 2-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.2 Alert Letdown Line Monitor R-9>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad loss Mode Applicability:

Power operation, hot shutdown Basis: This condition indicates the loss of the fuel clad barrier.Failed Fuel Monitor readings of 2 R/hr corresponds to 1%fuel failures.Failed Fuel Monitor readings of 10 R/hr corresponds to 5%fuel failures and is considered an actual loss of fuel clad.Note: Monitor R-9 automatically shifts scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.PEG

Reference:

FC6.1 Basis Reference(s):

l.EPIP-2-16"Core Damage Estimation" 2.P-9"Radiation Monitoring System" 3.EPIP 2-16 section 6.2.1.b 2-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.3 Site Area Emergency Letdown Line Monitor R-9>10 8/hr and any of the following:

~RED path on F-0.4, INTEGRITY~Primary system leakage>46 gpm~RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage NUIKARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS potential loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses combinations of fuel clad.loss with RCS loss and potential loss indicators.

Failed Fuel Monitor readings of 10 R/hr corresponds to 5%fuel failures.This condition indicates the loss of the fuel clad barrier.Note: Monitor R-9 automatically shiRs scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:

RED path on F-0.4, INTEGRITY:

RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.RCS subcooling

<EOP Fig.MIN SUBCOOLING:

This indicator addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage>46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG

Reference:

FC6.1+RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):

1.2.3.4 5.6.7.EPIP-2-16"Core Damage Estimation" CSFST F-0.4 Integrity E-O, Reactor Trip or Safety Injection F-0.5, Containment FR-Z.1, Response to High Containment Radiation Level Technical Specifications Section 3.1.5.2 FSAR Table 9.3.6 2-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading)10 R/hr MB4ARC IC: N/A FPB loss/potential loss: RCS loss Mode Applicability:

Power operation, hot shutdown Basis: Thel0 R/hr reading is a value which indicates the release of reactor coolant to the containment.

The reading was derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with normal operating concentrations (i.e., within T/S)into the containment atmosphere.

This EAL is indicative of a RCS leak only.If the radiation monitor reading increased to that specified by Reactor Fuel EAL 2.3.2, significant fuel damage would also be indicated.

PEG

Reference:

RCS4.1 Basis Reference(s):

1.F-0.5, Containment 2.FR-Z.1, Response to High Containment Radiation Level 3.EPIP 2-16, Core Damage Estimation 2-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.2 Site Area Emergency Containment radiation monitor R-29/R-30 reading>100 R/hr NUMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss Mode Applicability:

Power operation, hot shutdown Basis: The 100 R/hr reading is a value which indicates the release of reactor coolant, with elevated activity indicative of fuel damage, into the containment.

The reading is derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with a concentration of 300 p.Ci/gm dose equivalent I-131 into the containment atmosphere.

Reactor coolant concentrations of this magnitude are several times larger than the maximum concentrations (including iodine spiking)allowed within technical specifications and are therefore indicative of fuel damage (approximately 2-5%clad failure depending on core inventory and RCS volume).This value is higher than that specified in EAL 2.3.1 which would be indicative of only the RCS barrier.Thus, this EAL indicates a loss of both the fuel clad barrier and a loss of RCS barrier warranting declaration of a Site Area Emergency.

PEG

Reference:

FC5.1 Basis Reference(s):

1.P-9, Radiation Monitoring System, Section 2.2.2.6, pg.P-9:2 2.EPIP 2-16, Core Damage Estimation 2-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.3 General Emergency Containment radiation monitor R-29/R-30 reading>1000 R/hr NUINARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis: The 1000 H/hr reading is a value which indicates significant fuel damage (>20%clad failure)well in excess of the EALs associated with both loss of fuel clad and loss of RCS barriers.A major release of radioactivity requiring offsite protective actions from core damage is not possible unless a major failure of fuel cladding allows radioactive material to be released from the core into the reactor coolant.Regardless of whether containment is challenged, this amount of activity in containment, if released, could have such severe consequences that it is prudent to treat this as a potential loss of containment, such that a General Emergency declaration is warranted.

NUREG-1228"Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents," indicates that such conditions do not exist when the amount of clad damage is less than 20%.PEG

Reference:

PC5.1 2-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.2.3.EPIP 1-0, Ginna Station Event Evaluation and Classification EPIP 2-16, Core Damage Estimation NUREG-1228"Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents" Technology for Energy Report No.R-81-012 2-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint Nl3EIARC IC: Unexpected increase in plant radiation or airborne concentration.

FPB loss/potential loss: N/A Mode Applicability:

Basis: In light of Reactor Cavity Seal failure, incidents at two different PWRs and loss of water in the Spent Fuel Pit/Fuel Transfer Canal at a BWR all occurring since 1984, explicit coverage of these types of events via EALs¹1 and¹2 is appropriate given their potential for increased doses to plant staK Classification as an Unusual Event is warranted as a precursor to a more serious event.The spent fuel pool low water level alarm setpoint of 20 in.below top of pool is actuated by LC-661.The definition of"...cannot be restored and maintained above..." allows the operator to visually observe the low water level condition, if possible, and to attempt water level restoration instructions as long as water level remains above the top of irradiated fuel.Water level restoration instructions for loss of refueling cavity water level during refueling are performed in accordance with the RF-65 series of procedures.

When the fuel transfer canal is directly connected to the spent fuel pool and reactor cavity, there could exist the possibility of uncovering irradiated fuel in the fuel transfer canal.Therefore, this EAL is applicable for conditions i'which irradiated fuel is being transferred to and from the RPV and spent fuel pool.2-14 T OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

AU2.1 Basis Reference(s):

1.ER-SFP.1"Loss of Spent Fuel Pit Cooling" 2.AR-K-29 3.RF-65 series 2-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.2 Alert Confirmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:~R-2 Containment Area Monitor~R-5 Spent Fuel Pit~R-12 Containment Noble Gas NUMARC IC: Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.FPB loss/potential loss: N/A Mode Applicability:

All Basis: NUREG-0818,"Emergency Action Levels for Light Water Reactors," forms the basis for this EAL.This EAL is defined by the specific area where irradiated fuel is located such as reactor cavity, reactor vessel, or spent fuel pool.NUREG/CR-4982,"Severe Accident in Spent Fuel Pools in Support, of Generic Safety Issue 82," July 1987, indicates that even if corrective actions are not taken, no prompt fatalities are predicted, and that risk of injury is low.In addition, NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" presents the following in its discussion: "In the event of a serious accident involving decayed spent fuel, protective actions would be needed for personnel on site, while offsite doses (assuming an exclusion area radius of one mile from the plant site)would be well below the Environmental Protecti'on Agency's Protective Action Guides.Accordingly, it is important to be able to properly survey and monitor for Kr-85 in the event of an accident with'decayed spent fuel." 2-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 W An"uncontrolled fuel handling process" is defined as any event or activity related to the movement of irradiated fuel which results in unexpected or uncontrolled conditions.

This terminology has been specifically added to exclude anticipated increases in area radiation levels as a result of actions performed in accordance with approved procedures during refueling operations.

Thus, an Alert Classification for this event is appropriate.

Escalation, if appropriate, would occur via Emergency Coordinator judgment in EAL Category 9.0.The basis for the Containment Area Monitor setpoint (50 mR/hr)and Spent Fuel Pit monitor setpoint (25 mH/hr)are a spent fuel handling accident and is, therefore, appropriate for this EAL.PEG

Reference:

AA2.1 Basis Reference(s):

1.2.3.P-9 Radiation Monitoring System NUREG-0818,"Emergency Action Levels for Light Water Reactors," NUREG/CR-4982,"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" 2-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel'.3 Refueling Accidents or Other Radiation Monitors 2.4.3 Alert Report of visual observation of irradiated fuel uncovered MBCARC IC: Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL is defined by the specific areas where irradiated fuel is located such as reactor cavity, or spent fuel pool.There is no indication that water level in the spent fuel pool or refueling cavity has dropped to the level of the fuel other than by visual observation.

Since there is no level indicating system in the fuel transfer canal, visual observation of loss of water level would also be required.SuQicient time exists to take corrective actions for these conditions and there is little potential for substantial fuel damage.NUREG/CR-4982"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" indicates that even if corrective actions are not taken, no prompt fatalities are predicted and the risk of injury is low.In addition, NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" presents the following it its discussion: "In the event of a serious accident involving decayed spent fuel, protective actions would be n'ceded for personnel on site, while oQ'site doses (assuming an exclusion area radius of one mile from the plant site)would be well below the Environmental Protection Agency's Protective Action Guides.Accordingly, it is important to be able to properly survey 2-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 and monitor for Kr-85 in the event of an accident with decayed spent fuel.Thus, an Alert Classification for this event is appropriate.

Escalation, if appropriate, would occur via radioactivity release category 5.0 or Emergency Coordinator judgment in EAL Category 9.0.This EAL applies to spent fuel requiring water coverage and is not intended to address spent fuel which is licensed for dry storage.PEG

Reference:

AA2.2 Basis Reference(s):

1.2.P-9 Radiation Monitoring System NUREG/CR-4982"Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82".NRC Information Notice No.90-08,"KR-85 Hazards from Decayed Fuel" 2-19 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor vessel provides a volume for the coolant which covers the reactor core.The reactor vessel and associated pressure piping (reactor coolant system)together provide a barrier to limit the release of radioactive material should the reactor fuel cladding integrity fail.There are three RCS parameters which are indicative of conditions which may pose a threat to RCS or fuel cladding integrity:

SCfLtlRR*(>>T l l 1ST'fi tl)RCSl tg indications are utilized to indicate potential pipe cracks which may propagate to an extent threatening fuel clad, RCS and containment integrity.

RCS leakage of a degree requiring ECCS to maintain RCS inventory poses a direct threat to fuel clad integrity.

Reactor vessel water level is also directly related to the status of adequate core cooling, and therefore fuel cladding integrity.

n A subset of RCS leakage, excessive primary to secondary leakage in conjunction with unisolable secondary releases to environment may result in losses of containment integrity as well as threaten fuel clad integrity for more severe SG tube ruptures.Al fRCS A ll gl f d t ll dl that the inventory control systems are inadequate in maintaining RCS pressure and inventory against mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1.1 Unusual Event 3.1 RCS Leakage Unidentified or pressure boundary leakage>10 gpm OR Identified leakage>25 gpm NUMARC IC: RCS leakage when greater than 200'F FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: The conditions of this EAL may be a precursor of more serious conditions and, as a result, is considered to be a potential degradation of the level of safety of the plant.The 10 gpm value for the.unidentified leakage and pressure boundary leakage was selected because it is observable with normal Control Room indications.

Smaller values must be determined through time-consuming surveillance tests (e.g., mass balances).

The 25 gpm value for identified leakage is set at a higher value because of the significance of identified leakage in comparison to unidentified or pressure boundary leakage.Only operating modes in which there is fuel in the reactor coolant system and the system is pressurized are specified.

PEG

Reference:

SU5.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.2 Alert Primary system leakage>46 gpm MMARC IC: N/A FPB loss/potential loss: RCS potential loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.PEG

Reference:

RCS2.2 Basis Reference(s):

1.FSAR Table 9.3.6 3-3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1.3 Site Area Emergency 3.1 RCS Leakage RVLIS cannot be maintained

>43%with no RCPs running OR With the reactor vessel head removed, it is reported that water level in the reactor vessel is dropping in an uncontrolled manner and core uncovery is likely NUINARC IC: Loss of reactor vessel water level has or will uncover fuel in the reactor vessel.FPB loss/potential loss: Fuel clad potential loss, RCS loss Mode Applicability:

Basis: The reactor vessel water level used in this EAL is the top of active fuel (TAF).This value corresponds to the level which is used in CSFSTs to indicate challenge to core cooling and loss of the fuel clad barrier.This is the minimum water level to assure core cooling without further degradation of the clad.Severe core damage can occur and reactor coolant system pressure boundary integrity may not be assured if reactor vessel water level is not maintained above that corresponding to RVLIS at 43%.RVLIS dynamic range indications are not utilized in this EAL since the RCPs would not be running under conditions where vessel level is approaching TAF.Thus, declaration of a Site Area Emergency is warranted under the conditions specified by this EAL.Escalation to a General Emergency would be via radioactivity release category 5.0.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

SS5.1 FC4.1 Basis Reference(s):

1.FR-C.1"Response to Inadequate Core Cooling" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Reactor Coolant System 8.2 Primary to Secondary Leakage 8.2.1 Unusual Event Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator NUlVIARC IC: N/A FPB loss/potential loss: Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of containment.

Secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed.by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.For small leaks, not exceeding the normal charging capacity threshold in RCS leakage EAL 3.1.2, this EAL results in an Unusual Event.For larger leaks, RCS leakage EAL 3.2.2 would result in a Site Area Emergency.

For SG tube ruptures which may involve multiple steam generators or unisolable secondary line breaks, SG tube rupture EAL 4.2.1 would also result in a Site Area Emergency.

PEG

Reference:

PC4.1 Basis Reference(s):

1.Technical Specifications Section 3.1.5.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.2 Site Area Emergency Unisolable release of secondary side to atmosphere with primary to secondary leakage)46 gpm MMARC IC N/A FPB loss/potential loss: RCS potential loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of both RCS and containment barriers.Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.Primary to secondary leakage)46 gpm is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS)by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.For primary to secondary leakage)46 gpm in the absence of any secondary to atmosphere release, an Alert would be declared based on EAL 3.1.2, This EAL represents the loss of both RCS and containment barriers and therefore warrants declaration of a Site Area Emergency.

PEG

Reference:

PC4.1+RCS2.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.Technical Specifications Section 3.1.5.2 2.E-3"Steam Generator Tube Rupture" 3.FSAR Table 9.3.6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.3 Site Area Emergency Release of secondary side to atmosphere with primary to secondary leakage>0.1 gpm per steam generator AND Coolant activity)300 pCi/cc of I-131 MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses SG tube leaks indicative of a loss of containment in conjunction with a loss of fuel cladding.Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs.A steam generator which is required to be used for plant cooldown would also be covered under this EAL.A coolant activity)300 pCi/cc of I-131 indicates a loss of fuel cladding.Refer to EAL N2.1.2 basis This condition represents a loss of both primary containment with the loss of fuel cladding and thus warrants declaration of a Site Area Emergency.

PEG

Reference:

PC4.1+FC2.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.Technical Specifications Section 3.1.4 3-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage NUINARC IC: N/A FPB loss/potential loss: RCS loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred.The loss of subcooling is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through the leak.Loss of the RCS barrier warrants declaration of an Alert.PEG

Reference:

RCS2.1 Basis Reference(s):

1.E-O, Reactor Trip Or Safety Injection 3-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The containment structure is an atmospheric vapor containment system.It forms a Gssion product barrier designed to contain the radioactive fission products generated from any postulated accident so as to preclude exceeding offsite exposure limits.The containment structure is a low leakage system housing the reactor vessel, the reactor coolant piping, steam generators and other branch connections of the reactor primary system.The containment is equipped with isolation valves for systems which penetrate the containment boundary.These valves automatically actuate to isolate systems under emergency conditions.

There are three containment parameters which are indicative of conditions which may pose a threat to containment integrity or indicate degradation of RCS or reactor fuel clad integrity.

~i n I Abnormally high containment pressure or failure of containment cooling systems following a LOCA are indicative of potential losses of the containment barrier integrity.

The existence of an unisolable CI or CVI line break outside containment constitutes a loss of containment integrity as well as a loss of RCS boundary.Inconsistent containment response to a known LOCA is also indicative of containment loss in conjunction with RCS barrier breach.Should a loss of fuel cladding integrity occur under either of these conditions, the potential for release of large amounts of radioactive materials to the environment exists.m r wi h n 1 SGtube ruptures in conjunction with a secondary system line break resulting in release to the environment constitutes losses of both RCS and containment integrity.

Primary to secondary leakage in excess of Technical Specifications in conjunction with fuel clad damage and secondary system leakage to the environment constitutes losses of fuel clad, RCS and containment integrity.

This condition provides the potential for release of large amounts of radioactive materials to the environment.

~m i 1 n r'The existence of combustible'gas concentrations in containment pose a severe threat to containment integrity and are indicative of severely degraded reactor core and RCS conditions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.1 Containment

Integrity Status 4.1.1 Unusual Event Both doors open on containment airlock.OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment NUMARC IC: N/A FPB loss/potential loss: Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses an indication that unambiguously indicates loss of the containment barrier under conditions when containment integrity is required.It is important to note however, that loss of containment due to both airlock doors being open is event dependent.

Upon recognition, shift personnel would rapidly respond in an attempt to reestablish containment integrity.

If the doors cannot be reclosed, any loss of the RCS barrier that occurs with the doors open would appear as an inconsistent LOCA response.Therefore, this event is not used as a definitive indicator of loss of the primary containment barrier for purposes of defining higher classification EALs.Rather it is left to the Emergency Coordinator's judgment whether such a loss has occurred.'EG

Reference:

PC7.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.1 Containment

Integrity Status/4.1.2 Site Area Emergency 4 Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions MBMRC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: Rapid unexplained loss of pressure (i.e., not attributable to containment spray or Fan Cooling Units or condensation effects)following an initial pressure increase indicates a loss of both RCS and containment integrity.

Containment pressure and sump levels should increase as a result of th'mass and energy release into containment from a LOCA.Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.

This EAL indicates loss of both RCS and containment and therefore warrants declaration of a Site Area Emergency.

PEG

Reference:

PC2.1 PC2.2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.Alarm response procedure, AR-C-18, Revision 6 2.Alarm response procedure, AR-C-19, Revision 4 3.R.E.Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.1 Containment

Integrity Status 4.1.3 Site Area Emergency Either: CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists MMARC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL is intended to address incomplete containment isolation that allows direct release to the environment.

It represents a loss of both the RCS and containment barrier and therefore warrants declaration of a Site Area Emergency.

Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment.

It represents a loss of both the RCS and containment barrier.Confirmation of a I OCA should be based on diagnostic activities consistent with E-0"Reactor Trip or Safety Injection.""Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment.

PEG

Reference:

PC3.1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.FR-2.1"Response to High Containment Pressure" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

'4.l Containment Integrity Status 4.1.4 General Emergency Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Table 4.3 Minimum 0 erable Containment Heat Removal E ui ment CNMT Pressure Recirc Fans 0 erable S ra Pum sRe uired<28 psig N/A>28 psig Table 4.1 Fuel Clad Loss Indicators 1.Coolant activity>300 p.Ci/cc of I-131 2.Containment rad monitor R-29/R-30 reading>100 H/hr 3.Letdown Monitor R-9 reading>10 H/hr 4.RED path in F-0.2, CORE COOLING MMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL represents a potential loss of containment in conjunction with losses of both RCS and fuel clad.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 A potential loss of containment is considered to exist in that the containment heat removaVdepressurization systems (e.g., containment sprays, Recirc.Fans, but not including containment venting strategies) are either lost or performing in a degraded manner, as indicated by plant parameters such as containment pressure, pressurizer level and steam line pressure in excess of the setpoints at which the equipment was supposed to have actuated.RCS is also assumed to be lost in this condition due to exceeding safety injection initiation setpoints:

containment pressure ()4 psig)or low pressurizer

(<1723 psig).Table 4.1 presents fuel clad loss indicators which represent 2-5%clad failures.Refer to EAL 0's 2.1.2, 2.2.2, and 2.3.2 for bases of these indicators.

PEG

Reference:

PC2.5+FC2.1, FC5.1 and FC6.1 Basis Reference(s):

l.2.3.4.5.6.7.8.Technical Specifications, Table 3.5-4, pg.3.5-17 R.E.Ginna UFSAR, Section 6.2.2.1.2.4, pg.6.2-28 Technical Specifications, Article 5.2.1, pg.5.2-1 FR-Z.1, Response to High Containment Pressure, Revision 3 R.E.Ginna UFSAR, Section 6.2.2.1, pg.6.2-24b R.E.Ginna UFSAR, Section 6.2.2.2, pg.6.2-32 and Figure 6.2-11 EPIP 2-16, Core Damage Estimation P-9, Radiation Monitoring System, Revision 67, Section 2.2.2.6, pg.P-9:2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.1 Containment

Integrity Status 4.1.5 General Emergency Either: Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Damage Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 pCi/cc of I-131 Containment rad monitor R-29/R-30 reading>100 Ehr Letdown Monitor R-9 reading>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad potential loss/loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency., 4-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Rapid unexplained loss of pressure (i.e., not attributable to containment spray or Fan Cooling Units or condensation effects)following an initial pressure increase indicates a loss of both RCS and containment integrity.

Containment pressure and sump levels should increase as a result of the mass and energy release into containment from a LOCA.Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.

Table 4.2 presents fuel clad loss and potential loss indicators:

~ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL¹1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL¹1.2.1 basis Coolant activity>300 p,Ci/cc of I-131: Refer to EAL¹2.1.2 basis~Containment rad monitor reading>100 R/hr: Refer to EAL¹2.3.2 basis~Letdown Monitor R-9 reading>10 H/hr: Refer to EAL¹2.2.2 basis PEG

Reference:

PC2.1/PC2.2+

FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

l.2.3.4 5.6.7.8.9.10.Alarm response procedure, AR-C-18, Revision 6 Alarm response procedure, AR-C-19, Revision 4 R.E.Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiation Monitoring System" 4-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.1 Containment

Integrity Status 4.1.6 General Emergency Either: " CI or CVI valve(s)not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 p,Ci/cc of I-131 Containment rad monitor R-29/R-30 reading>100 R/hr Letdown Monitor R-9 reading>10 R/hr MMARC IC: N/A FPB loss/potential loss: Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.

Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment.

It represents a loss of both the RCS and containment barrier.4-12 OSSI-92-402A-4-REG Ginna EAI Technical Bases Document, Rev 1"Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment Table 4.2 presents fuel clad loss and potential loss indicators:

~ORANGE path in F-0.2, Core Cooling: Refer to EAL¹1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL¹1.2.1 basis~Coolant activity>300 pCi/cc of I-131: Refer to EAL¹2.1.2 basis Containment rad monitor reading>100 R/hr: Refer to EAL¹2.3.2 basis~Letdown Monitor R-9 reading>10 H/hr: Refer to EAL¹2.2.2 basis PEG

Reference:

PC3.1+FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

1.2.3.4 5.6.7.8.9.10.FR-2.1"Response to High Containment Pressure" CSFST F-0.2,"Core Cooling" FR-C.l,"Response to Inadequate Core Cooling" EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR;C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiatio'n Monitoring System" 4-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Contaixunent 4.2 SG Tube Rupture w/Secondary Release 4.2.1 Site Area Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" NMGQtC IC: N/A FPB loss/potential loss: RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL is intended to address the full spectrum of Steam Generator (SG)tube rupture events in conjunction with a loss of containment due to a significant secondary line break.This EAL addresses ruptured SG(s)with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier).This allows the direct release of radioactive fission and activation products to the environment.

Resultant offsite dose rates are a function of many variables.

Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.

The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), if available.

This should include indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG.Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam, and/or SG sampling system.Determination of the"uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action.This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the affected SG 4-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 to the environment.

This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.PEG

Reference:

RCS3.1 Basis Reference(s):

1.E-3"Steam Generator Tube Rupture" 4-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.2 SG Tube Rupture w/Secondary Release 4.2.2 General Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity>300 p.Ci/cc of I-131 Containment rad monitor R-29/R-30 reading>100 R/hr Letdown Monitor R-9 reading>10 R/hr NUMARC IC: N/A FPB loss/potential loss: Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL is intended to address the full spectrum of Steam Generator (SG)tube rupture events in conjunction with a loss of containment due to a significant secondary line break with actual or potential loss of the fuel clad integrity.

This EAL addresses ruptured SG(s)with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier)with the actual or potential loss of the third (fuel cladding).

This allows the direct release of radioactive fission and activation products to the environment.

Resultant offsite dose rates are a function of many variables.

Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.

4-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), if available.

This should include.indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG.Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam,.and/or SG sampling system.Determination of the"uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action.This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the afFected SG to the environment.

This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.Table 4.2 presents fuel clad loss and p'otential loss indicators:

~ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL¹1.1.1 basis~RED path in F-0.3, Heat Sink: Refer to EAL¹1.2.1 basis~Coolant activity>300 pCi/cc of I-131: Refer to EAL¹2.1.2 basis~Containment rad monitor reading>100 R/hr: Refer to EAL¹2.3.2 basis~Letdown Monitor R-9 reading>10 R/hr: Refer to EAL¹2.2.2 basis This condition represents a loss of both RCS and primary containment with the loss or potential loss of fuel cladding and thus warrants declaration of a General Emergency.

PEG

Reference:

RCS 3.1+FC1.2, FC1.3, FC2.1, FC3.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

1.2.3.4 5.6.'7.8.Technical Specifications Section 3.1.5.2 EPIP 2-16, Core Damage Estimation CSFST F-0.2, Core Cooling, Revision 3 CSFST F-0.3, Heat Sink, Revision 3 FR-C.1, Response to Inadequate Core Cooling, Revision 7 FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg.3 P-9"Radiation Monitoring System" 4-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment

4.3 Combustible

Gas Concentrations 4.3.1 General Emergency>4%hydrogen concentration in containment MJMARC IC: N/A FPB loss/potential loss: Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis: Existence of an explosive mixture (4%hydrogen)means a hydrogen and oxygen concentration of at least the lower deflagration limit curve exists.When hydrogen and oxygen concentrations reach or exceed the deflagration limits, imminent loss of the containment barrier exists.To generate such levels of combustible gas, loss of the fuel clad and RCS barriers must have occurred.This EAL represents loss of both fuel clad and,RCS with the potential loss of containment and therefore warrants declaration of a General Emergency.

PEG

Reference:

PC2.4 Basis Reference(s):

1.FR-Z.1"Response to High Containment Pressure" 4-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Many EALs are'ased on actual or potential degradation of fission product barriers because of the increased potential for oÃsite radioactivity release.Degradation of fission product barriers though, is not always apparent via non-radiological symptoms.Therefore, direct indication of increased radiological effluents or area radiation levels are appropriate symptoms for emergency classification.

At lower levels, abnormal radioactivity releases may be indicative of a failure of containment systems or precursors to more significant releases.At higher release rates, offsite radiological conditions may result which require offsite protective actions.Increased area radiation levels in plant may also be indicative of the failure of containment systems or preclude access to plant vital equipment necessary to ensure plant safety.There are two basic indications of radioactivity release rates and one for area radiation levels which warrant emergency classifications.

Di iii ii f Bl i ii'i'g systems provides a rapid assessment mechanism to determine releases in excess of classifiable limits.P.Projected offsite doses (based on effluent monitor readings)or actual offsite field measurements indicating doses or dose rates above classifiable limits.: Sustained general area radiation levels in excess of those indicating loss of control of radioactive materials or those levels which may preclude access to vital plant areas also warrant emergency classification.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.1 Unusual Event A valid reading on any monitors Table 5.1 column"NUE" for)60 min.unless sample analysis can confirm release rates<2 x technical specifications within this time period.Table 5.1 Effluent Monitor Classification Thresholds Monitor NUE Alert R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)

R-14A(7/9)

R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 p,Ci/cc 0.533 p,Ci/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 p,Ci/cc 115.00 p,Ci/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr NU1KARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis: The"value shown" for each monitor is two times the calculated Technical Specification release rates as specified in P-9 section 2.4.Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.The final integrated dose (which is very low in the Unusual Event emergency class)is not the primary concern here;it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes.Therefore, it is not intended that the release be averaged over 60 minutes.For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.

Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes.Monitor indications are calculated on the basis of the methodology of the site Offsite Dose Calculation Manual (ODCM).Annual average meteorology is used.Valid means that a radiation monitor reading has been confirmed by the operators to be correct.PEG

Reference:

AU1.1 Basis Reference(s):

1.2.3.4.5.6.EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3"Calculations for NU)~C EALs" by P.S.Polfleit File EAL.XLS RD-15.0 ODCM 5.3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.2 Alert.A valid reading on any monitors Table 5.1 column"Alert" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"Alert" within this time period.Monitor Table 5.1 EfQuent Monitor Classification Thresholds NUE QE, R-11 R-12 R-13 R-14 R-15 R-18 R-12 A(7/9)R-14A(7/9)

R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 pCi/cc 19.0 mEVhr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr Table 5.2 Dose Projection/

Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 0

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:

Basis: This event escalates from the Unusual Event by escalating the magnitude of the release by a factor of 100.Prorating the 500 mR/yr criterion for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.The required release duration was reduced to 15 minutes in recognition of the increased severity.Monitor indications are calculated on the basis of the methodology of the EPIP 2-18 Control Room Dose Assessment.

Annual average meteorology is used.As previously stated;the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits, rounded down to 10 mR/hr.The values for the gaseous effluent radiation monitors are based upon not exceeding 10 mR/hr at the site boundary as a result of the release.The conversion factors are based upon the mixture of noble gas present in reactor coolant during the V25/82 tube rupture-normal operations.

Since there is no high range monitor associated with liquid e6luent monitor R-18 and the 200x Technical Specification value is beyond it's upper scale, an indication of"offscale hi" is conservatively used.Valid means that a radiation monitor reading has been confirmed by the operators to be correct.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AA1.1 Basis Reference(s):

1.2.3.4 5.EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3"Calculations for NUMARC EALs" by P.S.Polfleit File EAL.XLS OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1 Effluent Monitors 5.1.3 Site Area Emergency A valid reading on any monitors Table 5.1 column"SAE" for)15 min.unless dose assessment can confirm releases are below Table 5.2 column"SAE" within this time period.Monitor Table 5.1 EfHuent Monitor Classification Thresholds Alert R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)

R-14A(7/9)

R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 pCi/cc 11.50 p,Ci/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mR/hr 95.1 mRhr 47.6 m R/hr 31.7 mEUhr 23.8 mR/hr Table 5.2 Dose Projection/

Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 MBCARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.FPB loss/potential loss: N/A Mode Applicability:

Basis: The values shown were determined utilizing EPIP 2-18"Control Room Dose Assessment" based upon a 100 mR whole body exposure.The calculations made the assumption of neutral stability and an 8 mph wind speed.These conditions represent annual average meteorology.

The most restrictive x/Q values at the 0-0.5 mile distance were used.EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of 1E-4.The 100 mR integrated dose is based on the proposed 10CFR20 annual average population exposure.This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes.It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class description.

The 500 mR integrated child thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.Integrated doses are generally not monitored in real-time.

In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 100 mR/hour whole body or 500 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).

Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.Valid means that a radiation monitor reading has been con6rmed by the operators to be correct.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AS1.1 Basis Reference(s):

1.2.3.4 5.P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment FSAR Table 2.3"Calculations for MJMARC EALs" by P.S.Polfleit File EAL.XLS RD-15.0 ODCM Tables 3, 5 and 7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.1.4 General Emergency 5.1 EQ1uent Monitors A valid reading on any monitors Table 5.1 column"GE" for>15 min.unless dose assessment can confirm releases are below Table 5.2 column"GE" within this time period.Table 5.1 EfQuent Monitor Classification Thresholds Monitor R-11 R-12 R-13 R-14 R-15 R-18 R-12A(7/9)

R-14A(7/9)

R-15 A(7/9)R-31/32 1 ARV 1 Safety 2 Safety 3 Safety 4 Safety NUE 1.62E6 cpm 7.80E6 cpm 2.20E4 cpm 6.40E5 cpm 4.00E5 cpm 3.60E5 cpm N/A N/A N/A N/A N/A N/A N/A N/A Alert N/A 1.07E7 cpm N/A 1.61E6 cpm 2.31E7 cpm offscale hi N/A N/A N/A 1.900 mR/hr 0.951 mR/hr 0.476 mR/hr 0.317 mR/hr 0.238 mR/hr N/A N/A N/A N/A N/A N/A 6.00 pCi/cc 0.533 p,Ci/cc 11.50 pCi/cc 19.0 mR/hr 9.51 mR/hr 4.76 mR/hr 3.17 mR/hr 2.38 mR/hr N/A N/A N/A N/A N/A N/A 60.00 pCi/cc 5.33 pCi/cc 115.00 pCi/cc 190 mEUhr 95.1 mRhr 47.6 m R/hr 31.7 mR/hr 23.8 mR/hr Table 5.2 Dose Projection

/Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mR/hr 5000 mR/hr 5-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUIVCARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.

FPB loss/potential loss: N/A Mode Applicability:

Basis: The values shown were determined utilizing EPIP 2-18"Control Room Dose Assessment" based upon a 1000 mR whole body exposure.The calculations made the assumption of neutral stability and an 8 mph wind speed.These conditions represent annual average meteorology.

EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of lE-4.The 1000 mR whole body and the 5000 mR child thyroid integrated dose are based on the EPA protective action guidance which indicates that public protective actions are indicated if the dose exceeds 1 rem whole body or 5 rem child thyroid.This is consistent with the emergency class description for a General Emergency.

This level constitutes the upper level of the desirable gradient for the Site Area Emergency.

Integrated doses are generally not monitored in real-time.

In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 1000 mR/hour whole body or 5000 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).

Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.Valid means that a radiation monitor reading has been, con6rmed by the operators to be correct.5-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AG1.1*Basis Reference(s):

l.2.3.4 P-9'Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment FSAR Table 2.3"Calculations for MV~C EALs" by P.S.PolQeit File EAL.XLS 5-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/

Environmental Measurements/Release Rates 5.2.1 Unusual Event Confirmed sample analyses for gaseous or liquid release rates>2 x technical specifications limits for>60 min.NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:

Basis: Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.The final integrated dose (which is very low in the Unusual Event emergency class)is not the primary concern here;it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes.Therefore, it is not intended that the release be averaged over 60 minutes.For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.

Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes PEG

Reference:

AU1.2 5-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):, 1.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 5-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/

Environmental Measurements/

Release Rates 5.2.2 Alert Confirmed sample analyses for gaseous or liquid release rates)200 x technical specifications limits for>15 min.NUINARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.FPB loss/potential loss: N/A Mode Applicability:

Basis: Confirmed sample analyses in excess of two hundred times the site technical specifications that continue for 15 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety.This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i.e., 200 times Technical Specifications).

Prorating the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.The required release duration was reduced to 15 minutes in recognition of the increased severity.PEG

Reference:

AA1.2 5-15 OSSI-92-402A-4-RE G Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):

1.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 5-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/

Environmental Measurements/

Release Rates 5.2.3 Alert Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"Alert" at the site boundary or beyond.Table 5.2 Dose Projection

/Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mB/hr N/A 100 mR 500 mR 100 mR/hr 500 mR/hr 1000 mR 5000 mR 1000 mH/hr 5000 mR/hr NUMARC IC: Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer FPB loss/potential loss: N/A Mode Applicability:

Basis.Offsite integrated doses in excess of 10 mR TEDE or dose rates in excess of 10 mR/hr TEDE represent an uncontrolled situation and hence, a potential degradation in the level of safety.This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i.e., 200 times Technical Specifications).

Prorating the 5-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 500 mR/yr basis of 10CFR20 for both time (8766 hr/yr)and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.As previously stated, the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of 10CFR20, rounded down to 10 mR/hr.PEG

Reference:

AA1.2 Basis Reference(s):

2.3.4 Technical Specifications, Amendment No.24, Article's 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment 5-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/

Environmental Measurements/

Release Rates 5.2.4 Site Area Emergency Dose projections or field surveys resulting from actual or imminent release which indicate doses/dose rates>Table 5.2 column"SAE" at the site boundary or beyond.Table 5.2 Dose Projection

/Env.Measurement Classification Thresholds TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mR/hr N/A 100 mR 500 mR 100 mH/hr 500 mH/hr 1000 mR 5000 mR 1000 mH/hr 5000 mH/hr NUINARC IC: Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.FPB loss/potential loss: N/A Mode Applicability:

'Basis: The 100 mR integrated TEDE dose in this EAL is based on the proposed 10CFR20 annual average population exposure.This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes.It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class 5-19 OSSI-92-402A-4-BEG Ginna EAL Technical Bases Document, Rev 0 description.

The 500 mR integrated CDE thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.In establishing the dose rate emergency action levels, a duration of one hour is assumed.Therefore, the dose rate EALs are based on a site boundary dose rate of 100 mR/hr TEDE or 500 mRlhr CDE thyroid, whichever is more limiting.PEG

Reference:

AS1.3 AS1.4 Basis Reference(s):

2.3.Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment t 5-20 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.2 Dose Projections/

Environmental Measurements/

Release Rates 5.2.5 General Emergency Dose projections or field surveys resulting Rom actual or imminent release which indicate doses/dose rates>Table 5.2 column"GE" at the site boundary or beyond.Table 5.2 Dose Pro ection/Env.Measurement Classification Thresholds Alert TEDE CDE Thyroid TEDE rate CDE Thyroid rate 10 mR N/A 10 mH/hr N/A 100 mR 500 mR 100 mH/hr 500 mR/hr 1000 mR 5000 mR 1000 mH/hr 5000 mH/hr NUIHARC IC Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.

FPB loss/potential loss: N/A Mode Applicability:

Basis: The General Emergency values of Table 5.2 are based on the boundary dose resulting from an actual or imminent release of gaseous radioactivity that exceeds 1000 mR TEDE or 5000 mR CDE thyroid for the actual or projected duration of the release.The 1000 mR TEDE and the 5000 mR CDE thyroid integrated dose are based on the EPA protective action guidance which 5-21 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 indicates that public protective actions are indicated if the dose exceeds 1 rem TEDE or 5 rem CDE thyroid.This is consistent with the emergency class description for a General Emergency.

This level constitutes the upper level of the desirable gradient for the Site Area Emergency.

Actual meteorology is specifically identified since it gives the most accurate dose assessment.

Actual meteorology (including forecasts) should be used whenever possible.In establishing the dose rate emergency action levels, a duration of one hour is assumed.Therefore, the dose rate EALs are based on a site boundary dose rate of 1000 mR/hr TEDE or 5000 mR/hr CDE thyroid, whichever is more limiting.PEG

Reference:

AG1.3 AG1.4~Basis Reference(s):

2.3.4 Technical Specifications, Amendment No.24, Articles 3.9.1.1 thru 3.9.2.3 EPIP 2-3 Emergency Release Rate Determination P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment 5-22 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.1 Unusual Event Any sustained direct ARM readings>100 x alarm or offscale hi resulting from an uncontrolled process MMARC IC: Unexpected increase in plant radiation or airborne concentration.

FPB loss/potential loss: N/A Mode Applicability:

Basis: Valid elevated area radiation levels usually have long lead times relative to the potential for radiological release beyond the site boundary, thus impact to public health and safety is very low.It should be noted that the CAS and SAS do not have installed radiation monitors.Therefore, evaluation of this EAL would require survey of these areas.This EAL addresses unplanned increases in radiation levels inside the plant.These radiation levels represent a degradation in the control of radioactive material and a potential degradation in the level of safety of the plant.Area radiation levels above 100 times the alarm setpoint have been selected because they are readily identifiable on ARM instrumentation.

Since ARM setpoints are nominally set one decade over normal levels, 100 times the alarm setpoint provides an appropriate threshold for emergency classification.

For those ARMs whose upper range limit are less than 100 times the alarm setpoint, a value of offscale high is used.This EAL escalates to an Alert, if the increases impair the level of safe plant operation.

0 0 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AU2.4.Basis Reference(s):

None 5-24 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.2 Alert Sustained area radiation levels)15 ma/hr in either: Control Room OR Central Alarm Station and Secondary Alarm Station IVUMARC IC: Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses increased radiation levels that impede necessary access to operating stations requiring continuous occupancy to maintain safe plant operation or perform a safe plant shutdown.Areas requiring continuous occupancy include the Control Room, the central alarm station (CAS)and the secondary security alarm station (SAS).The security alarm stations are included in this EAL because of their importance to permitting access to areas required to assure safe plant operations.

The value of 15 mR/hr is derived from the GDC 19 value of 5 rem in 30 days with adjustment for expected occupancy times.Although Section III.D.3 of NUREG-0737,"Clarification of TMI Action Plan Requirements", provides that the 15 mR/hr value can be averaged over the 30 days, the value is used here without averaging.

A 30 day duration implies an event potentially more significant than an Alert.5-25 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant.The cause or magnitude of the increase in radiation levels is not a concern of this EAL.The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine if any other EALs may be involved.For example, a dose rate of 15 mR/hr in the Control Room may be a problem in itself.However, the increase may also be indicative of high dose rates in the containment due to a LOCA.In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.

This EAL is not intended to apply to anticipated temporary radiation increases due to planned events (e.g., radwaste container movement, depleted resin transfers, etc.).PEG

Reference:

AA3.1 Basis Reference(s):

1.GDC 19 2.NUREG-0737,"Clari6cation of TMI Action Plan Requirements",Section III.D.3 3.P-9 Radiation Monitoring System Rev.67 5-26 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release/Area Radiation 5.3 Area Radiation Levels 5.3.3 Alert Sustained abnor mal area radiation levels>8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.Table 5.3 Plant Areas~Reactor Containment Building~Auxiliary Building~Turbine Building~Emergency Diesel Building~Screen House~Standby Auxiliary Feedwater Building NUMARC IC: Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses increased radiation levels in areas requiring infrequent access in order to maintain safe plant operation or perform a safe plant shutdown.Area radiation levels at or above 8 H/hr are indicative of radiation fields which may limit personnel access or adversely affect equipment whose operation may be needed to assure adequate core cooling or shutdown the reactor.The basis of the value is described in NMPC memo File Code 5-27 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NMP31027"Exposure Guidelines For Unusual/Accident Conditions".

The areas selected are consistent with those listed in other EALs and represent those structures which house systems and equipment necessary for the safe operation and shutdown of the plant.It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant.The cause or magnitude of the increase in radiation levels is not a concern of this EAL.The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine if any other EAL may be involved.For example, a dose rate of 8 R/hr may be a problem in itself.However, the increase may also be indicative of high dose rates in the containment due to a LOCA.In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.

This EAL is not meant to apply to increases in the containment radiation monitors as these are events which are addressed in other EALs.Nor is it intended to apply to anticipated temporary radiation increases due to planned events (e.g., radwaste container movement, deplete resin transfers, etc.).PEG

Reference:

AA3.2 Basis Reference(s):

1.Niagara Mohawk Power Corporation memo File Code NMP31027"Exposure Guidelines For UnusuaVAccident Conditions", Revision 1, 3/18/93 5-28 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Loss of vital plant electrical power can compromise plant safety system operability including decay heat removal and emergency core cooling systems which may be necessary to ensure fission product barrier integrity.

The events of this category have been grouped into the following two loss of electrical power types: A P r'his category includes losses of onsite and/or o6'site AC power sources including station blackout events.fD P r'his category involves total losses of vital plant 125 vdc power sources.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.1 Unusual Event 6.1 Loss of AC Power Sources Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for>15 min.NUINARC IC: Loss of all offsite power to essential busses for greater than 15 minutes.FPB loss/potential loss: N/A Mode Applicability:

Basis: Prolonged loss of all oFsite AC power reduces required redundancy and potentially degrades the level of safety of the plant by rendering the plant more vulnerable to a complete loss of AC power (station blackout).

Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.PEG

Reference:

SU1.1 Basis Reference(s):

1.RGE-6"4160V Electrical Distribution System" 2.RGE-7"480V Distribution

"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.2 Alert Loss of'all safeguards bus AC power for>15 min.NUlKARC IC: Loss of all offsite power and loss of all onsite AC power to essential busses during cold shutdown, refueling or defueled mode.FPB loss/potential loss: N/A Mode Applicability:

Cold Shutdown, Refueling, Defueled Basis: Loss of all AC power compromises all plant safety systems requiring electric power.This EAL is indicated by: loss of all o6'site AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes.When in cold shutdown, refueling, or defueled mode the event can be classified as an Alert, because of the signi6cantly reduced decay heat, lower temperature and pressure, increasing the time to restore one of the emergency busses, relative to that speci6ed for the Site Area Emergency EAL.Escalating to the Site Area Emergency, if appropriate, is by Abnormal Rad Levels/Radiological EfHuent, or Emergency Coordinator Judgment ICs.Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.PEG

Reference:

SA1.1 Basis Reference(s):

1.RGE-6"4160V Electrical Distribution System" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.3 Alert 6.1 Loss of AC Power Sources Available safeguard train AC power reduced to only one of the following for>15 min.:~EDG 1A (14/18)~EDG 1B (16/17)~Station Auxiliary Transformer 12A~Station Auxiliary Transformer 12B 1%JMARC IC: AC power capability to essential busses reduced to a single power source for greater than 15 minutes such that any additional single failure would result in station blackout with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: The condition indicated by this EAL is the degradation of the offsite power with a concurrent failure of one emergency generator to supply power to its emergency busses.Another related condition could be the loss of all oFsite power and loss of onsite emergency diesels with only one train of emergency busses being fed from the unit main generator, or the loss of onsite emergency diesels with only one train of emergency busses being fed from offsite power.The subsequent loss of this single power source would escalate the event to a Site Area Emergency.

PEG

Reference:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.RGE-6"4160V Electrical Distribution" 2.RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.4 Site Area Emergency Loss of all safeguards bus AC power for>15 min.NUINARC IC: Loss of all offsite power and loss of all onsite AC power to essential busses with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: Loss of all AC power compromises all plant safety systems requiring electric power.This EAL is indicated by: loss of all offsite AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes.Prolonged loss of all AC power will cause core uncovery and loss of containment integrity, thus this event can escalate to a General Emergency.

The time duration should be selected to exclude transient or momentary power losses, but should not exceed 15 minutes.PEG

Reference:

SS1.1 Basis Reference(s):

1.RGE-6"4160V Electrical Distribution" 2.RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1.5 General Emergency 6.1 Loss of AC Power Sources Loss of all safeguards bus AC power AND either: Power restoration to any safeguards bus is not likely in 5 4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2,"CORE COOLING" NUMARC IC: Prolonged loss of all offsite power and prolonged loss of all onsite AC power with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: Loss of all AC power compromises all plant safety systems requiring electric power.Prolonged loss of all AC power will lead to loss of fuel clad, RCS, and containment.

Although this EAL may be viewed as redundant to the RPV Water Level EALs, its inclusion is necessary to better assure timely recognition and emergency response.This EAL is specified to assure that in the unlikely event of prolonged station blackout, timely recognition of the seriousness of the event occurs and that declaration of a General Emergency occurs as early as is appropriate, based on a reasonable assessment of the event trajectory.

The likelihood of restoring at least one emergency bus should be based on a realistic appraisal of the situation since a delay in an upgrade decision based on only a chance of mitigating the event could result in a loss of valuable time in preparing and implementing public protective actions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 In addition, under these conditions, fission product barrier monitoring capability may be degraded.Although it may be difBcult to predict when power can be restored, the Emergency Coordinator should declare a General Emergency based on two major considerations:

1.Are there any present indications that core cooling is already degraded to the point that Loss or Potential Loss of fission product barriers is imminent?2.If there are no present indications of such core cooling degradation, how likely is it that power can be restored in time to assure that a loss of two barriers with a potential loss of the third barrier can be prevented?

Thus, indication of continuing core cooling degradation must be based on fission product barrier monitoring with particular emphasis on Emergency Coordinator judgment as it relates to imminent loss or potential loss of fission product barriers and degraded ability to monitor fission product barriers.The time to restore AC power is based on site blackout coping analysis performed in conformance with 10CFR50.63 and Regulatory Guide 1.155,"Station Blackout", with appropriate allowance for offsite emergency response.PEG

Reference:

SG1.1 Basis Reference(s):

1.2.3.4 F-0.2,"CORE COOLING," NRC letter to Dr.Mecredy dated V30/92"RE Ginna Nuclear Power Plant Station Blackout Analysis (TAC M68548)RGE-6"4160v Electrical Distribution System" RGE-7"480v Distribution" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2.1 Unusual Event 6.2 Loss of DC Power Sources<105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for>15 min.MMARC IC: Unplanned loss of required DC power during cold shutdown or refueling mode for greater than 15 minutes.FPB loss/potential loss: N/A Mode Applicability:

Cold Shutdown, Refueling Basis: The purpose of this EAL is to recognize a loss of DC power compromising the ability to monitor and control the removal of decay heat during cold shutdown or refueling operations.

This EAL is intended to be anticipatory in as much as the operating crew may not have necessary indication and control of equipment needed to respond to the loss.The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment.

This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.PEG

Reference:

SU7.1 Basis Reference(s):

1.RGE-9"Instrument Bus and DC Power System" OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2.2 Site Area Emergency 6.2 Loss of DC Power Sources>105 vdc bus voltage indications on 125 vdc batteries 1A and 1B.for>15 min.NUINARC IC: Loss of all vital DC power with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: Loss of all DC power compromises ability to monitor and control plant safety functions.

Prolonged loss of all DC power will cause core uncovering and loss of containment integrity when there is significant decay heat and sensible heat in the reactor system.Escalation to a General Emergency would occur by other EAL categories.

Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment.

This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.PEG

Reference:

SS3.1 Basis Reference(s):

1.RGE-9"Instrument Bus and DC Power System" 6-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Numerous plant system related equipment failure events which warrant emergency classification, based upon their potential to pose actual or potential threats to plant safety, have been identified in this category.The events of this category have been grouped into the following event types: T'Only one EAL falls under this event type related to the failure of the plant to be brought to the required plant operating condition required by technical specifications.

m il r r n r 1 m v i n This category includes events which are indicative of losses of operability of safety systems such as ECCS, isolation functions, Control Room habitability or cold and hot shutdown capabilities.

fn'nA1 nli Certain events which degrade the plant operators ability to effectively assess plant conditions or communicate with essential personnel within or external to the plant warrant emergency classification.

Under this event type are losses of annunciators and/or communication equipment.

7-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.1 Technical Speci6cation Requirements

7.1.1 Unusual'Event

Plant is not brought to required operating mode within Technical Specifications LCO Action Statement Time.1%UAIARC IC: Inability to reach required shutdown within Technical Specification Limits.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: Limiting Conditions of Operation (LCOs)require the plant to be brought to a required shutdown mode when the Technical Specification required configuration cannot be restored.Depending on the circumstances, this may or may not be an emergency or precursor to a more severe condition.

In any case, the initiation of plant shutdown required by the site Technical Specification requires a one hour report under 10CFR50.72 (b)non-emergency events.The plant is within its safety envelope when being shut down within the allowable action statement time in the Technical Specifications.

An immediate Notification of an Unusual Event is required when the plant is not brought to the required operating mode within the allowable action statement time in the Technical Specifications.

Declaration of an Unusual Event is based on the time at which the LCO-specified action statement time period elapses under the site Technical Specifications and is not related to how long a condition may have existed.Other required Technical Specification shutdowns that involve precursors to more serious events are addressed by other EALs.7-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

SU2.1 Basis Reference(s):

1.Technical Specifications Section 3.0 7-3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.1 Unusual Event Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.NUMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:

Power Operation, hot shutdown Basis: This EAL is intended to address main turbine rotating component failures of suf6cient magnitude to cause observable damage to the turbine casing or to the seals of the turbine generator.

Of major concern is the potential for leakage of combustible fluids (lubricating oils)and gases (hydrogen cooling)to the plant environs.Actual fires and flammable gas build up are appropriately classified through other EALs.This EAL is consistent with the definition of an Unusual Event while maintaining the anticipatory nature desired and recognizing the risk to non-safety related equipment.

PEG

Reference:

HU1.6 Basis Reference(s):

None 7-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.2 Alert Turbine failure generated missiles result in any visible structural damage to plant vital equipment NUINARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Power Operations, Hot Shutdown Basis: This EAL addresses the threat to safety related equipment imposed by missiles generated by main turbine rotating component failures.The involved equipment includes safety-related equipment, their controls, and their power supplies.This EAL is consistent with the definition of an ALERT in that, if missiles have damaged or penetrated areas containing safety-related equipment, the potential exists for substantial degradation of the level of safety of the plant.PEG

Reference:

HA1.6 Basis Reference(s):

None 7-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.3 Alert Entry into AP-CR.1"Control Room Inaccessability" MMARC IC: Control room evacuation has been initiated.

FPB loss/potential loss: N/A Mode Applicability:

All Basis: With the Control Room evacuated, additional support, monitoring and direction through the Technical Support Center and/or other emergency operations center is necessary.

Inability to establish plant control from outside the Control Room will escalate this event to a Site Area Emergency.

PEG

Reference:

HA5.1 Basis Reference(s):

1.AP-CR.1 Control Room Inaccessibility 7-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 1 7.2 System Failures or Control Room Evacuation 7.2.4 Alert Reactor coolant temperature cannot be maintained

<200'F NUINARC IC: Inability to maintain plant in cold shutdown.FPB loss/potential loss: N/A Mode Applicability:

Cold Shutdown, Refueling Basis: h This EAL addresses complete loss of functions required for core cooling during refueling and cold shutdown modes.Escalation to Site Area Emergency or General Emergency would be through other EALs.A reactor coolant temperature increase that approaches or exceeds the cold shutdown technical specification limit warrants declaration of an Alert irrespective of the availability of technical specification required functions to maintain cold shutdown.The concern of this EAL is the loss of ability to maintain the plant in cold shutdown which is defined by reactor coolant temperature and not the operability of equipment which supports removal of heat from the reactor.PEG

Reference:

SA3.1 7-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.AP-RHR.1"Loss of RHR" 2.Technical Specifications Section 1.2 3, AP-RHR-2"Loss of RHR While Operating at Reduced RCS Inventory Conditions" 7-8 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.5 Site Area Emergency Control Room evacuation AND Core cooling cannot be established per AP-CR.1"Control Room Inaccessibility" in~20 min.MJMARC IC: Control room evacuation has been initiated and control of core cooling cannot be established.

FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL indicates that expeditious transfer of safety systems has not occurred but fission product barrier damage may not yet be indicated.

The time interval for transfer is based on analysis or assessments as to how quickly control must be reestablished without core uncovering and/or core damage.The design criteria for the remote shutdown equipment specifies that control of safety systems must be able to be achieved without resulting in core uncovery or core damage.REGNPS Appendix R submittal indicates 20 minutes is the maximum time for which control of plant safety systems should occur under worst case conditions.

Therefore, 20 minutes is within the design criteria of the remote shutdown equipment.

In cold shutdown and refueling modes, operator concern is directed toward maintaining core cooling such as is discussed in Generic Letter 88-17,"Loss of Decay Heat Removal." In power operation, and hot shutdown modes, operator concern is primarily directed toward maintaining critical safety functions and thereby assuring fission product barrie'r integrity.

7-9 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HS2.1 Basis Reference(s):

1.AP-CR.1 Control Room Inaccessibility 2.Appendix R Section 6.4.5 page 6-35 3.Generic Letter 88-17,"Loss of Decay Heat Removal." 7-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications

/Alarms/Communication Capability 7.3.1 Unusual Event Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation Table 7.3 Vital Control Room Panels A AA B C D E F 0 NUINARC IC: Unplanned loss of most or all safety system annunciation or indication in the control room for greater than 15 minutes with reactor coolant temperature

>2OO'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: This EAL recognizes the difhculty associated with monitoring changing plant conditions without the use of a major portion of the annunciation or indication equipment.

Recognition of the availability of computer based indication equipment is considered (PPCS and SAS)."Unplanned" loss of annunciators or indicators excludes scheduled maintenance and testing activities.

It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use of judgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions.

This judgment 7-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 is supported by the specific opinion of the Shik Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to, safely operate the plant.It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is included in this EAL due to difficulty associated with assessment of plant conditions.

The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status.This will be addressed by their specific Technical Specification.

The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.

If the shutdown is not in compliance with the Technical Specification action, the Unusual Event is based on EAL 7.1.1, Inability to Reach Required Shutdown Within Technical Specification Limits.Annunciators or indicators for this EAL must include those identified in the Abnormal Operating procedures, in the Emergency Operating Procedures, and in other EALs (e.g., area, process, and/or effluent rad monitors, etc.).Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.Due to the limited number of safety systems in operation during cold shutdown, refueling, and defueled modes, this EAL is not applicable during these modes of operation.

This Unusual Event will be escalated to an Alert if a transient is in progress during the loss of annunciation or indication.

PEG

Reference:

SU3.1 Basis Reference(s):

None 7-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications

/Alarms/Communication Capability 7.3.2 Unusual Event Loss of all communications capability affecting the ability to either: Perform routine operations OR Notify offsite agencies or personnel NUMARC IC: Unplanned loss of all onsite or offsite communications capabilities.

FPB loss/potential loss:~N/A Mode Applicability:

Basis: The purpose of this EAL is to recognize a loss of communications capability that either defeats the plant operations staff ability to perform routine tasks necessary for plant ope'rations or the ability to communicate problems with offsite authorities.

The loss of offsite communications ability is expected to be significantly more comprehensive than the condition addressed by 10CFR50.72.

The onsite communications loss must encompass the loss of all means of routine communications (i.e., phones, sound powered phone systems, page party system, and'radios/walkie talkies).The offsite communications loss must encompass the loss of all means of communications with offsite authorities.

This should include ENS, Bell lines, FAX transmissions, and dedicated phone systems.This EAL is intended to be used only when extraordinary means are being utilized to make communications possible (relaying of information from radio transmissions, individuals being sent to offsite locations, etc.).7-13 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1.PEG

Reference:

SU6.1 Basis Reference(s):

1.A-56,"Communication Systems at Ginna Station" 7-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications

/Alarms/Communication Capability 7.3.3 Alert Unplanned loss of annunciators or indications on any Control Room Panels,.Table 7.3 for>15 min.AND Increased surveillance is required for safe plant operation AND either: A plant transient in progress OR PPCS and SAS are unavailable Table 7.3 Vital Control Room Panels AA B C D E F G NUMARC IC: Unplanned loss of most or all safety system annunciation or indication in control room with either (1)a significant transient in progress, or (2)compensatory non-alarming indicators are unavailable with reactor coolant>200'F.FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: This EAL recognizes the difBculty associated with monitoring changing plant'onditions without the use of a major portion of the annunciation or indication equipment during a transient.

Recognition of the availability of computer based indication equipment is considered (PPCS, SAS, etc.)."Unplanned" loss of annunciators or indicators does not include scheduled maintenance and testing activities.

7-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use of judgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions.

This judgment is supported by the specific opinion of the Shift Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to safely operate the plant.It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is Uicluded in this EAL due to difFiculty associated with assessment of plant conditions.

The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status, This will be addressed by the specific Technical Specification.

The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.

Annunciators or indicators for this EAL includes those identified in the Abnormal Operating Procedures, in the Emergency Operating Procedures, and in other EALs (e.g., area, process, and/or effluent rad monitors, etc.)."Significant transient" includes response to automatic or manually initiated functions such as trips, runbacks involving greater than 25%thermal power change, ECCS injections, or thermal power oscillations of 10%or greater.If both a major portion of the annunciation system and all computer monitoring are unavailable to the extent that the additional operating personnel are required to monitor indications, the Alert is required.Due to the limited number of safety systems in operation during cold shutdown, refueling and defueled modes, no EAL is indicated during these modes of operation.

This Alert will be escalated to a Site Area Emergency if the operating crew cannot monitor the transient in progress, PEG

Reference:

SA4.1 Basis Reference(s):

None 7-16 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications

/Alarms/Communication Capability 7.3.4 Site Area Emergency Loss of annunciators or indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Table 7.3 Vital Control Room Panels A AA B C D E'G NUIKARC IC: Inability to monitor a significant transient in progress with reactor coolant>200 DF FPB loss/potential loss: N/A Mode Applicability:

Power operation, hot shutdown Basis: This EAL recognizes the inability of the Control Room staff to monitor the plant response to a transient.

A Site Area Emergency is considered to exist if the Control Room staff cannot monitor safety functions needed for protection of the public.Annunciators for this EAL should be limited to include those identified in the Abnormal Operating Procedures, in the CSFST's and Emergency Operating Procedures, and in other EALs (e.g., rad"monitors, etc.)."Significant transient" includes response to automatic or manually initiated functions such as scrams, runbacks involving greater than 25 lo thermal 7-17 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 power change, ECCS injections, or thermal power oscillations of 10%or greater.Indications needed to monitor critical safety functions necessary for'rotection of the public must include Control Room indications, computer generated indications and dedicated annunciation capability.

The specific indications should be those used to determine such functions as the ability to shut down the reactor, maintain the core cooled and in a eoolable geometry, to remove heat from the core, to maintain the reactor coolant system intact, and to maintain containment intact."Planned" actions are excluded from the EAL since the loss of instrumentation of this magnitude is of such significance during a transient that the cause of the loss is not an ameliorating factor.PEG

Reference:

SS6.1 Basis Reference(s):

None 7-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Hazards are those non-plant system related events which can directly or indirectly impact plant operation or reactor plant and personnel safety.The events of this category have been grouped into the following types: PM tgp ld t*d tp t p into the Protected Area as well as bomb threats and sabotage attempts.Also addressed are actual security compromises threatening loss of physical control of the plant.Pl p lg ll tt*d t p l d reactor safety.Appropriate for classification are fires within the site Protected Area or which may affect operability of vital equipment.

E M-d t tg-t Ml occurring events which can cause damage to plant facilities such as aircraft crashes, missile impacts, toxic or flammable gas leaks or explosions from whatever source.E t t', tqd d which have potential to cause damage to plant structures or equipment significant enough to threaten personnel or plant safety.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.1 Unusual Event 8.1 Security Threats Bomb device or other indication of attempted sabotage discovered within plant Protected Area.OR Any security event which represents a potential degradation in the level of safety of the plant.MMARC IC: Confirmed security event which indicates a potential degradation in the level of safety of the plant.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL is based on the REGNPS Security Contingency Plan.Security events which do not represent at least a potential degradation in the level of safety of the plant, are reported under 10CFR73.71 or in some cases under 10CFR50.72, The plant Protected Area boundary is within the security isolation zone and is defined in the security plan.Bomb devices discovered within the plant vital area would result in EAL escalation.

PEG

Reference:

HU4.1 HU4.2 Basis Reference(s):

1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.2 Alert 8.1 Security Threats Intrusion into plant Protected Area by an adversary.

OR Any security event which represents an actual substantial degradation of the level of safety of the plant.MMARC IC: Security event in a plant protected area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This class of security events represents an escalated threat to plant safety above that contained in the Unusual Event, For the purposes of this EAL, the intrusion by unauth'orized personnel inside the Protected Area boundary can be considered a significant security threat.Intrusion into a vital area by unauthorized personnel will escalate this event to a Site Area Emergency.

PEG

Reference:

HA4.1 HA4.2 Basis Reference(s):

1.REGNPS Security Contingency Plan 8.3 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.3 Site Area Emergency 8.1 Security Threats.Intrusion into a plant security vital area by an adversary.

OR Any security event which represents actual or likely failures of plant systems needed to protect the public.MMARC IC: Security event in a plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This class of security events represents an escalated threat to plant safety above that contained in the Alert in that unauthorized personnel have progressed from the Protected Area to the vital area.PEG

Reference:

HS1.1 HS1.2 Basis Reference(s):

1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1.4 General Emergency 8.1 Security Threats Security event which results in: Loss of plant control from the Control Room OR Loss of remote shutdown capability NUMARC IC Security event resulting in loss of ability to reach and maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL encompasses conditions under which unauthorized personnel have taken physical control of vital areas required to reach and maintain safe shutdown.PEG

Reference:

HG1.1 HG1.2 Basis Reference(s):

1.REGNPS Security Contingency Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1~8.0 Hazards 8.2.1 Unusual Event 8.2 Fire or Explosion Confirmed fire in any plant area, Table 8.2 or 8.3 not extinguished in<15 min.of Control Room notification:

Table 8.2 Plant Areas~Turbine Building~TSC Service Building~Contaminated Storage Building Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUIYIARC IC Fire within protected area boundary not extinguished within 15 minutes of detection.

FPB loss/potential loss: N/A Mode Applicability:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis: The purpose of this EAL is to address the magnitude and extent of fires that may be potentially significant precursors to damage to safety systems.This excludes such items as fires within administration buildings, waste-basket fires, and other small fires of no safety consequence.

PEG

Reference:

HU2.1 Basis Reference(s):

1.Site Plot Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.2.2 Alert 8.2 Fire or Explosion Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:~visible damage to plant equipment or structures needed for safe plant operation OR~which affects safety system operability as indicated by degraded system performance Table 8.2 Plant Areas~Turbine Building~TSC~Service Building~Contaminated Storage Building Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUIKARC IC: Fire or explosion affecting the operability of plant safety systems required to establish or maintain safe shutdown.FPB loss/potential loss: N/A Mode Applicability:

All OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis: The listed areas contain functions and systems required for the safe shutdown of the plant.The REGNPS safe shutdown analysis was consulted for equipment and plant areas required for the applicable mode.With regard to explosions, only those explosions of suQicient force to damage permanent structures or equipment required for safe operation, or which results in degraded performance of safety systems within the identified plant areas should be considered.

As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to nearby structures and materials.

No attempt is made in this EAL to assess the actual magnitude of the damage.The wording of this EAL does not imply that an assessment of safety system performance is intended to be performed, rather that as a result of the event, safety system parameter symptoms are degraded as a result of the event.The declaration of an Alert and the activation of the TSC will provide the Emergency Coordinator with the resources needed to perform damage assessments.

The Emergency Coordinator also needs to consider any security aspects of the explosions.

PEG

Reference:

HA2.1 Basis Reference(s):

1.Site Plot Plan OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.1 Unusual Event 8.3 Man-Made Events Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary NUIKARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A~Mode Applicability:

Basis: The Protected Area boundary is within the security isolation zone and is defined in the site security plan.This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of other projectiles that may potentially damage plant structures containing functions and systems required for safe shutdown of the plant.If the crash is confirmed to affect a plant vital area, the event may be escalated to Alert.PEG

Reference:

HU1.4 Basis Reference(s):

1.Site Plot Plan 8-10 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.2 Unusual Event 8.3 Man-Made Events Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment NUINARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:

Basis: The Protected Area boundary is within the security isolation zone and is defined in the site security plan.For this EAL, only those explosions of sufBcient force to damage permanent structures or equipment within the Protected Area should be considered.

As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to near by structures and materials.

No attempt is made in this EAL to assess the actual magnitude of the damage.The occurrence of the explosion with reports of evidence of damage (e.g., deformation, scorching) is sufficient for declaration.

The Emergency Coordinator also needs to consider any security aspects of the explosion.

PEG

Reference:

HU1.5 Basis Reference(s):

1.Site Plot Plan 8-11 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.3 Unusual Event 8.3 Man-Made Events Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could afFect the~health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event NUMARC IC: Release of toxic or flammable gases deemed detrimental to safe operation of the plant.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL is based on releases in concentrations within the site boundary that=will afFect the health of plant personnel or afFecting the safe operation of the plant with the plant being within the evacuation area of an ofFsite event (i.e., tanker truck accident releasing toxic gases, etc.).The evacuation area is as determined from the DOT Evacuation Tables for Selected Hazardous Materials, in the DOT Emergency Response Guide for Hazardous Materials.

Should an explosion occur within a specified plant area, an Alert would be declared based on EAL 8.2.2., PEG

Reference:

HU3.1 HU3.2 8-12 OSSI-92-402A-4-REG Ginna EAL Technical Bases DocumentRev 1 Basis Reference(s):

None 8-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.4 Alert 8.3 Man-Made Events Vehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House NUINARC IC: Natural and destructive phenomena afFecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.

No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of projectiles into a plant vital area.8-14 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HA1.5 Basis Reference(s):

None 8-15 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3.5 Alert 8.3 Man-Made Events Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Release of toxic or flammable gases within a facility structure which jeopardizes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL is based on gases that have entered a plant structure precluding access to equipment necessary for the safe operation of the plant.This EAL applies to buildings and areas contiguous to plant vital areas or other significant buildings or areas.The intent of this EAL is not to include buildings (i.e., warehouses) or other areas that are not contiguous or immediately adjacent to plant vital areas.It is appropriate that increased monitoring be done to ascertain whether consequential damage has occurred.8-16 OSSI-92-402A-4-REG Ginna EAL Tech'nical Bases Document, Rev 1 PEG

Reference:

HA3.1 HA3.2 Basis Reference(s):

None 8-17 OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.1 Unusual Event 8.4 Natural Events Earthquake felt inplant by any operator AND Confirmation of earthquake of an intensity)0.01 g per SC-5"Earthquake Emergency Plan".MMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:

Basis: REGNPS seismic instrumentation actuates at 0.01 g.Damage to some portions of the site may occur but it should not affect ability of safety functions to operate.Methods of detection can be based on instrumentation validated by a reliable source, operator assessment, or indication received from outside agencies.As de6ned in the EPRI-sponsored"Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989, a"felt earthquake" is: "An earthquake of suQicient intensity such that: (a)the inventory ground motion is felt at the nuclear plant site and recognized as an earthquake based on a consensus of Control Room operators on duty at the time, and (b)for plants with operable seismic instrumentation, the seismic switches of the plant are activated.

For most plants with seismic instrumentation, the seismic switches are set at an acceleration of about 0.01 g." PEG

Reference:

HU1.1 8-18 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.SC-5 Earthquake Emergency Plan 2.EPRI document,"Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989 8-19 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.2 Unusual Event Report by plant personnel of tornado within plant Protected Area boundary M;5hVKC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL is based on the assumption that a tornado striking (touching down)within the Protected Area boundary may have potentially damaged plant structures containing functions or systems required for safe shutdown of the plant.If such damage is con6rmed visually or by other in-plant indications, the event may be escalated to Alert.PEG

Reference:

HU1.2 Basis Reference(s):

None 8-20 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.3 Unusual Event 8.4 Natural Events Deer Creek flooding over entrance road bridge (hand rail)OR Lake level>252 ft OR Screen House Suction Bay water level<15 ft (low-low level alarm)MMARC IC: Natural and destructive phenomena affecting the protected area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This covers high and low lake water level conditions that could be precursors of more serious events.Deer creek flooding over entrance road bridge may preclude emergency response personnel access and egress.Lake water level>252 ft.corresponds to plant design levels.Screen House Suction Bay level<15 R.corresponds to the low-low level alarm point and which requires load reduction below 50%.PEG

Reference:

HU1.7 Basis Reference(s):

1.2.3.SC-4 High Water (Flood)Emergency Plan SC-4.1 Low Screenhouse Water Level Interoffice Memo" Screenhouse Pump Bay Water Level" dated V24/94 to Terry White from William Rapin and Jeffrey Wayland 8-21 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.4 Alert 8.4 Natural Events Earthquake felt inplant by any plant operations personnel AND~Confirmation of earthquake of an intensity)0.08 g per SC-5"Earthquake Emergency Plan" NUIYGMC IC: Natural and destructive phenomena afFecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.

No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL is based on the FSAR design basis operating earthquake of 0.08 g.Seismic events of this magnitude can cause damage to plant safety functions.

PEG

Reference:

HAl.l Basis Reference(s):

1.SC-5"Earthquake Emergency Plan" 8-22

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.5 Alert 8.4 Natural Ev'ents Sustained winds>75 mph OR , Tornado strikes a plant vital area, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.

No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL is based on the FSAR assumed"severe environmental loading" condition of 75 mph.Wind loads of this magnitude can cause damage to safety functions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HA1.2 Basis Reference(s):

1.RGE FSAR Section 3.3.2.1.4 8-24 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.6 Alert 8.4 Natural Events Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 Table 8.3 Plant Vital Areas~Control Building~Reactor Containment Building~Auxiliary Building~Intermediate Building~Emergency Diesel Building~Standby Auxiliary Feedwater Building~Screen House MMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.

No attempt is made in this EAL to assess the actual magnitude of the damage.This EAL specifies areas in which structures containing systems and functions required for safe shutdown of the plant are located.8-25 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'PEG

Reference:

HA1.3 Basis Reference(s):

None 8-26 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4.V Alert 8.4 Natural Events Flood water accumulating on screen house operating floor OR'ake level>253 ft OR Screen House Suction Bay water level<13 ft NUMARC IC: Natural and destructive phenomena affecting the plant vital area.FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses events that may have resulted in a plant vital area being subjected to levels beyond design limits, and thus damage may be assumed to have occurred to plant safety systems.The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification.

No attempt is made in this EAL to assess the actual magnitude of the damage.This.EAL covers high and low lake water level conditions that exceed levels which threaten vital equipment.

Flood water accumulating on the screen house operating floor or lake levels>253 ft.corresponds to levels threatening vital equipment.

Screen House Suction Bay level<13 ft.corresponds to the level below which the motor driven firewater pump suction bowls are uncovered.

PEG

Reference:

HA1.7 8-27 OSSI-92-402A-4-REG'inna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1.SC-4 High Water (Flood)Emergency Plan 2.SC-4.1 Low Screenhouse Water Level 3.Interof6ce Memo" Screenhouse Pump Bay Water Level" dated 1/24/94 to Terry White from William Rapin and Jeffrey Wayland 8-28 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The EALs defined in categories 1.0 through 8.0 specify the predetermined symptoms or events which are indicative of emergency or potential emergency conditions, and which warrant classification.

While these EALs have been developed to address the full spectrum of possible emergency conditions which may warrant classification and subsequent implementation of the Emergency Plan, a provision for classification of emergencies based on operator/management experience and judgment is still necessary.

The EALs of this category provide the Shift Supervisor or Emergency Coordinator the latitude to classify emergency conditions consistent with the established classification criteria, based upon their judgment.9-1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.1 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.NUINARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Unusual Event emergency class.From a broad perspective, one area that may warrant Emergency Coordinator judgment is related to likely or actual breakdown of site specific event mitigating actions.Examples to consider include inadequate emergency response procedures, transient response either unexpected or not understood, failure or unavailability of emergency systems during an accident in excess of that assumed in accident analysis, or insufhcient availability of equipment and/or support personnel.

PEG

Reference:

HU1.3 HU5.1 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.2 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment,.Attachment A.NUbXARC IC: N/A FPB loss/potential loss: Containment loss/potential loss Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the containment barrier is lost or potentially lost.In addition, the inability to monitor, the barrier should also be incorporated in this EAL as a factor in Emergency Coordinator judgment that the barrier may be considered lost or potentially lost.PEG

Reference:

PCS.X Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.3 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.NMGLRC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:

Basis This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Alert emergency class.PEG

Reference:

HA6.1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.4 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to a loss or potential loss of either fuel clad or RCS barrier, Attachment A.NM4A'RC IC: N/A FPB loss/potential loss: Loss or potential loss of either fuel clad or RCS barrier Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the fuel clad or RCS barriers are lost or potentially lost.In addition, the inability to monitor the barriers should also be considered in this EAL as a factor in Emergency Coordinator judgment that the barriers may be considered lost or potentially lost.PEG

Reference:

FC7.1 RCS6.1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 OCher 9.1.5 Site Area Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public.Any releases are not expected to result in exposures which exceed EPA PAGs.NUMARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.

PEG

Reference:

HS3.1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Other 9.1.6 Site Area Emergency Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to either: Loss or potential loss of both fuel clad and RCS barrier, Attachment A OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attachment A NUIKARC IC: N/A FPB loss/potential loss: Loss or potential loss of both fuel clad and RCS barrier OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere.

Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.

PEG

Reference:

FC7.1 RCS6.1 PC8.1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0>>Other 9.1.7 General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential.for a large release of radioactive material in excess of EPA PAGs outside the site boundary.NUINARC IC: Emergency Director Judgment FPB loss/potential loss: N/A Mode Applicability:

Basis: This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the General Emergency class.Releases can reasonably be expected to exceed EPA PAG plume exposure levels outside the site boundary..PEG

Reference:

HG2.1 Basis Reference(s):

None OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.8 General Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attachment A.NUIKARC IC: N/A FPB loss/potential loss: Loss of any two fission product barriers and loss or potential loss of the third Mode Applicability:

Power operation, hot shutdown Basis: This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere.

Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for the General Emergency class.PEG

Reference:

FC7.1 HCS6.1 PC8.1 Basis Reference(s):

None 9-10 OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 ATTACHMENT A FISSION PRODUCT BARRIER LOSS 4 POTENTIAL LOSS INDICATORS Fission Product Barrier Loss/Potential Loss Matrix (Rose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)Potential Loss ,ORANGE path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Core Exit Thermocouple Readings>/00'F RVLIS 5 43%w/no RCPs running Emergency Coordinator Judgment RED path in F-0.2, CORE COOLING Coolant activity>300 Ii Ci/cc of 1-131 Core Exit Thermocouple Readings>1200'F Containment rad monitor reading>100 R/hr Letdown Monitor (R-9)reading>10 R/hr Emergency Coordinator Judgment Potential Loss RED path on F-0.4, INTEGRITY RED path on F-0.3, HEAT SINK Primaiy system leakage>46 gpm Emergency Coordinator Judgment RCS subcooling

<EOP Fig.MIN SUBCOOLING due to RCS leakage Unisolable secondary side line break with SG tube rupture as identified in E-3"Steam Generator Tube Rupture" Containment radiation monitor reading>10 R/hr Emergency Coordinator Judgment A-2 Fission Product Barrier Loss/Potential Loss Matrix+hose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)Potential Lose RED path F-0.5, CONTAINMENT Rapid uncontrolled decrease in Containment Pressure following initial increase Either: Core exit thermocouples

>1200'F OR Core exit thermocouples

>700'F with RVLIS<43%(no RCPs)AND Restoration procedures not effective within 15 minutes Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions, i.e.unexpected changes occur in these parameters that are not explainable due to operator actions or automatic system actions.Safety injection signal due to LOCA with<the minimum containment cooling safeguards equipment operating:

CNMT pressure<28 psig: 2 CNMT Recirc Fans CNMT pressure 228 psig: 2 CNMT Spray Pumps OR 2 CNMT Recirc Fans and 1 CNMT Spray Pump Either.CI or CVI isolation required and CI or CVI valve(s)not closed when required OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists Containment pressure 60 psig and increasing Release of secondary side to atmosphere with primary to secondary leakage greater than tech spec allowable of 0.1 CPM per steam generator h4%hydrogen concentration in containment Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR Cl or CVI valve(s)not closed when required which results in a radiological release pathway to the environment Containment radiation monitor reading>1000 R/hr Emergency Coordinator Judgment Emergency Coordinator Judgment A-3 ATTACHIVlENT B WORD LIST/DEFINITIONS OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Actuate To put into operation; to move to action;commonly used to refer to automated, multi-faceted operations."Actuate ECCS".Adversary As applied to security EALs, an individual whose intent is to commit sabotage, disrupt Station operations or otherwise commit a crime on station property.Events are in process or have occurred which involve an actual or potential substantial degradation of the level of safety of the plant.Any releases are expected to be limited to small fractions of the EPA Protective Action Guideline exposure levels.Available The state or condition of being ready and able to be used (placed into operation) to accomplish the stated (or implied)action or function.As applied to a system, this requires the operability of necessary support systems (electrical power supplies, cooling water, lubrication, etc.).Can/Cannot be determined

(</>)The current value or status of an identified parameter relative to that specified can/cannot be ascertained using all available indications (direct and indirect, singly or in combination).

Can/Cannot be maintained above/below (c/>)The value of the identified parameter(s) is/is not able to be kept above/below specified limits.This determination includes making an evaluation that considers both current and future system performance in relation to the current value and trend of the parameter(s).

Neither implies that the parameter must actually exceed the limit before the action is taken nor that the action must be taken before the limit is reached.B-2 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Can/Cannot be restored above/below (c/>)The value of the identified parameter(s) is/is not able to be returned to above/below speci6ed limits after having passed those limits.This determination includes making an evaluation that considers both current and future systems performances in relation to the current value and trend of the parameter(s).

Does not imply any specific time interval but does not permit prolonged operation beyond a limit without taking the specified action.As applied to loss of electrical power sources (ex.: Power cannot be restored to any vital bus in<4 hrs)the specified power source cannot be returned to service within the specified time.This determination includes making an evaluation that considers both current and future restoration capabilities.

Implies that the declaration should be made as soon as the determination is made that the power source cannot be restored within the specified time.Close To position a valve or damper so as to prevent flow of the process fluid.To make an electrical connection to supply power.Con6rm/Con6rmation To validate, through visual observation or physical inspection, that an assumed condition is as expected or required, without taking action to alter the"as found" configuration.

Control Take action, as necessary, to maintain the value of a specified parameter within applicable limits;to fix or adjust the time, amount, or rate of;to regulate or restrict.Decrease To become progressively less in size, amount, number, or intensity.

Discharge Removal of a fluid/gas&om a volume or system.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Enter To go into.Establish To perform actions necessary to meet a stated condition."Establish communication with the Control Room." Evacuate To remove the contents of;to remove personnel from an area.Exceeds To go or be beyond a stated or implied limit, measure, or degree.Exist To have being with respect to understood limitations or conditions.

Failure A state of inability to perform a normal function.General Emergency Events are in process or have occurred which involve actual or imminent substantial core degradation or melting with potential for loss of containment integrity.

Releases can be reasonably expected to exceed EPA Protective Action Guideline exposure levels oFsite for more than the immediate site area.Logic term which indicates that taking the action prescribed is contingent upon the current existence of the stated condition(s).

If the identi6ed conditions do not exist, the prescribed action is not to be taken and execution of operator a'ctions must proceed promptly in accordance with subsequent instructions.

B-4 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1'ncrease To become progressively greater in size, amount, number or intensity.

Indicate To point out or point to;to display the value of a process variable;to be a sign or symbol.Initiate The act of placing equipment or a system into service, either manually or automatically.

Activation of a function or protective feature (i.e.initiate a manual trip).Iajection The act of forcing a fluid into a volume or vessel.Inoperable Not able to perform it's intended function Intrusion The act of entering without authorization Failure of operability or lack of access to.Maintain Take action, as necessary, to keep the value of the specified parameter within the applicable limits.Monitor Observe and evaluate at a frequency sufBcient to remain apprised of the value, trend, and rate of change of the specified parameter.

B-5 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Notify To give notice of or report the occurrence of;to make known to;to inform specified personnel; to advise;to communicate; to contact;to relay.Open To position a valve or damper so as to allow flow of the process fluid.To break an electrical connection which removes a power supply from an electrical device.To make available for entry or passage by turning back, removing, or clearing away.Operable Able to perform it's intended function Perform To carry out an action;to accomplish; to aFect;to reach an objective.

Primary System The pipes, valves, and other equipment which connect directly to the reactor vessel or reactor coolant system such that a reduction in reactor coolant system pressure will effect a decrease in the steam or water being discharged through an unisolated break in the system.Remove To change the location or position of.Report To describe as being in a specific state.Require To demand as necessary or essential.

8-6 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Take the appropriate action requires to return the value of an identified parameter to within applicable limits.Rise Describes an increase in a parameter as the result of an operator or automatic action.Sample To perform an analysis on a specified media to determine its properties.

Shut down To perform operations necessary to cause equipment to cease or suspend operation; to stop."Shut down unnecessary equipment." Site Area Emergency Events are in process or have occurred which involve actual or likely major failures of plant functions needed for protection of the public.Any releases are not expected to result in exposure levels which exceed EPA Protective Action Guideline exposure levels except near the site boundary.Sustained Prolonged.

Not intermittent or of transitory nature TFlp To de-energize a pump or fan motor;to position a breaker so as to interrupt or prevent the flow of current in the associated circuit;to manually activate a semi-automatic feature.I To take action to cause shutdown of the reactor by rapidly inserting a control rod or control rods (PWR).8-7 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Uncontrolled An evolution lacking control but is not the result of operator action.Unplanned Not as an expected result of deliberate action.Until Indicates that the associated prescribed action is to proceed only so long as the identified condition does not exist.Unusual Event Events are in process or have occurred which indicate a potential degradation of the level of safety of the plant.No releases of radioactive material requiring offsite response or monitoring are expected unless further degradation of safety systems occurs.Valid Supported or corroborated on a sound basis.Vent To open an effluent (exhaust)flowpath from an enclosed volume;to reduce pressure in an enclosed volume.Verify To conGrm a condition and take action to establish that condition if required."Verify reactor trip, verify SI pumps running." B-8 f4)pi(i'I I l~'I<<->~a)A