ML17263A833: Difference between revisions

From kanterella
Jump to navigation Jump to search
(Created page by program invented by StriderTol)
 
(Created page by program invented by StriderTol)
 
(6 intermediate revisions by the same user not shown)
Line 17: Line 17:


=Text=
=Text=
{{#Wiki_filter:AttachmBllDNaw&#xc3;I0'oOMCl0'o'4Ul4QwO~DOOUMV-R.E.GinnaEmergencyActionLevelsAnnotatedClassificationCriteriaBasedonResponsetoNRCRAlsCategory1.0CSFSTStatusCategory2.0-ReactorFuelCategory3.0Category4.0Category5.0Category6.0Category7.0Category8.0Category9.0ReactorCoolantSystemContainmentRadioactivityReleaseElectricalFailuresEquipmentFailuresHazardsOther R.E.GinnaEmergencyActionLevelsProposedRevision19BasedonResponsetoNRCRAIsCategory1.0Category2.00Category3.0Category4.0Category5.0Category6.0Category7.0Category8.0Category9.0CSFSTStatusReactorFuelReactorCoolantSystemContainmentRadioactivityReleaseElecrticalFailuresEquipmentFailures-HazardsOther10/11/94 1.0CSFSTStatus1.1Subcriticality1.1.1Alert[SA2]ORANGEorREDpathF-0.1SUBCRITICALITYANDEmergencyborationisrequiredPowerOperations,HotShutdownCatego.0CSFSTStatus1.0CSFSTStatus12CoreCooling1.2.1SiteAreaEmergency[fpl/fl,rl][SS4]ORANGEorREDpathinF-0.2,CORECOOLINGPowerOperations,HotShutdown1.2.2GeneralEmergency[fl,rl,cpl]1.1.2SiteAreaEmergency[SS2]REDpathinF-0.1SUBCRITICALITYANDeither:EmergencyborationisinoperableORPowerrangenot<6%within15min.ofinitiationofemergencyborationPowerOperations,HotShutdownREDpathinF~-0.2,CORECOOLINGANDFunctionalrestorationproceduresnoteffectivewithin15min.PowerOperations,HotShutdown1.1.3GeneralEmergency[SG2]REDpathinF-0.1,SUBCRITICALITYANDActualorimminententryintoeither:REDpathinF-0.2,CORECOOLINGORREDpathinF-0.3,HEATSINKPowerOperations,HotShutdown1-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 1.0CSFSTStatus13HeatSink1.3.1SiteAreaEmergency[fpl,rpl][SS4]REDpathinF-0.3,HEATSINKPowerOperations,HotShutdownCatego.0CSFSTStatus1.0CSFSTStatus1.4Integrity1.4.1Alert[rpl]REDpathonF-0.4,INTEGRITYPowerOperations,HotShutdown1-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0CSFSTStatus1.0CSFSTStatus1.5Containment1.5.1GeneralEmergency[6,rl,cpl]REDpathF-0.5,CONTAINMENTresultingfromlossofreactorcoolantPowerOperations,HotShutdown1-4fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0ReactorFuel2.0ReactorFuel2.1CoolantActivity2.1.1UnusualEvent[SU4]Coolantsampleactivity:>100%%uoof84/EbarpCi/cctotalspecificactivityOR>0.2pCi/ccI-131equivalentandtheconditionsofTechnicalSpecifications3.1.4.3.bareexceededAll2.1.2Alert[0]Coolantactivity>300pCi/ccI-131equivalentPoweroperation,hotshutdown2.1.3SiteAreaEmergency[fi.rpl/rl]Coolantactivity>300pCi/ccI-131equivalentandanyofthefollowing:~REDpathonF-0.4,INTEGRITY~Primarysystemleakage>46gpm~RCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakage~ContainmentradiationmonitorR-29/R-30reading>10R/hrPoweroperation,hotshutdown2.0ReactorFuel2.2FailedFuelDetectors2.2.1UnusualEvent[SU4]LetdownLineMonitorR-9>2R/hrAll2.2.2AlertLetdownLineMonitorR-9>10R/hrPoweroperation,hotshutdown2.2.3SiteAreaEmergency[fl,rpl]LetdownLineMonitorR-9>10R/hrandanyofthefollowing:~REDpathonF-0.4,INTEGRITY~Primarysystemleakage>46gpm~RCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakage~Containment*radiationmonitorR-29/R-30reading>10R/hrPoweroperation,hotshutdown2-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0ReactorFuel2.0ReactorFuel2.3ContainmentRadiation2.3.1AlertContainmentradiationmonitorR-29/R-30reading>10R/hrPoweroperation,hotshutdown2.3.2SiteAreaEmergency[fl,rl]ContainmentradiationmonitorR-29/R-30reading>100R/hrPoweroperation,hotshutdown2.8.3GeneralEmergency[fl,rl,cpl]ContainmentradiationmonitorR-29/R-30reading>1000R/hr2.0ReactorFuel2.4RefuelingAccidentsorOtherRadiationMonitors2.4.1UnusualEvent[AU2]Spentfuelpool(reactorcavityduringrefueling)waterlevelcannotberestoredandmaintainedabovethespentfuelpoollowwaterlevelalarmsetpointAll2.4.2Alert[AA2]Con6rmedsustainedalarmonanyofthefollowingradiationmonitorsresultingfromanuncontrolledfuelhandlingprocess:~R-2ContainmentAreaMonitor~R-5SpentFuelPit~R-12ContainmentNobleGasPoweroperation,hotshutdown2.4.8Alert[AA2]ReportofvisualobservationofirradiatedfueluncoveredAll2-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot,lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0-ReactorCoolantSystem3.0ReactorCoolantSystem3.1RCSLeakage3.1.1UnusualEvent[SU5]3.0ReactorCoolantSystem3.2PrimarytoSecondaryLeakage3.2.1UnusualEvent[cl]Unidentifiedorpressureboundaryleakage>10gpmORIdentifiedleakage>25gpmPoweroperation,hotshutdown3.1.2Alert[rpl]Primarysystemleakage>46gpmPoweroperation,hotshutdownReleaseofsecondarysidetoatmospherewithprimarytosecondaryleakage>0.1gpmpersteamgeneratorPoweroperation,hotshutdown13.2.2SiteAreaEmergency[rpl,cl]Unisolablereleaseofsecondarysidetoatmospherewithprimarytosecondaryleakage>46gpmPoweroperation,hotshutdown3.1.3SiteAreaEmergency[fpl,rl][SS5]3.2.3SiteAreaEmergency[fl,cl]RVLIScannotbemaintained>43%withnoRCPsrunningORWiththereactorvesselheadremoved,itisreportedthatwaterlevelinthereactorvesselisdroppinginan.uncontrolledmannerandcoreuncoveryislikely.Releaseofsecondarysidetoatmospherewithprimarytosecondaryleakage>0.1gpmpersteamgeneratorANDEither:Coolantactivity>300pCi/ccofI-131ORLetdownLineMonitorR-9>108/hrAllPoweroperation,hotshutdown3-1fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0ReactorCoolantSystem3.0ReactorCoolantSystem3.3RCSSubcooling3.3.1Alert[rl]RCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakagePoweroperation,hotshutdown3-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category4.0Containment4.0Containment4.1ContainmentIntegrityStatus4.1.1UnusualEvent[cl]4.0Containment4.1ContainmentIntegrityStatus4.1.3SiteAreaEmergency[rl,cl]BothdoorsopenoncontainmentairlockORInabilitytoclosecontainmentpressurerelieforpurgevalveswhichresultsinaradiologicalreleasepathwaytotheenvironmentORCIorCVIvalve(s)notclosedwhenrequiredwhichresultsinaradiologicalreleasepathwaytotheenvironmentEither:CIorCVIvalve(s)notclosedwhenrequiredfollowingconfirmedLOCAORInabilitytoisolateanyprimarysystemdischargingoutsidecontainmentANDRadiologicalreleasepathwaytotheenvironmentexistsPoweroperation,hotshutdownPoweroperation,hotshutdown4.1.2SiteAreaEmergency[rl,cl]RapiduncontrolleddecreaseincontainmentpressurefollowinginitialincreaseORLossofprimarycoolantinsidecontainmentwithcontainmentpressureorsumplevelresponsenotconsistentwithLOCAconditionsPoweroperation,hotshutdown4.1.4GeneralEmergency[fl,rl,cpl]SafetyinjectionsignalduetoLOCAwithlessthanminimumoperablecontainmentheatremovalequipment,Table4.3ANDAnyindicatorsoffuelcladloss,Table4.1Poweroperation,hotshutdown4-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 0Category4.0Containment4.0Containment4.1ContainmentIntegrityStatus4.1.5GeneralEmergency[fpVfl,rl,cl]4.0Containment4.2SGTubeRupturew/SecondaryRelease4.2.1SiteAreaEmergency[rl,cl]Either:RapiduncontrolleddecreaseincontainmentpressurefollowinginitialincreaseORLossofprimarycoolantinsidecontainmentwithcontainmentpressureorsumplevelresponsenotconsistentwithLOCAconditionsANDAnyindicatorsoffuelcladdamage,Table4.2Poweroperation,hot'hutdown4.1.6GeneralEmergency[fpVfl,rl,cl]Either:CIorCVIvalve(s)notclosedwhenrequiredfollowingconfirmedLOCAORInabilitytoisolateanyprimarysystemdischargingoutsidecontainmentANDRadiologicalreleasepathwaytotheenvironmentexistsANDAnyindicatorsoffuelcladdamage,Table4.2UnisolablesecondarysidelinebreakwithSGtuberuptureasidentifiedinE-3"SteamGeneratorTubeRupture"Poweroperation,hotshutdown4.2.2GeneralEmergency[fpVfl,rl,cl]UnisolablesecondarysidelinebreakwithSGtuberuptureasidentifiedinE-3"SteamGeneratorTubeRupture"ANDAnyindicatorsoffuelcladdamage,Table4.2Poweroperation,hotshutdownPoweroperation,hotshutdown4-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 4.0Containment4.3CombustibleGasConcentrations4.3.1GeneralEmergencyIfl,rl,cpl]24%hydrogenconcentrationincontainmentPoweroperation,hotshutdownCatego.0ContainmentTable4.1FuelCladLossIndicators1.Coolantactivity>300pCi/ccofI-1312.ContainmentradmonitorR-29/R-30reading>100R/hr3.LetdownMonitorR-9reading>10R/hr4.REDpathinF-0.2,CORECOOLINGTable4.2FuelCladDamaeIndicators~ORANGEorREDpathinF-0.2,CORECOOLING~REDpathinF-0.3,HEATSINK~Coolantactivity>300pCi/ccofI-131~ContainmentradmonitorR-29/R-30reading>100H/hr~LetdownMonitorR-9reading>10R/hr<28psigN/A>28psigTable4.3MinimumOperableContainmentHeatRemovalEuimentCNMTPressureRecircFansOperableSprayPumpsReuired4-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category6.0RadioactivityRelease6.0RadioactivityRelease/AreaRadiation6.1EQluentMonitors6.1.1UnusualEvent[AU1]6.0RadioactivityRelease/AreaRadiation6.1EQluentMonitors6.1.4GeneralEmergency[AG1]AvalidreadingonanymonitorsTable5.1column"NUE"for>60min.unlesssampleanalysiscanconfirmreleaserates<2xtechnicalspecificationswithinthistimeperiod.AvalidreadingonanymonitorsTable5.1column"GE"for>15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"GE"withinthistimeperiod.AllAll6.1.2Alert[AA1]AvalidreadingonanymonitorsTable5.1column"Alert"for>15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"Alert"withinthistimeperiod.All6.1.3SiteAreaEmergency[AS1]AvalidreadingonanymonitorsTable5.1column"SAE"for>15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"SAE"withinthistimeperiod.All5-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoryo.0RadioactivityRelease6.0RadioactivityRelease/AreaRadiation6.0RadioactivityRelease/AreaRadiation6.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates6.2.1UnusualEvent[AU1]6.2.4SiteAreaEmergency[AS1]Confirmedsampleanalysesforgaseousorliquidreleaserates>2xtechnicalspecificationslimitsfor>60min.AllDoseprojectionsorfieldsurveysresultingfromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"SAE"atthesiteboundaryorbeyond.All6.2.2Alert[AA1]Confirmedsampleanalysesforgaseousorliquidreleaserates>200xtechnicalspecificationslimitsfor>15min.6.2.5GeneralEmergency[AG1]Doseprojectionsorfieldsurveysresultingfromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"GE"atthesiteboundaryorbeyond.All5.2.8Alert[AA1]Doseprojectionsorfieldsurveysresultingfromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"Alert"atthesiteboundaryorbeyond.All.Table5.3.PlantAreas~ReactorContainmentBuilding~AuxiliaryBuilding~TurbineBuilding~EmergencyDieselBuilding~ScreenHouse~StandbyAuxiliaryFeedwaterBuilding5-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoo.0RadioactivityRelease5.0RadioactivityRelease/AreaRadiation5.3AreaRadiationLevels5.3.1'UnusualEvent[AU2]AnysustaineddirectARMreadings>100xalarmoroAscalehiresultingfromanuncontrolledprocess5.3.2Alert[AA3]Sustainedarearadiationlevels>15mR/hrineither:ControlRoomORCentralAlarmStationandSecondaryAlarmStation5.3.3Alert[AA3]Sustainedabnormalarearadiationlevels>8R/hrwithinanyareas,Table5.3ANDAccessisrequiredtoestablishormaintaincoldshutdown.All5-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Categoryo.0RadioactivityReleaseMonitorTable5.1EfHuentMonitorClassificationThresholdsAlertGER-llR-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr.23.8mR/hrTable5.2DoseProection/Env.MeasurementClassificationThresholdsAlertGETEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hr100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr5-4fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0ElectricalFailures6.0ElectricalFailures6.1LossofACPowerSources6.1.1UnusualEvent[SUl]Lossofabilitytosupplypowertothesafeguardbusesfromoffsitecircuits751and767for>15min.All6.0ElectricalFailures6.1LossofACPowerSources6.1.4SiteAreaEmergency[SS1]LossofallsafeguardsbusACpowerfor>15min.Poweroperation,hotshutdown6.1.2Alert[SA1]6.1.6GeneralEmergency[SGl]6.1.3Alert[SA5]LossofallsafeguardsbusACpowerfor>15min.ColdShutdown,Refueling,DefueledLossofallsafeguardsbusACpowerANDeither:Powerrestorationtoanysafeguardsbusisnotlikelyin<4hrsORActualorimminententryintoORANGEorREDpathonF-0.2,"CORECOOLING"AvailablesafeguardtrainACpowerreducedtoonlyoneofthefollowingfor>15min.:~EDG1A(14/18)~EDG1B(16/17)~StationAuxiliaryTransformer12A~StationAuxiliaryTransformer12BPoweroperation,hotshutdownPoweroperation,hotshutdown6-1fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category6.0ElectricalFailures6.0ElectricalFailures6.2LossofDCPowerSources6.2.1UnusualEvent[SU7]<105vdcbusvoltageindicationson125vdcbatteries1Aand1Bfor>15min.ColdShutdown,Refueling6.2.2SiteAreaEmergency[SS3]>105vdcbusvoltageindicationson125vdcbatteries1Aand1Bfor>15min.Poweroperation,hotshutdown6-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category.0EquipmentFailures7.0EquipmentFailuresV.1TechnicalSpecification%Requirements7.1.1UnusualEvent[SU2]PlantisnotbroughttorequiredoperatingmodewithinTechnicalSpecificationsLCOAction-StatementTime.Poweroperation,hotshutdownV.OEquipmentFailuresV.2SystemFailuresorControlRoomEvacuation7.2.1UnusualEvent[HU1]Reportofmainturbinefailureresultingincasingpenetrationordamagetoturbinesealsorgeneratorseals.PowerOperationsV.2.2Alert[HA1]TurbinefailuregeneratedmissilesresultinanyvisiblestructuraldamagetoplantvitalequipmentPowerOperations,HotShutdown7.2.8Alert[HA5]EntryintoAP-CR.1"ControlRoomInaccessability"All7.2.4Alert[SA3]Reactorcoolanttemperaturecannotbemaintained<200'FColdShutdown,Refueling7-1fyl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0EquipmentFailuresV.OEquipmentFailures7.0EquipmentFailuresV.2SystemFailuresorControlRoomEvacuation7.3LossofIndications/Alarms/CommunicationCapabilityV.2.5SiteAreaEmergency[HS2]V.3.1UnusualEvent[SU3]ControlRoomevacuationANDCorecoolingcannotbeestablishedperAP-CR.1"ControlRoomInaccessibility"in<20min.AllUnplannedlossofannunciatorsorindicationsonanyControlRoomPanels,Table7.3for>15min.ANDIncreasedsurveillanceisrequiredforsafeplantoperationPoweroperation,hotshutdown7.3.2UnusualEvent[SU6]Lossofallcommunicationscapabilityaffectingtheabilitytoeither:PerformroutineoperationsORNotifyoffsiteagenciesorpersonnel7-2fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0.EquipmentFailuresV.OEquipmentFailuresV.3LossofIndications/Alarms/CommunicationCapabilityTable7.3VitalControlRoomPanelsV.3.3Alert[SA4]BCDEFGUnplannedlossofannunciatorsorindicationsonanyControlRoomPanels,Table7.3for>15min.ANDIncreasedsurveillanceisrequiredforsafeplantoperationANDeither:AplanttransientinprogressORPPCSandSASareunavailablePoweroperation,hotshutdownV.3.4SiteAreaEmergency[SS6]Lossofannunciatorsor'indicationsonanyControlRoomPanels,Table7.3ANDCompletelossofabilitytomonitorallcriticalsafetyfunctionstatusANDAplanttransientinprogressPoweroperation,hotshutdown7-3fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Catego.0Hazards8.0Hazards8.1SecurityThreats8.1.1UnusualEvent[HU4]8.0Hazards8.1SecurityThreats8.1.4GeneralEmergency[HG1]BombdeviceorotherindicationofattemptedsabotagediscoveredwithinplantProtectedArea.ORAnysecurityeventwhichrepresentsapotentialdegradationinthelevelofsafetyoftheplant.Securityeventwhichresultsin:LossofplantcontrolfromtheControlRoomORLossofremoteshutdowncapabilityAll8.1.2Alert[HA4]IntrusionintoplantProtectedAreabyanadversary.ORAnysecurityeventwhichrepresentsanactualsubstantialdegradationofthelevelofsafetyoftheplant.All8.1.3SiteAreaEmergency[HS1]Intrusionintoaplantsecurityvitalareabyanadversary.ORAnysecurityeventwhichrepresentsactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.All8-1fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Hazards8.0Hazards8.2FireorExplosion8.2.1UnusualEventDiU2]8.0Hazards8.3Man-MadeEvents8.3.1UnusualEventDiU1]Confirmedfireinanyplantarea,Table8.2orTable8.3notextinguishedin515min.ofControlRoomnotification:AllVehiclecrashintoorprojectilewhichimpactsplantstructuresorsystemswithinProtectedAreaboundaryAll8.2.2Alert[HA2]8.3.2UnusualEvent[HU1]Fireorexplosioninanyplantarea,Table8.2orTable8.3whichresultsinEITHER:~visibledamagetoplantequipmentorstructuresneededforsafeplantoperationOR~whichaffectssafetysystemoperabilityasindicatedbydegradedsystemperformanceReportbyplantpersonnelofanexplosionwithinProtectedAreaboundaryresultinginvisibledamagetopermanentstructuresorequipmentAll8.3.3UnusualEvent[HU3]ReportordetectionoftoxicorflammablegasesthatcouldenterorhaveenteredwithintheProtectedAreaboundaryinamountsthatcouldaffectthehealthofplantpersonnelorsafeplantoperationORReportbylocal,countyorstateofficialsforpotentialevacuationofsitepersonnelbasedonoffsiteeventAll8-2fpl-fuelcladpot.lossfl-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss Category8.0Hazards8.0Hazards8.3Man-MadeEvents8.3.4Alert[HA1]8.0Hazards8.4NaturalEvents8.4.1UnusualEvent[HU1]'ehiclecrashorprojectileimpactwhichprecludespersonnelaccesstoordamagesequipmentinplantvitalareas,Table8.3AllEarthquakefeltinplantbyanyoperatorANDIConfirmationofearthquakeofanintensity>0.01gperSC-5"EarthquakeEmergencyPlan".All8.3.5Alert[HA3]Reportordetectionoftoxicorflammablegaseswithinaplantarea,Table8.3,inconcentrationsthatwillbelifethreateningtoplantpersonnelorprecludeaccesstoequipmentneededforsafeplantoperation8.4.2UnusualEvent[HU1]ReportbyplantpersonneloftornadowithinplantProtectedAreaboundaryAll8.4.3UnusualEvent[HUl]DeerCreekfloodingoverentranceroadbridge(handrail)ORLakelevel>252ftORScreenHouseSuctionBaywaterlevel<15ft(low-lowlevelalarm)All8-3~fpl-fuelcladpot.loss6-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 8.0Hazards8.4NaturalEvents8.4.4Alert[HA1]Category.0Hazards8.0Hazards8.4NaturalEvents8.4.7Alert[HA1]EarthquakefeltinplantbyanyplantoperationspersonnelANDConfirmationofearthquakeofanintensity)0.08gperSC-5"EarthquakeEmergencyPlan"AllFloodwateraccumulatingonscreenhouseoperatingfloorORLakelevel>253ftI'RScreenHouseSuctionBaywaterlevel<13ftAll8.4.5Alert[HA1]Sustainedwinds>75mphORTornadostrikesaplantvitalarea,Table8.3All8.4.6Alert[HAl]Table8.2PlantAreas~TurbineBuilding~TSC~ServiceBuilding~ContaminatedStorageBuildingAnynaturaleventwhichresultsinareportofvisiblestructuraldamageorassessmentbyControlRoompersonnelofactualdamagetoequipmentneededforsafeplantoperation,Table8.3AllTable8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuildingAuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouse8-4fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 9.0Other9.1.1UnusualEventCategory9.0Other9.0Other9.1.3AlertAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadtoorhasledtoapotentialdegradationofthelevelofsafetyoftheplant.Anyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldcauseorhascausedactualsubstantialdegradationofthelevelofsafetyoftheplant.AIl9.1.2UnusualEvent9.1.4AlertAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadtoorhasledtoalossorpotentiallossofcontainment,Attach.A.Poweroperation,hotshutdownAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadorhasledtoa,lossorpotentiallossofeitherfuelcladorRCSbarrier,Attach.A.Poweroperation,hotshutdown9-1fpl-fuelcladpot.lossQ-fuelcladlossrpl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss 9.0Other9.1.5SiteAreaEmergencyCategory9.0Other9.0Other9.1.VGeneralEmergencyAsdeterminedbytheShiftSupervisororEmergencyCoordinator,eventsareinprogresswhichindicateactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.AnyreleasesarenotexpectedtoresultinexposureswhichexceedEPAPAGs,Attach.A.AllAsdeterminedbytheShikSupervisororEmergencyCoordinator,eventsareinprogresswhichindicateactualorimminentcoredamageandthepotentialforalargereleaseofradioactivematerialinexcessofEPAPAGsoutsidethesiteboundary.All9.1.6SiteAreaEmergencyAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadorhasledtoeither:LossorpotentiallossofbothfuelcladandRCSbarrier,Attach.A.ORLossorpotentiallossofeitherfuelcladorRCSbarrierinconjunctionwithalossofcontainment,Attach.A.9.1.8GeneralEmergencyAnyevent,asdeterminedbytheShiA.SupervisororEmergencyCoordinator,thatcouldleadorhasledtoalossofanytwofissionproductbarriersandlossorpotentiallossofthethird,Attach.A.Poweroperation,hotshutdownPoweroperation,hotshutdown9-2fpl-fuelcladpot.loss6-fuelcladlossryl-RCSpot.lossrl-RCSlosscpl-contain.pot.losscl-contain.loss OSSI-92-402A-4-REGfgi.J2'gfI'inndEALTechnicalBasesDocument,Rev1}AttachmentCNewYorkEALUpgradeProjectR.E.GinnaEmergencyActionLevelsTechnicalBasesRevision1BasedonProposedResponsestoNRCRAIs10/11/94 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument.Rev1PURPOSEThepurposeofthisdocumentistoprovideanexplanationandrationaleforeachoftheemergencyactionlevels(EALs)includedintheEALUpgradeProgramforR.E.GinnaNuclearPowerStation(REGNPS).ItisalsointendedtofacilitatethereviewprocessoftheREGNPSEALsandprovidehistoricaldocumentationforfuturereference.Thisdocumentisalsointendedtobeutilizedby,thoseindividualsresponsibleforimplementationofEPIP-1-0"GinnaStationEventEvaluationandClassification"asatechnicalreferenceandaidinEALinterpretation.DISCUSSIONEALsaretheplant-specificindications,conditionsorinstrumentreadingswhichareutilizedtoclassifyemergencyconditionsdefinedintheREGNPSEmergencyPlan.SubsequenttotheacceptancebytheNRCofNUMARC/NESP-007"MethodologyforDevelopmentofEmergencyActionLevels"asanacceptablealternativetotheNUREG0654EALguidance,thefournuclearutilitiesintheStateofNewYorkdecidedtoperformajointimplementationofthenewmethodology.Thisupgradeprojectinvolvedthefollowingplants:~NineMilePointUnit1(NMPC)~NineMilePointUnit2(NMPC)JamesA.FitzPatrickNuclearPowerPlant(NYPA)~IndianPointStation2(ConEd)~IndianPoint3NuclearPo'werStation(NYPA)~R.E.GinnaNuclearPowerStation(RG&E)WhiletheupgradedEALsaresitespecific,anobjectiveoftheupgradeprojectwastoensureconformityandconsistencybetweenthesitestotheextentpossible.TherevisedEALswerederivedfromtheInitiatingConditionsandexampleEALsgivenintheREGNPSPlant-SpecificEALGuideline(PEG).ThePEGistheREGNPSinterpretationoftheNUMARCmethodologyfordevelopingEALs.ThePEGidentifiesdeletionsfromtheNUMARCmethodologybystrikingoutwordsandphrasesthatarenotapplicabletoREGNPS;additionsareidentifiedbyunderliningnewwordsandphrases.ThesourceofdocumentsforPEGchangesfromNUNCmethodologyarelistedinthereferencessectionofthePEG.ManyoftheEALsderivedfromtheNV)~Cmethodologyarefissionproductbarrierbased.Thatis,theconditionswhichdefinetheEALsare OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Revlbaseduponlossorpotentiallossofoneormoreofthethreefissionproductbarriers.Theprimaryfissionproductbarriersare:A.rF11inThefuelcladdingiscomprisedofthezirconiumtubeswhichhousetheceramicuraniumoxidepelletsalongwiththeendplugswhichareweldedintoeachendofthefuelrods.B.rInmTheRCSiscomprisedofthereactorvesselshell,vesselhead,vesselnozzlesandpenetrationsandallprimarysystemsdirectlyconnectedt'othereactorvesseluptothefirstcontainmentisolationvalve.C~i~Yhiip'fhpcontainmentstructureandallisolationvalvesrequiredtomaintaincontainmentintegrityunderaccidentconditions.Thefollowingcriteriaservesasthebasesforeventclassificationrelatedtofissionproductbarrierloss:n1EvnAnylossorpotentiallossofcontainmenthhzf'nylossoranypotentiallossofeitherfuelcladorRCSrnAnylossofbothfuelcladandRCSorAnypotentiallossofbothfuelcladandRCSorAnypotentiallossofeitherfuelcladorRCSwithalossofanyadditionalbarrierLossofanytwobarrierswithlossorpotentiallossofathirdThoseEALs-which'referenceoneormoreofthefissionproductbarrierICdesignators(FC,RCSandPC)inthePEGReferencesectionofthetechnicalbasesarederivedfromtheFissionProductBarrierAnalysis.Theanalysisentailedanevaluationofeverycombinationoftheplantspecificbarrierloss/potentiallossindicatorsappliedtotheabovecriteria.
{{#Wiki_filter:Attachm      B ll DN aw
OSSI-92-402A-4-REGGinnaEAI.TechnicalBasesDocument,RevIWherepossible,theEALshavebeenmadeconsistentwith'ndutilizetheconditionsdefinedintheREGNPSCriticalSafetyFunctionStatusTrees(CSFSTs).WhilethesymptomsthatdriveoperatoractionsspecifiedintheCSFSTsarenotindicativeofgllpossibleconditionswhichwarrantemergencyclassification,theydodefinethesymptoms,independentofinitiatingevents,forwhichreactorplantsafetyand/orfissionproductbarrierintegrityarethreatened.WherethesesymptomsareclearlyrepresentativeofoneofthePEGInitiatingConditions,theyhavebeenutilizedasanEAL.Thisallowsforrapidclassificationofemergencysituationsbasedonplantconditionswithouttheneedforadditionalevaluationoreventdiagnosis.AlthoughsomeoftheEALspresentedherearebasedonconditionsdefinedintheCSFSTs,classificationofemergenciesusingtheseEALsisnotdependentuponEmergencyOperatingProcedures(EOPs)entryorexecution.TheEALscanbeutilizedindependentlyorinconjunctionwiththeEOPs.Totheextentpossible,theEALsaresymptombased.Thatis,theactionlevelisdefinedbyvaluesofkeyplantoperatingparameterswhichidentifyemergencyorpotentialemergencyconditions.Thisapproachisappropriatebecauseitallowsthefullscopeofvariationsinthetypesofeventstobeclassifiedasemergencies.But,apurelysymptombasedapproachisnotsufBcienttoaddressalleventsforwhichemergencyclassificationisappropriate.ParticulareventstowhichnopredeterminedsymptomscanbeascribedhavealsobeenutilizedasEALssincetheymaybeindicativeofpotentiallymoreseriousconditionsnotyetfullyrealized.TheEALsaregroupedintoninecategoriestosimplifytheirpresentationandtopromotearapidunderstandingbytheirusers.Thesecategoriesare:1.2.3.45.6.7.8.9.CSFSTStatusReactorFuelReactorCoolantSystemContainmentRadioactivityRelease/AreaRadiationElectricalFailuresEquipmentFailuresHazardsOtherCategories1through5areprimarilysymptombased.Thesymptomsareindicativeofactualorpotentialdegradationofeitherfissionproductbarriersorpersonnelsafety.Categories6,7and8areeventbased.ElectricalFailuresarethoseeventsassociatedwithlossesofeitherACorvitalDCelectricalpower.EquipmentFailuresareabnormalandemergencyeventsassociatedwithvitalplantsystemfailures,whileHazardsarethosenon-plantsystemrelatedeventswhichhaveaffectedormayaffectplantsafety.
  &#xc3;I R.E. Ginna Emergency Action Levels 0'o OM Cl 0'o'4 Annotated Classification Criteria Based on Response to NRC RAls Ul4                    Category 1.0        CSFST Status Qw O~
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument.RevICategory9providestheEmergencyCoordinator(ShiRSupervisor)thelatitudetoclassifyanddeclareemergenciesbasedonplantsymptomsoreventswhichinhisjudgmentwarrantclassification.ThisjudgmentincludesevaluationoflossorpotentiallossofoneormorefissionproductbarrierswarrantingemergencyclassificationconsistentwiththeNUMlARCbarrierlosscriteria.ThefissionproductbarrierlossandpotentiallossindicatorsareprovidedinAttachmentA.Categoriesarefurtherdividedintooneormoresubcategoriesdependingonthetypesandnumberofplantconditionsthatdictateemergencyclassifications.Forexample,theElectricalFailurescategoryhastwosubcategorieswhosevaluescanbeindicativeoflossesofelectricalpowersources:lossofACpowersourcesandlossofDCpowersources.AnEALmayormaynotexistforeachsubcategoryatallfourclassificationlevels.Similarly,morethanoneEALmayexistforasubcategoryinagivenemergencyclassificationwhenappropriate(i.e.noEALattheGeneralEmergencylevelbutthreeEALsattheUnusualEventlevel).ForeachEAL,the,followinginformationisprovided:Classification:UnusualEvent,Alert,SiteAreaEmergency,orGeneralEmergencyNUMARCInitiatingCondition&omwhichtheEALwasderived,ifapplicable.~Fissionproductbarrierloss/potentiallossconditionwhichtheEALrepresents,ifapplicable.~OperatingModeApplicability:Oneormoreofthefollowingplantoperatingconditionsarelisted:PowerOperation,HotShutdown,ColdShutdown,RefuelandDefueledEAL:DescriptionoftheconditionorsetofconditionswhichcomprisetheEAL~Basis:DescriptionoftherationalefortheEAL~PEG
DOO UMV Category 2.0 Reactor Fuel Category 3.0        Reactor Coolant System Category 4.0        Containment Category 5.0         Radioactivity Release Category 6.0        Electrical Failures Category 7.0        Equipment Failures Category 8.0        Hazards Category 9.0        Other
 
R. E. Ginna Emergency Action Levels Proposed Revision 19 Based on Response to NRC RAIs Category 1.0      CSFST Status Category 2.0      Reactor Fuel 0
Category 3.0      Reactor Coolant System Category 4.0      Containment Category 5.0      Radioactivity Release Category 6.0      Elecrtical Failures Category 7.0      Equipment Failures Category 8.0      Hazards Category 9.0      Other 10/11/94
 
Cate go      .0 CSFST Status 1.0    CSFST Status                                              1.0    CSFST Status 1.1    Subcriticality                                            12    Core Cooling 1.1.1  Alert          [SA2]                                       1.2.1  Site Area Emergency        [fpl/fl,rl] [SS4]
ORANGE or RED path F-0.1 SUBCRITICALITY                            ORANGE or RED path in F-0.2, CORE COOLING AND Emergency boration is required                                    Power Operations, Hot Shutdown Power Operations, Hot Shutdown 1.2.2  General Emergency          [fl, rl, cpl]
1.1.2  Site Area Emergency          [SS2]                         RED path in F~-0.2, CORE COOLING AND RED path in F-0.1 SUBCRITICALITY                                  Functional restoration procedures not effective within AND either:                                                      15 min.
Emergency boration is inoperable OR                                                          Power Operations, Hot Shutdown Power range not < 6% within 15 min. of initiation of emergency boration Power Operations, Hot Shutdown 1.1.3  General Emergency            [SG2]
RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either:
RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown 1-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Catego      .0 CSFST Status 1.0    CSFST Status                                              1.0    CSFST Status 13    Heat Sink                                                  1.4    Integrity 1.3.1  Site Area Emergency          [fpl, rpl] [SS4]             1.4.1  Alert        [rpl]
RED path in F-0.3, HEAT SINK                                      RED path on F-0.4, INTEGRITY Power Operations, Hot Shutdown                                    Power Operations, Hot Shutdown 1-3 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Catego       .0 CSFST Status 1.0    CSFST Status 1.5    Containment 1.5.1  General Emergency        [6, rl, cpl]
RED path F-0.5, CONTAINMENTresulting from loss of reactor coolant Power Operations, Hot Shutdown 1-4 fpl fuel clad pot. loss 6
      -                   - fuel clad loss    rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Catego       .0 Reactor Fuel 2.0    Reactor Fuel                                              2.0    Reactor Fuel 2.1    Coolant Activity                                          2.2    Failed Fuel Detectors 2.1.1  Unusual Event        [SU4]                                 2.2.1  Unusual Event      [SU4]
Coolant sample activity:                                          Letdown Line Monitor R-9 > 2 R/hr
    >100%%uo of 84/E bar pCi/cc total specific activity OR                                                          All
    > 0.2 pCi/cc I-131 equivalent and the conditions    of Technical Specifications 3.1.4.3.b are exceeded 2.2.2  Alert All Letdown Line Monitor R-9 > 10 R/hr 2.1.2  Alert          [0]                                         Power operation, hot shutdown Coolant activity > 300 pCi/cc I-131 equivalent 2.2.3 Site Area Emergency          [fl, rpl]
Power operation, hot shutdown Letdown Line Monitor R-9 > 10 R/hr and any of the following:
2.1.3 Site    Area Emergency        [fi. rpl/rl]                       ~  RED path on F-0.4, INTEGRITY
                                                                        ~  Primary system leakage > 46 gpm Coolant activity > 300 pCi/cc I-131 equivalent and                      ~  RCS subcooling < EOP Fig. MIN SUBCOOLING any of the following:                                                     due to RCS leakage
    ~   RED path on F-0.4, INTEGRITY                                   ~ Containment*radiation monitor R-29/R-30
    ~  Primary system leakage > 46 gpm                                    reading > 10 R/hr
    ~  RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage                              Power operation, hot shutdown
    ~  Containment radiation monitor R-29/R-30 reading > 10 R/hr Power operation, hot shutdown 2-1 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Cate go      .0 Reactor Fuel 2.0    Reactor Fuel                                                2.0    Reactor Fuel 2.3     Containment Radiation                                      2.4    Refueling Accidents or Other Radiation Monitors 2.3.1  Alert 2.4.1  Unusual Event      [AU2]
Containment radiation monitor R-29/R-30 reading > 10 R/hr                                                                Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the Power operation, hot shutdown                                      spent fuel pool low water level alarm setpoint All 2.3.2 Site Area Emergency            [fl, rl]
Containment radiation monitor R-29/R-30 reading >                   2.4.2  Alert        [AA2]
100  R/hr Con6rmed sustained alarm on any of the following Power operation, hot shutdown                                      radiation monitors resulting from an uncontrolled fuel handling process:
                                                                        ~ R-2 Containment Area Monitor 2.8.3 General Emergency              [fl, rl, cpl]                     ~ R-5 Spent Fuel Pit
                                                                        ~ R-12 Containment Noble Gas Containment radiation monitor R-29/R-30 reading >
1000  R/hr Power operation, hot shutdown 2.4.8  Alert        [AA2]
Report of visual observation of irradiated fuel uncovered All 2-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot, loss  rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category .0 Reactor Coolant System 3.0    Reactor Coolant System                                        3.0    Reactor Coolant System 3.1     RCS Leakage                                                    3.2 Primary to Secondary Leakage 3.1.1  Unusual Event        [SU5]                                   3.2.1  Unusual Event      [cl]
Unidentified or pressure boundary leakage > 10 gpm                    Release of secondary side to atmosphere with primary OR                                                                    to secondary leakage > 0.1 gpm per steam generator Identified leakage > 25 gpm Power operation, hot shutdown Power operation, hot shutdown                                                              1 3.2.2 Site Area Emergency        [rpl, cl]
3.1.2  Alert          [rpl]
Unisolable release of secondary side to atmosphere Primary system leakage > 46 gpm                                        with primary to secondary leakage > 46 gpm Power operation, hot shutdown                                          Power operation, hot shutdown 3.1.3 Site    Area Emergency          [fpl, rl] [SS5]                 3.2.3 Site Area Emergency        [fl,cl]
RVLIS cannot be maintained > 43% with no RCPs                          Release of secondary side to atmosphere with primary running                                                                to secondary leakage > 0.1 gpm per steam generator OR                                                                      AND Either:
With the reactor vessel head removed, it is reported                      Coolant activity > 300 pCi/cc of I-131 that water level in the reactor vessel is dropping in an                    OR
. uncontrolled manner and core uncovery is likely            .              Letdown Line Monitor R-9 > 10    8/hr All                                                                    Power operation, hot shutdown 3-1 fpl - fuel clad pot. loss  fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Category .0 Reactor Coolant System 3.0    Reactor Coolant System 3.3    RCS Subcooling 3.3.1  Alert        [rl]
RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage Power operation, hot shutdown 3-2 fpl - fuel clad pot. loss 6-fuel clad loss rpl -RCS pot. loss rl -RCS loss cpl -contain. pot. loss cl - contain. loss
 
Category 4.0 Containment 4.0    Containment                                            4.0    Containment 4.1    Containment Integrity Status                            4.1    Containment Integrity Status 4.1.1  Unusual Event      [cl]                               4.1.3  Site Area Emergency        [rl, cl]
Both doors open on containment airlock                          Either:
OR                                                                CI or CVI valve(s) not closed when required Inability to close containment pressure relief or purge            following confirmed LOCA valves which results in a radiological release pathway                OR to the environment                                                  Inability to isolate any primary system discharging OR                                                                outside containment CI or CVI valve(s) not closed when required which                AND results in a radiological release pathway to the                Radiological release pathway to the environment environment                                                    exists Power operation, hot shutdown                                  Power operation, hot shutdown 4.1.2 Site  Area Emergency        [rl, cl]                     4.1.4  General Emergency          [fl, rl, cpl]
Rapid uncontrolled decrease in containment pressure            Safety injection signal due to LOCA with less than following initial increase                                      minimum operable containment heat removal OR                                                            equipment, Table 4.3 Loss of primary coolant inside containment with                  AND containment pressure or sump level response not                Any indicators of fuel clad loss, Table 4.1 consistent with LOCA conditions Power operation, hot shutdown Power operation, hot shutdown 4-1 fpl fuel clad pot. loss 6 fuel clad loss rpl
      -                       -                 - RCS pot. loss rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
0                                                    Category 4.0 Containment 4.0    Containment                                              4.0    Containment 4.1    Containment Integrity Status                            4.2    SG Tube  Rupture w/ Secondary Release 4.1.5 General Emergency            [fpVfl,rl,cl]                 4.2.1 Site  Area Emergency        [rl, cl]
Either:                                                         Unisolable secondary side line break with SG tube Rapid uncontrolled decrease in containment                rupture as identified in E-3 "Steam Generator Tube pressure following initial increase                        Rupture" OR Loss of primary coolant inside containment with            Power operation, hot shutdown containment pressure or sump level response not consistent with LOCA conditions AND                                                            4.2.2 General Emergency            [fpVfl,rl, cl]
Any indicators of fuel clad damage, Table 4.2 Unisolable secondary side line break with SG tube Power operation, hot'hutdown                                    rupture as identified in E-3 "Steam Generator Tube Rupture" AND 4.1.6 General Emergency            [fpVfl,rl,cl]                 Any indicators of fuel clad damage, Table 4.2 Either:                                                          Power operation, hot shutdown CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot shutdown 4-2 fpl - fuel clad pot. loss 6 fuel clad loss rpl
                              -                 - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Catego    .0 Containment 4.0    Containment 4.3    Combustible Gas Concentrations 4.3.1  General Emergency          I fl,rl,cpl]
2 4% hydrogen concentration in containment Power operation, hot shutdown Table 4.1      Fuel Clad Loss Indicators
: 1. Coolant activity > 300 pCi/cc of I-131
: 2. Containment rad monitor R-29/R-30 reading
        >100 R/hr
: 3. Letdown Monitor R-9 reading > 10 R/hr
: 4. RED path in F-0.2, CORE COOLING Table 4.3  Minimum Operable Containment Heat Table 4.2    Fuel Clad Dama      e Indicators                            Removal E ui ment CNMT Pressure  Recirc Fans Operable Spray Pumps
    ~   ORANGE or RED path in F-0.2, CORE                                                                    Re uired COOLING
    ~   RED path in F-0.3, HEAT SINK                              <28 psig                                    N/A
    ~   Coolant activity > 300 pCi/cc of I-131
    ~   Containment rad monitor R-29/R-30 reading
        >100 H/hr                                                 >28 psig
    ~   Letdown Monitor R-9 reading > 10 R/hr 4-3 fpl - fuel clad pot. loss 6- fuel clad loss rpl - RCS pot. loss rl -RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category 6.0 Radioactivity Release 6.0    Radioactivity Release /Area Radiation                    6.0    Radioactivity Release / Area Radiation 6.1    EQluent Monitors                                          6.1    EQluent Monitors 6.1.1    Unusual Event      [AU1]                                 6.1.4  General Emergency          [AG1]
A valid reading on any monitors Table 5.1 column                  A valid reading on any monitors Table 5.1 column "NUE" for > 60 min. unless sample analysis can                    "GE" for > 15 min. unless dose assessment can confirm confirm release rates < 2 x technical specifications              releases are below Table 5.2 column "GE" within this within this time period.                                           time period.
All                                                                All 6.1.2  Alert          [AA1]
A valid reading on any monitors Table 5.1 column "Alert" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "Alert" within this time period.
All 6.1.3 Site    Area Emergency        [AS1]
A valid reading on any monitors Table 5.1 column "SAE" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "SAE" within this time period.
All 5-1 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category o.0 Radioactivity Release 6.0    Radioactivity Release /Area Radiation                      6.0    Radioactivity Release / Area Radiation 6.2    Dose Projections/ Environmental                            5.2    Dose Projections/ Environmental Measurements/ Release Rates                                      Measurements/ Release Rates 6.2.1  Unusual Event        [AU1]                                 6.2.4 Site Area Emergency          [AS1]
Confirmed sample analyses for gaseous or liquid                    Dose projections or field surveys resulting from actual release rates > 2 x technical specifications limits for >         or imminent release which indicate doses / dose rates >
60 min.                                                           Table 5.2 column "SAE" at the site boundary or beyond.
All All 6.2.2  Alert          [AA1]
6.2.5 General Emergency            [AG1]
Confirmed sample analyses for gaseous or liquid release rates > 200 x technical specifications limits for          Dose projections or field surveys resulting from actual
> 15 min.                                                          or imminent release which indicate doses / dose rates >
Table 5.2 column "GE" at the site boundary or beyond.
All 5.2.8  Alert          [AA1]                                                   Table 5.3. Plant Areas Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates >
                                                                            ~ Reactor Containment Table 5.2 column "Alert" at the site boundary or                              Building beyond.
                                                                            ~ Auxiliary Building
                                                                            ~ Turbine Building All .
                                                                            ~ Emergency Diesel Building
                                                                            ~ Screen House
                                                                            ~ Standby Auxiliary Feedwater Building 5-2 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Catego      o.0 Radioactivity Release 5.0    Radioactivity Release /Area Radiation 5.3    Area Radiation Levels 5.3.1 'Unusual Event        [AU2]
Any sustained direct ARM readings > 100 x alarm or oAscale hi resulting from an uncontrolled process 5.3.2  Alert          [AA3]
Sustained area radiation levels > 15 mR/hr in either:
Control Room OR Central Alarm Station and Secondary Alarm Station 5.3.3  Alert          [AA3]
Sustained abnormal area radiation levels > 8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.
All 5-3 fpl - fuel clad pot. loss 6 fuel clad loss rpl
                              -                 - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category o.0 Radioactivity Release Table 5.1    EfHuent Monitor Classification Thresholds Monitor                                  Alert                                      GE R-ll          1.62E6 cpm                  N/A                  N/A                  N/A R-12          7.80E6 cpm            1.07E7 cpm                N/A                  N/A R-13          2.20E4 cpm                  N/A                  N/A                  N/A R-14          6.40E5 cpm            1.61E6 cpm                N/A                  N/A R-15          4.00E5 cpm          2.31E7 cpm                  N/A                  N/A R-18          3.60E5 cpm              offscale hi              N/A                  N/A R-12 A(7/9)          N/A                  N/A            6.00 pCi/cc        60.00 pCi/cc R-14A(7/9)          N/A                  N/A            0.533 pCi/cc        5.33      pCi/cc R-15A(7/9)            N/A                  N/A            11.50 pCi/cc        115.00 pCi/cc R-31/32 1ARV              N/A            1.900  mR/hr          19.0 mR/hr          190    mR/hr 1 Safety          N/A            0.951  mR/hr          9.51 mR/hr          95.1  mRhr 2 Safety          N/A            0.476  mR/hr          4.76 mR/hr          47.6  m R/hr 3 Safety          N/A            0.317  mR/hr          3.17 mR/hr          31.7  mR/hr 4 Safety          N/A            0.238  mR/hr          2.38 mR/hr         .23.8 mR/hr Table 5.2    Dose Pro ection  / Env. Measurement Classification Thresholds Alert                                                GE TEDE                      10 mR                    100 mR                    1000 mR CDE Thyroid              N/A                    500 mR                    5000 mR TEDE rate                10  mR/hr                100 mR/hr                1000 mR/hr CDE Thyroid rate                                  500 mR/hr                  5000 mR/hr 5-4 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss    rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Catego       .0 Electrical Failures 6.0    Electrical Failures                                      6.0    Electrical Failures 6.1     Loss  of AC Power Sources                                6.1    Loss  of AC Power Sources 6.1.1  Unusual Event      [SUl]                               6.1.4  Site Area Emergency      [SS1]
Loss of ability to supply power to the safeguard buses          Loss of all safeguards bus AC power for > 15 min.
from offsite circuits 751 and 767 for > 15 min.
Power operation, hot shutdown All 6.1.6 General Emergency          [SGl]
6.1.2  Alert        [SA1]
Loss of all safeguards bus AC power Loss of all safeguards bus AC power for > 15 min.                 AND either:
Power restoration to any safeguards bus is not Cold Shutdown, Refueling, Defueled                                    likely in < 4 hrs OR Actual or imminent entry into ORANGE or RED 6.1.3  Alert        [SA5]                                            path on F-0.2, "CORE COOLING" Available safeguard train AC power reduced to only              Power operation, hot shutdown one of the following for > 15 min.:
      ~   EDG 1A (14/18)
      ~   EDG 1B (16/17)
      ~   Station AuxiliaryTransformer 12A
      ~   Station Auxiliary Transformer 12B Power operation, hot shutdown 6-1 fpl fuel clad pot. loss
      -                   6- fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Category 6.0 Electrical Failures 6.0    Electrical Failures 6.2    Loss  of DC Power Sources 6.2.1  Unusual Event        [SU7]
< 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.
Cold Shutdown, Refueling 6.2.2 Site    Area Emergency          [SS3]
> 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.
Power operation, hot shutdown 6-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category .0 Equipment Failures 7.0    Equipment Failures                                          V.O    Equipment Failures V.1    Technical Specification%Requirements                        V.2    System Failures or Control Room Evacuation 7.1.1  Unusual Event        [SU2]
7.2.1  Unusual Event      [HU1]
Plant is not brought to required operating mode within Technical Specifications LCO Action-Statement Time.               Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator Power operation, hot shutdown                                      seals.
Power Operations V.2.2  Alert        [HA1]
Turbine failure generated missiles result in any visible structural damage to plant vital equipment Power Operations, Hot Shutdown 7.2.8  Alert        [HA5]
Entry into AP-CR.1 "Control Room Inaccessability" All 7.2.4  Alert        [SA3]
Reactor coolant temperature cannot be maintained <
200 'F Cold Shutdown, Refueling 7-1 fyl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Cate go      .0 Equipment Failures V.O    Equipment Failures                                      7.0    Equipment Failures V.2    System Failures or Control Room                          7.3    Loss  of Indications /Alarms /
Evacuation                                                      Communication Capability V.2.5  Site Area Emergency      [HS2]                         V.3.1  Unusual Event        [SU3]
Control Room evacuation                                          Unplanned loss of annunciators or indications on any AND                                                            Control Room Panels, Table 7.3 for > 15 min.
Core cooling cannot be established per AP-CR.1                   AND "Control Room Inaccessibility" in < 20 min.                     Increased surveillance is required for safe plant operation All Power operation, hot shutdown 7.3.2 Unusual      Event    [SU6]
Loss of all communications capability affecting the ability to either:
Perform routine operations OR Notify offsite agencies or personnel 7-2 fpl - fuel clad pot. loss 6 fuel clad loss rpl
                            -                   - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Catego       .0
                                                    . Equipment Failures V.O    Equipment Failures V.3    Loss of Indications /Alarms /
Communication Capability                                            Table 7.3    Vital Control Room Panels V.3.3  Alert          [SA4]                                                         B      C      D      E      F      G Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for > 15 min.
AND Increased surveillance is required for safe plant operation AND either:
A plant transient in progress OR PPCS and SAS are unavailable Power operation, hot shutdown V.3.4  Site Area Emergency          [SS6]
Loss of annunciators or'indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Power operation, hot shutdown 7-3 fpl - fuel clad pot. loss  6 - fuel clad loss rpl - RCS  pot. loss rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Catego       .0 Hazards 8.0    Hazards                                                    8.0    Hazards 8.1    Security Threats                                          8.1    Security Threats 8.1.1  Unusual Event        [HU4]                                 8.1.4  General Emergency            [HG1]
Bomb device or other indication of attempted sabotage              Security event which results in:
discovered within plant Protected Area.                                 Loss of plant control from the Control Room OR                                                                      OR Any security event which represents a potential                          Loss of remote shutdown capability degradation in the level of safety of the plant.
All 8.1.2  Alert          [HA4]
Intrusion into plant Protected Area by an adversary.
OR Any security event which represents an actual substantial degradation of the level of safety of the plant.
All 8.1.3  Site Area Emergency          [HS1]
Intrusion into a plant security vital area by an adversary.
OR Any security event which represents actual or likely failures of plant systems needed to protect the public.
All 8-1 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Hazards 8.0    Hazards                                                    8.0    Hazards 8.2     Fire or Explosion                                          8.3    Man-Made Events 8.2.1  Unusual Event        DiU2]                                8.3.1  Unusual Event      DiU1]
Confirmed fire in any plant area, Table 8.2 or Table                Vehicle crash into or projectile which impacts plant 8.3 not extinguished    in 5 15 min. of Control Room                structures or systems within Protected Area boundary notification:
All All 8.3.2  Unusual Event        [HU1]
8.2.2  Alert          [HA2]
Report by plant personnel of an explosion within Fire or explosion in any plant area, Table 8.2 or Table            Protected Area boundary resulting in visible damage 8.3 which results in EITHER:                                       to permanent structures or equipment
    ~   visible damage to plant equipment or structures needed for safe plant operation                            All OR
    ~   which affects safety system operability as indicated by degraded system performance                    8.3.3  Unusual Event        [HU3]
Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could affect the health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event All 8-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category 8.0 Hazards 8.0    Hazards                                                      8.0    Hazards 8.3    Man-Made Events                                              8.4    Natural Events 8.3.4  Alert          [HA1]                                         8.4.1  Unusual Event      [HU1]
'ehicle    crash or projectile impact which precludes                Earthquake felt inplant by any operator personnel access to or damages equipment in plant                      AND                                              I vital areas, Table 8.3                                              Confirmation of earthquake of an intensity > 0.01 g per SC-5 "Earthquake Emergency Plan".
All All 8.3.5  Alert          [HA3]
8.4.2 Unusual    Event      [HU1]
Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be            Report by plant personnel of tornado within plant life threatening to plant personnel or preclude access              Protected Area boundary to equipment needed for safe plant operation All 8.4.3 Unusual    Event      [HUl]
Deer Creek flooding over entrance road bridge (hand rail)
OR Lake level > 252 ft OR Screen House Suction Bay water level < 15      ft (low-low level alarm)
All 8-3 ~
fpl - fuel clad pot. loss 6  - fuel clad loss rpl - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category .0 Hazards 8.0    Hazards                                                    8.0    Hazards 8.4     Natural Events                                            8.4    Natural Events 8.4.4   Alert          [HA1]                                       8.4.7  Alert        [HA1]
Earthquake felt inplant by any plant operations                    Flood water accumulating on screen house operating personnel                                                          floor AND                                                                OR Confirmation of earthquake of an intensity      ) 0.08 g          Lake level > 253 ft                                      I'R per SC-5 "Earthquake Emergency Plan" Screen House Suction Bay water level < 13      ft All All 8.4.5  Alert          [HA1]
Table 8.2    Plant Areas Sustained winds > 75 mph OR Tornado strikes a plant vital area, Table 8.3
                                                                            ~ Turbine Building
                                                                            ~ TSC All
                                                                            ~ Service Building
                                                                            ~ Contaminated Storage Building 8.4.6  Alert          [HAl]
Any natural event which results in a report of visible                          Table 8.3  Plant Vital Areas structural damage or assessment by Control Room personnel of actual damage to equipment needed for                          ~ Control Building safe plant operation, Table 8.3                                              ~ Reactor Containment Building AuxiliaryBuilding All                                                                          ~ Intermediate Building
                                                                            ~ Emergency Diesel Building
                                                                            ~ Standby AuxiliaryFeedwater Building
                                                                            ~ Screen House 8-4 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss
 
Category 9.0 Other 9.0    Other                                                      9.0    Other 9.1.1 Unusual      Event                                          9.1.3  Alert Any event,   as determined  by the Shift Supervisor or            Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led              Emergency Coordinator, that could cause or has to a potential degradation of the level of safety of the          caused actual substantial degradation of the level of plant.                                                             safety of the plant.
AIl 9.1.2 Unusual      Event                                          9.1.4  Alert Any event, as determined by the Shift Supervisor or                Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led              Emergency Coordinator, that could lead or has led to a, to a loss or potential loss of containment, Attach. A.             loss or potential loss of either fuel clad or RCS barrier, Attach. A.
Power operation, hot shutdown Power operation, hot shutdown 9-1 fpl - fuel clad pot. loss Q - fuel clad loss rpl - RCS pot. loss  rl - RCS loss cpl - contain. pot. loss  cl - contain. loss
 
Category 9.0 Other 9.0    Other                                                      9.0    Other 9.1.5  Site Area Emergency                                        9.1.V  General Emergency As determined by the Shift Supervisor or Emergency                As determined by the Shik Supervisor or Emergency Coordinator, events are in progress which indicate                Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to              actual or imminent core damage and the potential for protect the public. Any releases are not expected to              a large release of radioactive material in excess of EPA result in exposures which exceed EPA PAGs, Attach.                 PAGs outside the site boundary.
A.
All All 9.1.8 General    Emergency 9.1.6  Site Area Emergency Any event, as determined by the ShiA. Supervisor or Any event, as determined by the      Shift Supervisor or          Emergency Coordinator, that could lead or has led to a Emergency Coordinator, that could lead or has led to              loss of any two fission product barriers and loss or either:                                                            potential loss of the third, Attach. A.
Loss or potential loss of both fuel clad and RCS barrier, Attach. A.                                         Power operation, hot shutdown OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attach. A.
Power operation, hot shutdown 9-2 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS  loss cpl - contain. pot. loss cl - contain. loss
 
OSSI-92-402A-4-REG            'gf I'innd EAL  Technical Bases Document, Rev 1
                                            }
fgi.J 2 Attachment C New York EAL Upgrade Project R.E. Ginna Emergency Action Levels Technical Bases Revision        1 Based on Proposed Responses to NRC RAIs 10/11/94
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document. Rev 1 PURPOSE The purpose of this document is to provide an explanation and rationale for each of the emergency action levels (EALs) included in the EAL Upgrade Program for R.E. Ginna Nuclear Power Station (REGNPS). It is also intended to facilitate the review process of the REGNPS EALs and provide historical documentation for future reference. This document is also intended to be utilized by, those individuals responsible for implementation of EPIP-1-0 "Ginna Station Event Evaluation and Classification" as a technical reference and aid in EAL interpretation.
DISCUSSION EALs are the plant-specific indications, conditions or instrument readings which are utilized to classify emergency conditions defined in the REGNPS Emergency Plan.
Subsequent to the acceptance by the NRC of NUMARC/NESP-007 "Methodology for Development of Emergency Action Levels" as an acceptable alternative to the NUREG 0654 EAL guidance, the four nuclear utilities in the State of New York decided to perform a joint implementation of the new methodology. This upgrade project involved the following plants:
                  ~ Nine Mile Point Unit 1 (NMPC)
                  ~ Nine Mile Point Unit 2 (NMPC)
James A. FitzPatrick Nuclear Power Plant (NYPA)
                  ~ Indian Point Station 2 (ConEd)
                  ~ Indian Point 3 Nuclear Po'wer Station (NYPA)
                  ~ R.E. Ginna Nuclear Power Station (RG&E)
While the upgraded EALs are site specific, an objective of the upgrade project was to ensure conformity and consistency between the sites to the extent possible.
The revised EALs were derived from the Initiating Conditions and example EALs given in the REGNPS Plant-Specific EAL Guideline (PEG). The PEG is the REGNPS interpretation of the NUMARC methodology for developing EALs. The PEG identifies deletions from the NUMARC methodology by striking out words and phrases that are not applicable to REGNPS; additions are identified by underlining new words and phrases. The source of documents for PEG changes from NUNC methodology are listed in the references section of the PEG.
Many of the EALs derived from the NV)~C methodology are fission product barrier based. That is, the conditions which define the EALs are
 
OSSI-92-402A-4-REG                            Ginna EAL Technical Bases Document, Rev l based upon loss or potential loss of one or more of the three fission product barriers.
The primary fission product barriers are:
A.           rF 1    1  in The fuel cladding is comprised of the zirconium tubes which house the ceramic uranium oxide pellets along with the end plugs which are welded into each end of the fuel rods.
B.         r    I n        m          The RCS is comprised of the reactor vessel shell, vessel head, vessel nozzles and penetrations and all primary systems directly connected t'o the reactor vessel up to the first containment isolation valve.
C~i             ~   Yh        i      i    p'       fh containment structure and all isolation valves required to p
maintain containment integrity under accident conditions.
The following criteria serves as the bases for event classification related to fission product barrier loss:
n        1Ev n Any loss or potential loss of containment hhzf'ny loss or any potential loss of either fuel clad or RCS r n Any loss of both fuel clad and RCS or Any potential loss of both fuel clad and RCS or Any potential loss of either fuel clad or RCS with a loss of any additional barrier Loss of any two barriers with loss or potential loss of a third Those EALs-which'reference one or more of the fission product barrier IC designators (FC, RCS and PC) in the PEG Reference section of the technical bases are derived from the Fission Product Barrier Analysis. The analysis entailed an evaluation of every combination of the plant specific barrier loss/potential loss indicators applied to the above criteria.
 
OSSI-92-402A-4-REG                      Ginna EAI. Technical Bases Document, Rev I Where possible, the EALs have been made consistent with'nd utilize the conditions defined in the REGNPS Critical Safety Function Status Trees (CSFSTs). While the symptoms that drive operator actions specified in the CSFSTs are not indicative of gll possible conditions which warrant emergency classification, they do define the symptoms, independent of initiating events, for which reactor plant safety and/or fission product barrier integrity are threatened. Where these symptoms are clearly representative of one of the PEG Initiating Conditions, they have been utilized as an EAL. This allows for rapid classification of emergency situations based on plant conditions without the need for additional evaluation or event diagnosis. Although some of the EALs presented here are based on conditions defined in the CSFSTs, classification of emergencies using these EALs is not dependent upon Emergency Operating Procedures (EOPs) entry or execution. The EALs can be utilized independently or in conjunction with the EOPs.
To the extent possible, the EALs are symptom based. That is, the action level is defined by values of key plant operating parameters which identify emergency or potential emergency conditions. This approach is appropriate because it allows the full scope of variations in the types of events to be classified as emergencies. But, a purely symptom based approach is not sufBcient to address all events for which emergency classification is appropriate. Particular events to which no predetermined symptoms can be ascribed have also been utilized as EALs since they may be indicative of potentially more serious conditions not yet fully realized.
The EALs are grouped into nine categories to simplify their presentation and to promote a rapid understanding by their users. These categories are:
: 1. CSFST Status
: 2. Reactor Fuel
: 3. Reactor Coolant System 4    Containment
: 5. Radioactivity Release / Area Radiation
: 6. Electrical Failures
: 7. Equipment Failures
: 8. Hazards
: 9. Other Categories 1 through 5 are primarily symptom based. The symptoms are indicative of actual or potential degradation of either fission product barriers or personnel safety.
Categories 6, 7 and 8 are event based. Electrical Failures are those events associated with losses of either AC or vital DC electrical power. Equipment Failures are abnormal and emergency events associated with vital plant system failures, while Hazards are those non-plant system related events which have affected or may affect plant safety.
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document. Rev I Category 9 provides the Emergency Coordinator (ShiR Supervisor) the latitude to classify and declare emergencies based on plant symptoms or events which in his judgment warrant classification. This judgment includes evaluation of loss or potential loss of one or more fission product barriers warranting emergency classification consistent with the NUMlARC barrier loss criteria. The fission product barrier loss and potential loss indicators are provided in Attachment A.
Categories are further divided into one or more subcategories depending on the types and number of plant conditions that dictate emergency classifications. For example, the Electrical Failures category has two subcategories whose values can be indicative of losses of electrical power sources: loss of AC power sources and loss of DC power sources. An EAL may or may not exist for each sub category at all four classification levels.
Similarly, more than one EAL may exist for a sub category in a given emergency classification when appropriate (i.e. no EAL at the General Emergency level but three EALs at the Unusual Event level).
For each EAL, the, following information is provided:
Classification: Unusual Event, Alert, Site Area Emergency, or General Emergency NUMARC Initiating Condition &om which the EAL was derived,         if applicable.
        ~   Fission product barrier loss/potential loss condition which the EAL represents, ifapplicable.
        ~   Operating Mode Applicability: One or more of the following plant operating conditions are listed: Power Operation, Hot Shutdown, Cold Shutdown, Refuel and Defueled EAL: Description of the condition or set of conditions which comprise the EAL
        ~   Basis:   Description of the rationale for the EAL
        ~   PEG  


==Reference:==
==Reference:==
PEGIC(s)andexampleEAL(s)fromwhichtheEALisderived~BasisReference(s):SourcedocumentationfromwhichtheEALisderived OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1TheidentifiedoperatingmodesaredefinedasfollowsReactorshutdownmarginislessthanTechnicalSpecificationminimumrequiredwithcoolanttemperature(Tavg)atorabovenormaloperatingtemperature.ReactorshutdownmargingreaterthanorequaltoTechnicalSpecificationminimumrequiredwithcoolanttemperature(Tavg)lessthannormaloperatingtemperature.~IhReactorshutdownmargingreaterthanorequaltoTechnicalSpecificationminimumrequiredwithcoolanttemperature(Tavg)lessthanorequalto200'F.E~f~gReactorshutdownmargingreaterthanorequaltoTechnicalSpecificationminimumrequiredforrefuelingoperationsandcoolanttemperature(Tavg)lessthanorequalto140'F.Lh~luiReactorvesselcontainsnoirradiatedfuel.TheseoperatingmodescorrelatetotheNUMARC-007andPEGidentifiedoperatingmodesasfollows:hni1BPowerOperationsStartup/HotstandbyHotShutdownColdShutdownRefuelDefueledAllPowerOperationsPowerOperationHotShutdownColdShutdownRefuelDefueledAll OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PlantEmergencyOperatingProcedures(EOPs)aredesignedtomaintainand/orrestoreasetofcriticalsafetyfunctionswhichareprioritizedforrestorationeffortsduringaccidentconditions.Bymonitoringthecriticalsafetyfunctionsstatus,theimpactofmultipleeventscanbeinherentlyaddressed.ThecriticalsafetyfunctionsaremonitoredthroughtheuseofCriticalSafetyFunctionStatusTrees(CSFSTs).WhencertainplantparametersexceedthresholdvaluesspecifiedbytheCSFST,theplantoperatorisdirectedtooneormorefunctionalrestorationand/orEOPsinanattempttorestorethoseparameterstowithinacceptablelimits.ThefollowingCSFSTsareutilizedtobeindicativeoffailuresorpotentialfailuresofoneormorefissionproductbarriers:'0gRdpttltl'SFSTldltlfreactivitycontrolwhichmayposeathreattofuelcladandRCS'ntegrity.CgRdptlI'SFSTldllfcoresubcoolingandthusposeadirectthreattotheintegrityofthereactorfuelcladandRCS.~H~ink'heRedpathofthisCSFSTisindicativeofalossofabilitytoremovedecayheatfromthecoreandthusposesadirectthreattofuelcladandRCSintegrity.TheRedpathofthisCSFSTisindicativeofadirectthreattoRCSbarrierintegrity.RdptftgCSFSTlldltltlffcladandRCSbarrieranddirectthreattothecontainmentbarrierintegrity.1-1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.1Subcriticality1.1.1AlertORANGEorREDpathF-0.1SUBCRITICALITYANDEmergencyborationisrequiredNUIVIARCIC:FailureofReactorProtectionsysteminstrumentationtocompleteorinitiateanautomaticreactortriponceaReactorProtectionsystemsetpointhasbeenexceededandimmediatemanualtripswerenotsuccessfulwhileinpoweroperationsorhotstandbyFPBloss/potentialloss:N/AModeApplicability:PowerOperations,HotShutdownBasis:CSFSTSubcriticality-ORANGEpathisenteredbasedonfailureoftheintermediaterangestartupratemonitorstoindicatenegativeorzerofollowingreactortrip.ThisEALaddressesanymanualtriporautomatictripsignalfollowedbyamanualtripwhichfailstoshutdownthereactortoanextentrequiringemergencyboration.Amanualtripisanysetofactionsbythereactoroperator(s)atthereactorcontrolconsolewhichcausescontrolrodstoberapidlyinsertedintothecoreandbringsthereactorsubcritical(e.g.,reactortripbutton).Thisconditionindicatesfailureoftheautomaticandmanualprotectionsystemstotripthereactortotheextentwhichprecludesthereactorbeingmadesub-critical.Althoughafrontlineautomaticprotectionsystemdidnotfunctioninresponsetoaplanttransient,itisthecontinuedcriticalityunder"conditionsrequiringareactortripwhichposesthepotentialthreattofuelcladintegrityandthuswarrantingdeclarationofanAlert.PEG
PEG IC(s) and example EAL(s) from which the EAL is derived
        ~   Basis Reference(s):   Source documentation from which the EAL is derived
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 The identified operating modes are defined as follows Reactor shutdown margin is less than Technical Specification minimum required with coolant temperature (Tavg) at or above normal operating temperature.
Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg) less than normal operating temperature.
      ~Ih shutdown margin greater than or equal Reactor                                          to Technical Specification minimum required with coolant temperature (Tavg) less than or equal to 200 'F.
E~f~g Reactor shutdown margin greater than or equal to Technical Specification minimum required for refueling operations and coolant temperature (Tavg) less than or equal to 140 'F.
Lh~lui Reactor vessel contains no irradiated fuel.
These operating modes correlate to the NUMARC-007 and PEG identified operating modes as follows:
hni 1B Power Operations                Power Operations Startup/Hot standby              Power Operation Hot Shutdown                    Hot Shutdown Cold Shutdown                    Cold Shutdown Refuel                          Refuel Defueled                        Defueled All                              All
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 Plant Emergency Operating Procedures (EOPs) are designed to maintain and/or restore a set of critical safety functions which are prioritized for restoration efforts during accident conditions. By monitoring the critical safety functions status, the impact of multiple events can be inherently addressed.
The critical safety functions are monitored through the use of Critical Safety Function Status Trees (CSFSTs). When certain plant parameters exceed threshold values specified by the CSFST, the plant operator is directed to one or more functional restoration and/or EOPs in an attempt to restore those parameters to within acceptable limits. The following CSFSTs are utilized to be indicative of failures or potential failures of one or more fission product barriers:
                      '0    g      Rdptt      l  tl'SFSTldl          t l        f reactivity control which may pose a threat to fuel clad and RCS
    'ntegrity.
C    g    Rdp      tl core subcooling and thus pose a direct I'SFSTldl            l threat to the integrity of the f
reactor fuel clad and RCS.
      ~H~ink'he Red path of this CSFST is indicative of a loss of ability to remove decay heat from the core and thus poses a direct threat to fuel clad and RCS integrity.
The Red path of this CSFST is indicative of a direct threat to RCS barrier integrity.
R dp    t ftg    CSFSTl l dl tl t l              ff clad and RCS barrier and direct threat to the containment barrier integrity.
1-1
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.1  Subcriticality 1.1.1      Alert ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required NUIVIARCIC:
Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and immediate manual trips were not successful while in power operations or hot standby FPB loss/potential loss:
N/A Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Subcriticality - ORANGE path is entered based on failure of the intermediate range startup rate monitors to indicate negative or zero following reactor trip. This EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent requiring emergency boration. A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes control rods to be rapidly inserted into the core and brings the reactor subcritical (e.
g., reactor trip button).
This condition indicates failure of the automatic and manual protection systems to trip the reactor to the extent which precludes the reactor being made sub-critical. Although a front line automatic protection system did not function in response to a plant transient, it is the continued criticality under "conditions requiring a reactor trip which poses the potential threat to fuel clad integrity and thus warranting declaration of an Alert.
PEG  


==Reference:==
==Reference:==
SA2.11-2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.CSFSTF-0.1,Subcriticality2."MethodologyforDevelopmentofEmergencyActionLevelsNUMARC/NESP-007Revision2-QuestionsandAnswers,June19931-3 OSSA-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.1Subcriticality1.1.2SiteAreaEmergencyREDpathinF-0.1SUBCRITICALITYANDeither:EmergencyborationisinoperableORPowerrangenot<5%within15min.ofinitiationofemergencyborationNUINARCIC:FailureofReactorProtectionsysteminstrumentationtocompleteorinitiateanautomaticreactortriponceaReactorProtectionsystemsetpointhasbeenexceededandmanualscramtripwasnotsuccessfulandthereiscontinuedpowergeneration.FPBloss/potentialloss:N/AModeApplicability:PowerOperations,HotShutdownBasis:CSFSTSubcriticality-REDpathisenteredbasedonfailureofpowerrangeindicationtodecreasebelow5%followingareactortrip.ThisportionoftheEALaddressesanymanualtriporautomatictripsignalfollowedbyamanualtripwhichfailstoshutdownthereactortoanextentthatthereactorisproducingmoreheatloadforwhichthesafetysystemsweredesigned.Amanualtripisanysetofactionsbythereactoroperator(s)atthereactorcontrolconsolewhichcauses"controlrodstoberapidlyinsertedintothecoreandbringspowerbelowthatpercentpowerassociatedwiththeabilityofthesafetysystemstoremoveheatandcontinuetodecrease."Thisconditionindicatesfailureofboththeautomaticandmanualprotectionsystemstotripthereactorinconjunctionwithafailureofalternateborationsystemstoreducereactorpowerbelowdecayheatlevels.Thecombinationoffailureofbothfrontlineandbackupprotectionsystemstofunctioninresponsetoaplanttransient,alongwiththecontinuedproductionofheatposesadirectthreattofuelcladandRCSintegrityandthuswarrantsdeclarationofaSiteAreaEmergency.1-4 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev115minutesisspecifiedtoallowtimeforemergencyborationtobeeffectiveandprovidesadiscriminatorbetweenSA2.1andSS2.1.Theclassificationshouldbemadeassoonasitisapparentthatemergencyborationisnotorwillnotbeeffectiveinreducingreactorpowerbelow5%.PEG
 
SA2.1 1-2
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. CSFST F-0.1, Subcriticality
: 2.     "Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2 - Questions and Answers, June 1993 1-3
 
OSSA-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.1    Subcriticality 1.1.2    Site Area Emergency RED path in F-0.1 SUBCRITICALITY AND either:
Emergency boration is inoperable OR Power range not < 5% within 15 min. of initiation of emergency boration NUINARC IC:
Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and manual scram trip was not successful and there is continued power generation.
FPB loss/potential loss:
N/A Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Subcriticality - RED path is entered based on failure of power range indication to decrease below 5% following a reactor trip. This portion of the EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent that the reactor is producing more heat load for which the safety systems were designed. A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes "control rods to be rapidly inserted into the core and brings power below that percent power associated with the ability of the safety systems to remove heat and continue to decrease."
This condition indicates failure of both the automatic and manual protection systems to trip the reactor in conjunction with a failure of alternate boration systems to reduce reactor power below decay heat levels. The combination of failure ofboth front line and backup protection systems to function in response to a plant transient, along with the continued production of heat poses a direct threat to fuel clad and RCS integrity and thus warrants declaration of a Site Area Emergency.
1-4
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 15 minutes is specified to allow time for emergency boration to be effective and provides a discriminator between SA2.1 and SS2.1. The classification should be made as soon as it is apparent that emergency boration is not or will not be effective in reducing reactor power below 5%.
PEG  


==Reference:==
==Reference:==
SS2.1SS4.1BasisReference(s):l.2.3.4CSFSTF-0.1,SubcriticalityFR-S.1,ResponsetoReactorRestart/ATWSFR-S.2,ResponsetoLossofCoreShutdown"MethodologyforDevelopmentofEmergencyActionLevelsNUMARC/NESP-007Revision2-QuestionsandAnswers,June19931-5 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.1Subcriticality1.1.3GeneralEmergencyREDpathinF-0.1,SUBCRITICALITYANDActualorimminententryintoeitherREDpathinF-0.2,CORECOOLINGORREDpathinF-0.3,HEATSINKMBRLRCIC:FailureoftheReactorProtectionSystemtocompleteanautomatictripandmanualtripwasnotsuccessfulandthereisindicationofanextremechallengetotheabilitytocoolthecore.FPBloss/potentialloss:N/AModeApplicability:PowerOperations,HotShutdownBasis:CSFSTSubcriticality-REDpathisenteredbasedon>5%reactorpowerfollowingareactortrip.CSFSTHeatSink-REDpathisenteredbasedonboth:~bothS/G'snarrowrangelevel<5%AND~TotalfeedwaterflowtoS/Gs<200gpmCSFSTCoreCooling-REDpathisenteredbasedoneither:~Coreexitthermocouples>1200'FOR~Coreexitthermocouples>700'FAND~RVLISlevel<43%w/noRCPs(TAF).1-6 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Thecombinationoftheseconditions(reactorpower>5%andHeatSink-REDorCoreCoolingREDpath)indicatestheultimateheatsinkfunctionisunderextremechallenge.Additionally,theeffortstobringthereactorsubcriticalhavebeenunsuccessfuland,asaresult,thereactorisproducingmoreheatloadforwhichthesafetysystemsweredesigned.Thissituationcouldbetheprecursorforacoremeltsequence.Amajorconsiderationistheinabilitytoinitiallyremoveheatduringtheearlystagesofthissequence.Ifemergencyfeedwaterflowisinsufficienttoremovetheamountofheatrequiredbydesignfromatleastonesteamgenerator,anextremechallengeshouldbeconsideredtoexist.ThisequatestoaHEATSinkREDcondition.IfCETsindicate>1200'Forare>700'FwithRVLIS<topofactivefuelaconditionindicativeofseverechallengetoheatremovalalsoexists.Intheeventthischallengeexistsatatimewhenthereactorhasnotbeenbroughtbelowthepowerassociatedwithsafetysystemdesignpower(5%)acoremeltsequenceisconsideredtoexist.Inthissituation,coredegradationcanoccurrapidly.Forthisreason,theGeneralEmergencydeclarationisintendedtobeanticipatoryofthefissionproductbarriermatrixdeclarationtopermitmaximumoffsiteinterventiontime.PEG
 
SS2.1 SS4.1 Basis Reference(s):
: l. CSFST F-0.1, Subcriticality
: 2. FR-S.1, Response to Reactor Restart/ATWS
: 3. FR-S.2, Response to Loss of Core Shutdown 4      "Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2 - Questions and Answers, June 1993 1-5
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.1    Subcriticality 1.1.3      General Emergency RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK MBRLRC IC:
Failure of the Reactor Protection System to complete an automatic trip and manual trip was not successful and there is indication of an extreme challenge to the ability to cool the core.
FPB loss/potential loss:
N/A Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Subcriticality - RED path is entered based on > 5% reactor power following a reactor trip.
CSFST Heat Sink - RED path is entered based on both:
    ~ both S/G's narrow range level < 5%
AND
    ~ Total feedwater flow to S/Gs < 200 gpm CSFST Core Cooling - RED path is entered based on either:
    ~ Core exit thermocouples >1200 'F OR
        ~ Core exit thermocouples > 700 'F AND
        ~ RVLIS level < 43% w/ no RCPs (TAF)       .
1-6
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 The combination of these conditions (reactor power > 5% and Heat Sink-RED or Core Cooling RED path ) indicates the ultimate heat sink function is under extreme challenge. Additionally, the efforts to bring the reactor subcritical have been unsuccessful and, as a result, the reactor is producing more heat load for which the safety systems were designed. This situation could be the precursor for a core melt sequence.
A major consideration is the inability to initiallyremove heat during the early stages of this sequence. Ifemergency feedwater flow is insufficient to remove the amount of heat required by design from at least one steam generator, an extreme challenge should be considered to exist. This equates to a HEAT Sink RED condition. IfCETs indicate > 1200 'F or are > 700 'F with RVLIS < top of active fuel a condition indicative of severe challenge to heat removal also exists.
In the event this challenge exists at a time when the reactor has not been brought below the power associated with safety system design power (5%) a core melt sequence is considered to exist. In this situation, core degradation can occur rapidly. For this reason, the General Emergency declaration is intended to be anticipatory of the fission product barrier matrix declaration to permit maximum offsite intervention time.
PEG  


==Reference:==
==Reference:==
SG2.1BasisReference(s):l.2.3.3.4CSFSTF-0.3,HeatSinkCSFSTF-0.1,SubcriticalityCSFSTF-0.2,CoreCoolingFR-S.1,ResponsetoReactorRestart/ATWSFR-S.2,ResponsetoLossofCoreShutdown1-7 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.2CoreCooling1.2.1SiteAreaEmergencyORANGEorREDpathinF-0.2,CORECOOLING1%JMARCIC:Completelossoffunctionneededtoachieveormaintainhotshutdownwithreactorcoolant)200'F.FPBloss/potentialloss:Fuelcladpotentialloss,RCSlossModeApplicability:PowerOperations,HotShutdownBasis:CSFSTCoreCooling-ORANGEpathisenteredbasedoneither:~Coreexitthermocouples)700'FOR~RVLISlevel(43%w/noRCPs(TAF)Eitherconditionindicatessubcoolinghasbeenlostandthatsomecladdamagemayoccur.ItmustalsobeassumedthatthelossofRCSinventoryisaresultofalossofRCSbarrier.ThereforeaSiteAreaEmergencyiswarrantedbaseduponthepotentiallossoffuelcladwithlossofRCSbarriers.PEG
 
SG2.1 Basis Reference(s):
: l. CSFST    F-0.3, Heat Sink
: 2. CSFST    F-0.1, Subcriticality
: 3. CSFST    F-0.2, Core Cooling
: 3. FR-S.1, Response to Reactor Restart/ATWS 4      FR-S.2, Response to Loss of Core Shutdown 1-7
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.2    Core Cooling 1.2.1      Site Area Emergency ORANGE or RED path in F-0.2, CORE COOLING 1%JMARC IC:
Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant ) 200 'F.
FPB loss/potential loss:
Fuel clad potential loss, RCS loss Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Core Cooling - ORANGE path is entered based on either:
    ~ Core exit thermocouples    ) 700 'F OR
    ~ RVLIS level    ( 43% w/ no RCPs  (TAF)
Either condition indicates subcooling has been lost and that some clad damage may occur. It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier. Therefore a Site Area Emergency is warranted based upon the potential loss of fuel clad with loss of RCS barriers.
PEG  


==Reference:==
==Reference:==
FC1.2FC3-.2FC4.1SS4.1BasisReference(s):1.CSFSTF-0.2,CoreCooling1-8 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.2CoreCooling1.2.2GeneralEmergencyREDpathinF-0.2,CORECOOLINGANDFunctionalrestorationproceduresnoteffectivewithin15min.NUINARCIC:N/AFPBloss/potentialloss:Fuelcladlos,Sloss,ContainmentpotentiallossModeApplicability:PowerOperations,HotShutdownBasis:CSFSTCoreCooling-REDpathisenteredbasedoneither:~Coreexitthermocouples>1200'FOR~Coreexitthermocouples>700'FAND~RVLISlevel<43%(TAF)EitherconditionindicatessignificantcoreexitsuperheatingandcoreuncoveryandisconsideredalossoftheFuelCladBarrier.ItmustalsobeassumedthatthelossofRCSinventoryisaresultofalossofRCSbarrier.Theseconditions,ifnotmitigated,willlikelyleadtocoremeltwhichwillinturnresultinapotentiallossofcontainment.Therefore,declarationofaGeneralEmergencyiswarranted.Severeaccidentanalyses(e.g.,NUREG-1150)haveconcludedthatfunctionrestorationprocedurescanarrestcoredegradationwithinthereactorvesselinasignificantfractionofthecoredamagescenarios,andthatthelikelihoodofcontainmentfailureisverysmallintheseevents.Giventhis,itisappropriatetoprovideareasonableperiodtoallowfunctionrestoration'rocedurestoarrestthecoremeltsequence.Whetherornotprocedureswillbeeffectiveshouldbeapparentwithin15minutes.TheEmergency1-9 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Coordinatorshouldmakethedeclarationassoonasitisdeterminedthattheprocedureshavenotbeen,orwillnotbeeffective.ForthepurposeofthisEALtheterm'effective'ithregardstofunctionalrestorationproceduresmeansthattheCSFSTCoreCooling-REDpathentrycriterionnolongerexists.PEG
 
FC1.2 FC3-.2 FC4.1 SS4.1 Basis Reference(s):
: 1. CSFST F-0.2, Core Cooling 1-8
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev      1 1.0    CSFST Status          1.2  Core Cooling 1.2.2      General Emergency RED path in F-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.
NUINARC IC:
N/A FPB loss/potential loss:
Fuel clad los,     S loss, Containment potential loss Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Core Cooling - RED path is entered based on either:
    ~ Core exit thermocouples > 1200 'F OR
    ~ Core exit thermocouples > 700   'F AND
    ~ RVLIS level < 43% (TAF)
Either condition indicates significant core exit superheating and core uncovery and is considered a loss of the Fuel Clad Barrier. It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.
These conditions, ifnot mitigated, will likely lead to core melt which will in turn result in a potential loss of containment. Therefore, declaration of a General Emergency is warranted.
Severe accident analyses (e. g., NUREG-1150) have concluded that function restoration procedures can arrest core degradation within the reactor vessel in a significant fraction of the core damage scenarios, and that the likelihood of containment failure is very small in these events. Given this, it is appropriate to provide a reasonable period to allow function restoration to arrest the core melt sequence. Whether or not procedures will  'rocedures be effective should be apparent within 15 minutes. The Emergency 1-9
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 Coordinator should make the declaration as soon as    it is determined that the procedures have not been, or will not be effective.
For the purpose of this EAL the term 'effective'ith regards to functional restoration procedures means that the CSFST Core Cooling - RED path entry criterion no longer exists.
PEG  


==Reference:==
==Reference:==
FC1.1PC6.1PC6.2BasisReference(s):1.CSFSTF-0.2,CoreCooling1-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.3HeatSink1.3.1SiteAreaEmergencyREDpathinF-0.3,HEATSINKNUINARCIC:Completelossoffunctionneededtoachieveormaintainhotshutdownwithreactorcoolant>200'F.FPBloss/potentialloss:Fuelcladpotentialloss,RCSpotentiallossModeApplicability:PowerOperations,HotShutdownBasis:CSFSTHeatSink-REDpathisenteredbasedonboth:~bothS/0'snarrowrangelevel<5%AND~TotalfeedwaterflowtoS/Gs<200gpmThecombinationofthesetwoconditionsindicatestheultimateheatsinkfunctionisunderextremechallenge.ThisEALaddresseslossoffunctionsrequiredforhotshutdownwiththereactoratpressureandtemperature.Undertheseconditions,thereisanactualmajorfailureofasystemintendedforprotectionofthepublicwithpotentialformultiplefissionproductbarrierloss.Therefore,declarationofaSiteAreaEmergencyiswarranted.PEG
 
FC1.1 PC6.1 PC6.2 Basis Reference(s):
: 1. CSFST F-0.2, Core Cooling 1-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.3  Heat Sink 1.3.1    Site Area Emergency RED path in F-0.3, HEAT SINK NUINARC IC:
Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant > 200 'F.
FPB loss/potential loss:
Fuel clad potential loss, RCS potential loss Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Heat Sink - RED path is entered based on both:
    ~ both S/0's narrow range level < 5%
AND
    ~ Total feedwater flow to S/Gs < 200 gpm The combination of these two conditions indicates the ultimate heat sink function is under extreme challenge. This EAL addresses loss of functions required for hot shutdown with the reactor at pressure and temperature.
Under these conditions, there is an actual major failure of a system intended for protection of the public with potential for multiple fission product barrier loss. Therefore, declaration of a Site Area Emergency is warranted.
PEG  


==Reference:==
==Reference:==
FC1.3RCS1.2SS4.1BasisReference(s):1.'SFSTF-0.3,HeatSink1-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.4Integrity1.4.1AlertREDpathonF-0.4,INTEGRITYNU1VCARCIC:N/AFPBloss/potentialloss:RCSpotentiallossModeApplicability:PowerOperations,HotShutdownBasis:CSFSTIntegrity-REDpathisenteredbasedonboth:~exceedingRCScooldownrateof100'F/hrAND~allRCScoldlegtemperaturestotheleRoftheRCSPressure/RCSColdLegTemperatureCurveThecombinationofthese'woconditionsindicatestheRCSbarrierisundersignificantchallengeandshouldbeconsideredapotentiallossofRCSbarrier.AnylossorpotentiallossofRCSbarrierwarrantsdeclarationofanAlert.PEG
 
FC1.3 RCS1.2 SS4.1 Basis Reference(s):
: 1. 'SFST      F-0.3, Heat Sink 1-11
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.4  Integrity 1.4.1      Alert RED path on F-0.4, INTEGRITY NU1VCARC IC:
N/A FPB loss/potential loss:
RCS potential loss Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Integrity - RED path is entered based on both:
    ~ exceeding RCS cooldown rate of 100 'F/hr AND
    ~ all RCS cold leg temperatures to the leR of the RCS Pressure/RCS Cold Leg Temperature Curve The combination of these'wo conditions indicates the RCS barrier is under significant challenge and should be considered a potential loss of RCS barrier.
Any loss or potential loss of RCS barrier warrants declaration of an Alert.
PEG  


==Reference:==
==Reference:==
RCS1.1BasisReference(s):*1.CSFSTF-0.4,Integrity1-12 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev11.0CSFSTStatus1.5Contaixunent1.5.1GeneralEmergencyREDpathF-0.5,CONTAINMENTNUINARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSloss,ContainmentpotentiallossModeApplicability:PowerOperations,HotShutdownBasis:CSFSTContainment-REDpathisenteredbasedonexceedingcontainmentdesignpressureof60psig.Thispressureiswellinexcessofthatexpectedfromthedesignbasislossofcoolantaccident.ThisisindicativeofalossofbothRCSandfuelcladboundariesinthatitisnotpossibletoreachthisconditionwithoutseverecoredegradation(metal-waterreaction)orfailuretoscramincombinationwithRCSbreach.Sincecontainmentpressuresatorapproachingdesignlevelsisalsoapotentiallossofcontainment,'thiscombinationofconditionsrequiresthedeclarationofaGeneralEmergency.PEG
 
RCS1.1 Basis Reference(s):
*1. CSFST F-0.4, Integrity 1-12
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 1.0    CSFST Status        1.5    Contaixunent 1.5.1      General Emergency RED path F-0.5, CONTAINMENT NUINARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Power Operations, Hot Shutdown Basis:
CSFST Containment - RED path is entered based on exceeding containment design pressure of 60 psig. This pressure is well in excess of that expected from the design basis loss of coolant accident. This is indicative of a loss of both RCS and fuel clad boundaries in that it is not possible to reach this condition without severe core degradation (metal-water reaction) or failure to scram in combination with RCS breach. Since containment pressures at or approaching design levels is also a potential loss of containment,'this combination of conditions requires the declaration of a General Emergency.
PEG  


==Reference:==
==Reference:==
PC1.1BasisReference(s):1.CSFSTF-0.5,Containment1-13 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Thereactorfuelcladdingservesastheprimaryfissionproductbarrier.Overtheusefullifeofafuelbundle,theintegrityofthisbarriershouldremainintactaslongasfuelcladdingintegritylimitsarenotexceeded.Should'fueldamageoccur(breachofthefuelcladdingintegrity)radioactivefissionproductsarereleasedtothereactorcoolant.Themagnitudeofsuchareleaseisdependentupontheextentofthedamageaswellasthemechanismbywhichthedamageoccurred.Oncereleasedintothereactorcoolant,thehighly,radioactivefissionproductscanposesignificantradiologicalhazardsinplantfromreactorcoolantprocessstreams.Ifotherfissionproductbarriersweretofail,theseradioactivefissionproductscanposesignificantoffsiteradiologicalconsequences.Thefollowingparameters/indicatorsareindicativeofpossiblefuelfailures:A'gai,t1fiproductactivityisverylow.Smallconcentrationsoffissionproductsin'hecoolantareprimarilyfromthefissionoftrampuraniuminthefuelcladdingorminorperforationsinthecladdingitself.Anysignificantincreasefromthesebase-linelevelsisindicativeoffuelfailures.~FilFl0'Aswithcoolantactivity,anyfuelfailureswillreleasefissionproductstothereactorcoolant.ThesefissionproductswillbecirculatedwiththereactorcoolantandbedetectedbythefailedfuelradiationdetectorintheRCSletdownline.inAlthoughnotadirectindicationormeasurementoffueldamage,exceedingpredeterminedlimitsoncontainmenthighrangeradiationmonitorsunderLOCAconditionsisindicativepossiblefuelfailures.~flinA'riinMnir'othareaandprocessradiationmonitoringsystemsdesignedtodetectfissionproductsduringrefuelingconditionsaswellasvisualobservationcanbeutilizedtoindicatelossorpotentiallossofspentfuelcladdingintegrity.2-1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.1CoolantActivity2.1.1UnusualEventCoolantsampleactivity:)100%of84/Ebarp,Ci/cctotalspecificactivityOR>0.2p,Ci/gmI-131equivalentandtheconditionsofTechnicalSpecifications3.1.4.3.bareexceededNUINARCIC:FuelcladdegradationFPBloss/potentialloss:N/AModeApplicability:Basis:Elevatedreactorcoolantactivityrepresentsapotentialdegradationinthelevelofsafetyoftheplantandapotentialprecursorofmoreseriousproblems.ThisEALaddressesreactorcoolantsamplesexceedingcoolanttechnicalspecifications.PEG
 
PC1.1 Basis Reference(s):
: 1. CSFST F-0.5, Containment 1-13
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev      1 The reactor fuel cladding serves as the primary fission product barrier. Over the useful life of a fuel bundle, the integrity of this barrier should remain intact as long as fuel cladding integrity limits are not exceeded.
Should'fuel damage occur (breach of the fuel cladding integrity) radioactive fission products are released to the reactor coolant. The magnitude of such a release is dependent upon the extent of the damage as well as the mechanism by which the damage occurred. Once released into the reactor coolant, the highly, radioactive fission products can pose significant radiological hazards inplant from reactor coolant process streams. Ifother fission product barriers were to fail, these radioactive fission products can pose significant offsite radiological consequences.
The following parameters/indicators are indicative of possible fuel failures:
A g      a        i,       t      1  fi product activity is very low. Small concentrations of fission products coolant are primarily from the fission of tramp uranium in the fuel in'he cladding or minor perforations in the cladding itself. Any significant increase from these base-line levels is indicative of fuel failures.
    ~ F il F l 0'             As with coolant activity, any fuel failures will release fission products to the reactor coolant. These fission products will be circulated with the reactor coolant and be detected by the failed fuel radiation detector in the RCS letdown line.
i    n                        Although not a direct indication or measurement of fuel damage, exceeding predetermined limits on containment high range radiation monitors under LOCA conditions is indicative possible fuel failures.
    ~     f  lin A                  r    i i nM ni r 'othareaand process radiation monitoring systems designed to detect fission products during refueling conditions as well as visual observation can be utilized to indicate loss or potential loss of spent fuel cladding integrity.
2-1
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.1  Coolant Activity 2.1.1      Unusual Event Coolant sample activity:
      )100% of 84/E bar p,Ci/cc total specific activity OR
      > 0.2 p,Ci/gm I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded NUINARC IC:
Fuel clad degradation FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.
This EAL addresses reactor coolant samples exceeding coolant technical specifications.
PEG  


==Reference:==
==Reference:==
SU4.2BasisReference(s):1.TechnicalSpecificationssection3.1.42-2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.1CoolantActivity2.1.2AlertCoolantactivity>300p.Ci/ccI-131equivalentIMUIKARCIC:N/AFPBloss/potentialloss:FuelcladlossModeApplicability:Poweroperation,hotshutdownBasis:Elevatedreactorcoolantactivityrepresentsapotentialdegradationinthelevelofsafetyoftheplantandapotentialprecursorofmoreseriousproblems.Thisamountofcoolantactivitycorrespondstoabout2%to5%fuelcladdamage.Whenreactorcoolantactivityreachesthislevel,significantcladheatinghasoccurredandthusthefuelcladbarrierisconsideredlost.Therefore,declarationofanAlertiswarranted.PEG
 
SU4.2 Basis Reference(s):
: 1.     Technical Specifications section 3.1.4 2-2
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.1    Coolant Activity 2.1.2 Alert Coolant activity > 300 p.Ci/cc I-131 equivalent IMUIKARCIC:
N/A FPB loss/potential loss:
Fuel clad loss Mode Applicability:
Power operation, hot shutdown Basis:
Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.
This amount of coolant activity corresponds to about 2% to 5% fuel clad damage. When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.
Therefore, declaration of an Alert is warranted.
PEG  


==Reference:==
==Reference:==
FC2.1BasisReference(s):None2-3  
 
,OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.1CoolantActivity2.1.3SiteAreaEmergencyCoolantactivity>300pCi/ccI-131equivalentandanyofthefollowing:~REDpathonF-0.4,INTEGRITY~Primarysystemleakage>46gpm~RCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakageMMARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSpotentialloss/lossNodeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressescombinationsoffuelcladlosswithRCSlossandpotentiallossindicators.300pCi/ccI-131equivalentcoolantactivitycorrespondstoabout2%to5%fuelcladdamage.Whenreactorcoolantactivityreachesthislevel,significantcladheatinghasoccurredandthusthefuelcladbarrierisconsideredlost.ThisconditionincombinationwithanyofthefollowingRCSloss/potentiallossindicatorswarrantsdeclarationofaSiteAreaEmergency:REDpathonF-0.4,INTEGRITY:REDpathindicatesanextremechallengetothesafetyfunctionderivedfromappropriateinstrumentreadings,andindicatesapotentiallossofRCSbarrier.RCSsubcooling<EOPFig.MINSUBCOOLING:Thisindicatoraddresses'conditionswhereleakagefromtheRCSisgreaterthanavailableinventorycontrolcapacitysuchthatalossofsubcoolinghasoccurred.ThelossofsubcoolingasdeterminedfromE-O,ReactorTriporSafetyInjectionisthe.fundamentalindicationthattheinventorycontrolsystemsareinadequateinmaintainingRCSpressureandinventoryagainstthemasslossthroughaleak.
FC2.1 Basis Reference(s):
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Primarysystemleakage>46gpm:ThispotentiallossofRCSisbasedontheinabilitytomaintainnormalliquidinventorywithintheReactorCoolantSystem(RCS)bynormaloperationoftheChemicalandVolumeControlSystemwhichisconsideredastwopositivedisplacementchargingpumpsdischargingtothechargingheader.PEG
None 2-3
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel      2.1    Coolant Activity 2.1.3 Site Area Emergency Coolant activity > 300 pCi/cc I-131 equivalent and any of the following:
      ~   RED path on F-0.4, INTEGRITY
      ~   Primary system leakage > 46 gpm
      ~   RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage MMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS potential loss/loss Node Applicability:
Power operation, hot shutdown Basis:
This EAL addresses combinations of fuel clad loss with RCS loss and potential loss indicators.
300 pCi/cc I-131 equivalent coolant activity corresponds to about 2% to 5%
fuel clad damage. When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.
This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:
RED path on F-0.4, INTEGRITY:           RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.
RCS subcooling < EOP Fig. MIN SUBCOOLING: This indicator addresses
  'conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the .
fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Primary system leakage > 46 gpm:       This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.
PEG  


==Reference:==
==Reference:==
FC2.1+RCS1.1,RCS2.1andRCS2.2BasisReference(s):1.2.3.45.EPIP-2-16"CoreDamageEstimation"CSFSTF-0.4IntegrityE-O,ReactorTriporSafetyInjectionTechnicalSpecificationsSection3.1.5.2FSARTable9.3.62-5 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.2FailedFuelDetectors2.2.1UnusualEventLetdownLineMonitorR-9>2R/hrNUMARCIC:FuelcladdegradationFPBloss/potentialloss:N/AModeApplicability:Basis:Elevatedletdownlineactivityrepresentsapotentialdegradationinthelevelofsafetyoftheplantandapotentialprecursorofmoreseriousproblems.Thisradiationlevel(2H/hr)correspondsto1%fuelfailure(basesfortheTechnicalSpecificationscoolantactivitylimits).Therefore,declarationofanUnusualEventiswarranted.PEG
 
FC2.1+       RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):
: 1. EPIP 16 "Core Damage Estimation"
: 2. CSFST F-0.4 Integrity
: 3. E-O, Reactor Trip or Safety Injection 4      Technical Specifications Section 3.1.5.2
: 5. FSAR Table 9.3.6 2-5
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.2    Failed Fuel Detectors 2.2.1 Unusual Event Letdown Line Monitor R-9 > 2 R/hr NUMARC IC:
Fuel clad degradation FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Elevated letdown line activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.
This radiation level (2 H/hr) corresponds to 1% fuel failure (bases for the Technical Specifications coolant activity limits). Therefore, declaration of an Unusual Event is warranted.
PEG  


==Reference:==
==Reference:==
SU4.1BasisReference(s):1.TechnicalSpecificationssection3.1.42.P-9"RadiationMonitoringSystem"3.EPIP2-16section6.2.l.b2-6 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.2FailedFuelDetectors2.2.2AlertLetdownLineMonitorR-9>10R/hrMMARCIC:N/AFPBloss/potentialloss:FuelcladlossModeApplicability:Poweroperation,hotshutdownBasis:Thisconditionindicatesthelossofthefuelcladbarrier.FailedFuelMonitorreadingsof2R/hrcorrespondsto1%fuelfailures.FailedFuelMonitorreadingsof10R/hrcorrespondsto5%fuelfailuresandisconsideredanactuallossoffuelclad.Note:MonitorR-9automaticallyshiftsscalefrommR/hrtoR/hrwhenindicatedvaluesexceed1000mR/hr.PEG
 
SU4.1 Basis Reference(s):
: 1. Technical Specifications section 3.1.4
: 2. P-9 "Radiation Monitoring System"
: 3. EPIP 2-16 section 6.2.l.b 2-6
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.2    Failed Fuel Detectors 2.2.2 Alert Letdown Line Monitor R-9 > 10 R/hr MMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss Mode Applicability:
Power operation, hot shutdown Basis:
This condition indicates the loss of the fuel clad barrier. Failed Fuel Monitor readings of 2 R/hr corresponds to 1% fuel failures. Failed Fuel Monitor readings of 10 R/hr corresponds to 5% fuel failures and is considered an actual loss of fuel clad.
Note: Monitor R-9 automatically shifts scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.
PEG  


==Reference:==
==Reference:==
FC6.1BasisReference(s):l.EPIP-2-16"CoreDamageEstimation"2.P-9"RadiationMonitoringSystem"3.EPIP2-16section6.2.1.b2-7 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.2FailedFuelDetectors2.2.3SiteAreaEmergencyLetdownLineMonitorR-9>108/hrandanyofthefollowing:~REDpathonF-0.4,INTEGRITY~Primarysystemleakage>46gpm~RCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakageNUIKARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSpotentiallossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressescombinationsoffuelclad.losswithRCSlossandpotentiallossindicators.FailedFuelMonitorreadingsof10R/hrcorrespondsto5%fuelfailures.Thisconditionindicatesthelossofthefuelcladbarrier.Note:MonitorR-9automaticallyshiRsscalefrommR/hrtoR/hrwhenindicatedvaluesexceed1000mR/hr.ThisconditionincombinationwithanyofthefollowingRCSloss/potentiallossindicatorswarrantsdeclarationofaSiteAreaEmergency:REDpathonF-0.4,INTEGRITY:REDpathindicatesanextremechallengetothesafetyfunctionderivedfromappropriateinstrumentreadings,andindicatesapotentiallossofRCSbarrier.RCSsubcooling<EOPFig.MINSUBCOOLING:ThisindicatoraddressesconditionswhereleakagefromtheRCSisgreaterthanavailableinventorycontrolcapacitysuchthatalossofsubcoolinghasoccurred.ThelossofsubcoolingasdeterminedfromE-O,ReactorTriporSafetyInjectionisthefundamentalindicationthattheinventorycontrolsystemsareinadequateinmaintainingRCSpressureandinventoryagainstthemasslossthroughaleak.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Primarysystemleakage>46gpm:ThispotentiallossofRCSisbasedontheinabilitytomaintainnormalliquidinventorywithintheReactorCoolantSystem(RCS)bynormaloperationoftheChemicalandVolumeControlSystemwhichisconsideredastwopositivedisplacementchargingpumpsdischargingtothechargingheader.PEG
FC6.1 Basis Reference(s):
: l. EPIP 16 "Core Damage Estimation"
: 2. P-9 "Radiation Monitoring System"
: 3. EPIP 2-16 section 6.2.1.b 2-7
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.2  Failed Fuel Detectors 2.2.3 Site Area Emergency Letdown Line Monitor R-9 > 10 8/hr and any of the following:
    ~ RED path on F-0.4, INTEGRITY
    ~ Primary system leakage > 46 gpm
    ~ RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage NUIKARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS potential loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses combinations of fuel clad. loss with RCS loss and potential loss indicators.
Failed Fuel Monitor readings of 10 R/hr corresponds to 5% fuel failures. This condition indicates the loss of the fuel clad barrier. Note: Monitor R-9 automatically shiRs scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr. This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:
RED path on F-0.4, INTEGRITY:             RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.
RCS subcooling < EOP Fig. MIN SUBCOOLING: This indicator addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 Primary system leakage > 46 gpm:           This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.
PEG  


==Reference:==
==Reference:==
FC6.1+RCS1.1,RCS2.1andRCS2.2BasisReference(s):1.2.3.45.6.7.EPIP-2-16"CoreDamageEstimation"CSFSTF-0.4IntegrityE-O,ReactorTriporSafetyInjectionF-0.5,ContainmentFR-Z.1,ResponsetoHighContainmentRadiationLevelTechnicalSpecificationsSection3.1.5.2FSARTable9.3.62-9 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.3ContainmentRadiation2.3.1AlertContainmentradiationmonitorR-29/R-30reading)10R/hrMB4ARCIC:N/AFPBloss/potentialloss:RCSlossModeApplicability:Poweroperation,hotshutdownBasis:Thel0R/hrreadingisavaluewhichindicatesthereleaseofreactorcoolanttothecontainment.Thereadingwasderivedassumingtheinstantaneousreleaseanddispersalofthereactorcoolantnoblegasandiodineinventoryassociatedwithnormaloperatingconcentrations(i.e.,withinT/S)intothecontainmentatmosphere.ThisEALisindicativeofaRCSleakonly.IftheradiationmonitorreadingincreasedtothatspecifiedbyReactorFuelEAL2.3.2,significantfueldamagewouldalsobeindicated.PEG
 
FC6.1+         RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):
: 1. EPIP   16 "Core Damage Estimation"
: 2. CSFST F-0.4 Integrity
: 3. E-O, Reactor  Trip or Safety Injection 4      F-0.5, Containment
: 5. FR-Z.1, Response to High Containment Radiation Level
: 6. Technical Specifications Section 3.1.5.2
: 7. FSAR Table 9.3.6 2-9
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.3    Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading    ) 10 R/hr MB4ARC IC:
N/A FPB loss/potential loss:
RCS loss Mode Applicability:
Power operation, hot shutdown Basis:
Thel0 R/hr reading is a value which indicates the release of reactor coolant to the containment. The reading was derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with normal operating concentrations (i. e., within T/S) into the containment atmosphere. This EAL is indicative of a RCS leak only. Ifthe radiation monitor reading increased to that specified by Reactor Fuel EAL 2.3.2, significant fuel damage would also be indicated.
PEG  


==Reference:==
==Reference:==
RCS4.1BasisReference(s):1.F-0.5,Containment2.FR-Z.1,ResponsetoHighContainmentRadiationLevel3.EPIP2-16,CoreDamageEstimation2-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.3ContainmentRadiation2.3.2SiteAreaEmergencyContainmentradiationmonitorR-29/R-30reading>100R/hrNUMARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSlossModeApplicability:Poweroperation,hotshutdownBasis:The100R/hrreadingisavaluewhichindicatesthereleaseofreactorcoolant,withelevatedactivityindicativeoffueldamage,intothecontainment.Thereadingisderivedassumingtheinstantaneousreleaseanddispersalofthereactorcoolantnoblegasandiodineinventoryassociatedwithaconcentrationof300p.Ci/gmdoseequivalentI-131intothecontainmentatmosphere.Reactorcoolantconcentrationsofthismagnitudeareseveraltimeslargerthanthemaximumconcentrations(includingiodinespiking)allowedwithintechnicalspecificationsandarethereforeindicativeoffueldamage(approximately2-5%cladfailuredependingoncoreinventoryandRCSvolume).ThisvalueishigherthanthatspecifiedinEAL2.3.1whichwouldbeindicativeofonlytheRCSbarrier.Thus,thisEALindicatesalossofboththefuelcladbarrierandalossofRCSbarrierwarrantingdeclarationofaSiteAreaEmergency.PEG
 
RCS4.1 Basis Reference(s):
: 1. F-0.5, Containment
: 2. FR-Z.1, Response to High Containment Radiation Level
: 3. EPIP 2-16, Core Damage Estimation 2-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.3  Containment Radiation 2.3.2 Site Area Emergency Containment radiation monitor R-29/R-30 reading > 100 R/hr NUMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS loss Mode Applicability:
Power operation, hot shutdown Basis:
The 100 R/hr reading is a value which indicates the release of reactor coolant, with elevated activity indicative of fuel damage, into the containment. The reading is derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with a concentration of 300 p.Ci/gm dose equivalent I-131 into the containment atmosphere. Reactor coolant concentrations of this magnitude are several times larger than the maximum concentrations (including iodine spiking) allowed within technical specifications and are therefore indicative of fuel damage (approximately 2-5 % clad failure depending on core inventory and RCS volume). This value is higher than that specified in EAL 2.3.1 which would be indicative of only the RCS barrier. Thus, this EAL indicates a loss of both the fuel clad barrier and a loss of RCS barrier warranting declaration of a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
FC5.1BasisReference(s):1.P-9,RadiationMonitoringSystem,Section2.2.2.6,pg.P-9:22.EPIP2-16,CoreDamageEstimation2-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.3ContainmentRadiation2.3.3GeneralEmergencyContainmentradiationmonitorR-29/R-30reading>1000R/hrNUINARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSloss,ContainmentpotentiallossModeApplicability:Poweroperation,hotshutdownBasis:The1000H/hrreadingisavaluewhichindicatessignificantfueldamage(>20%cladfailure)wellinexcessoftheEALsassociatedwithbothlossoffuelcladandlossofRCSbarriers.Amajorreleaseofradioactivityrequiringoffsiteprotectiveactionsfromcoredamageisnotpossibleunlessamajorfailureoffuelcladdingallowsradioactivematerialtobereleasedfromthecoreintothereactorcoolant.Regardlessofwhethercontainmentischallenged,thisamountofactivityincontainment,ifreleased,couldhavesuchsevereconsequencesthatitisprudenttotreatthisasapotentiallossofcontainment,suchthataGeneralEmergencydeclarationiswarranted.NUREG-1228"SourceEstimationsDuringIncidentResponsetoSevereNuclearPowerPlantAccidents,"indicatesthatsuchconditionsdonotexistwhentheamountofcladdamageislessthan20%.PEG
 
FC5.1 Basis Reference(s):
: 1. P-9, Radiation Monitoring System, Section 2.2.2.6, pg. P-9:2
: 2. EPIP 2-16, Core Damage Estimation 2-11
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.3    Containment Radiation 2.3.3 General Emergency Containment radiation monitor R-29/R-30 reading > 1000 R/hr NUINARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Power operation, hot shutdown Basis:
The 1000 H/hr reading is a value which indicates significant fuel damage
(>20% clad failure) well in excess of the EALs associated with both loss of fuel clad and loss of RCS barriers. A major release of radioactivity requiring offsite protective actions from core damage is not possible unless a major failure of fuel cladding allows radioactive material to be released from the core into the reactor coolant. Regardless of whether containment is challenged, this amount of activity in containment, ifreleased, could have such severe consequences that it is prudent to treat this as a potential loss of containment, such that a General Emergency declaration is warranted.
NUREG-1228 "Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents," indicates that such conditions do not exist when the amount of clad damage is less than 20%.
PEG  


==Reference:==
==Reference:==
PC5.12-12 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.2.3.EPIP1-0,GinnaStationEventEvaluationandClassificationEPIP2-16,CoreDamageEstimationNUREG-1228"SourceEstimationsDuringIncidentResponsetoSevereNuclearPowerPlantAccidents"TechnologyforEnergyReportNo.R-81-0122-13 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.3RefuelingAccidentsorOtherRadiationMonitors2.4.1UnusualEventSpentfuelpool(reactorcavityduringrefueling)waterlevelcannotberestoredandmaintainedabovethespentfuelpoollowwaterlevelalarmsetpointNl3EIARCIC:Unexpectedincreaseinplantradiationorairborneconcentration.FPBloss/potentialloss:N/AModeApplicability:Basis:InlightofReactorCavitySealfailure,incidentsattwodifferentPWRsandlossofwaterintheSpentFuelPit/FuelTransferCanalataBWRalloccurringsince1984,explicitcoverageofthesetypesofeventsviaEALs&#xb9;1and&#xb9;2isappropriategiventheirpotentialforincreaseddosestoplantstaKClassificationasanUnusualEventiswarrantedasaprecursortoamoreseriousevent.Thespentfuelpoollowwaterlevelalarmsetpointof20in.belowtopofpoolisactuatedbyLC-661.Thedefinitionof"...cannotberestoredandmaintainedabove..."allowstheoperatortovisuallyobservethelowwaterlevelcondition,ifpossible,andtoattemptwaterlevelrestorationinstructionsaslongaswaterlevelremainsabovethetopofirradiatedfuel.WaterlevelrestorationinstructionsforlossofrefuelingcavitywaterlevelduringrefuelingareperformedinaccordancewiththeRF-65seriesofprocedures.Whenthefueltransfercanalisdirectlyconnectedtothespentfuelpoolandreactorcavity,therecouldexistthepossibilityofuncoveringirradiatedfuelinthefueltransfercanal.Therefore,thisEALisapplicableforconditionsi'whichirradiatedfuelisbeingtransferredtoandfromtheRPVandspentfuelpool.2-14T OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
 
PC5.1 2-12
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. EPIP 1-0, Ginna Station Event Evaluation and Classification
: 2. EPIP 2-16, Core Damage Estimation
: 3. NUREG-1228 "Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents" Technology for Energy Report No. R-81-012 2-13
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel        2.3  Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint Nl3EIARC IC:
Unexpected increase in plant radiation or airborne concentration.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
In light of Reactor Cavity Seal failure, incidents at two different PWRs and loss of water in the Spent Fuel Pit/Fuel Transfer Canal at a BWR all occurring since 1984, explicit coverage of these types of events via EALs &#xb9;1 and &#xb9;2 is appropriate given their potential for increased doses to plant staK Classification as an Unusual Event is warranted as a precursor to a more serious event.
The spent fuel pool low water level alarm setpoint of 20 in. below top of pool is actuated by LC-661. The definition of "... cannot be restored and maintained above ..." allows the operator to visually observe the low water level condition, ifpossible, and to attempt water level restoration instructions as long as water level remains above the top of irradiated fuel. Water level restoration instructions for loss of refueling cavity water level during refueling are performed in accordance with the RF-65 series of procedures.
When the fuel transfer canal is directly connected to the spent fuel pool and reactor cavity, there could exist the possibility of uncovering irradiated fuel in the fuel transfer canal. Therefore, this EAL is applicable for conditions i' which irradiated fuel is being transferred to and from the RPV and spent fuel pool.
2-14 T
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
AU2.1BasisReference(s):1.ER-SFP.1"LossofSpentFuelPitCooling"2.AR-K-293.RF-65series2-15 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel2.3RefuelingAccidentsorOtherRadiationMonitors2.4.2AlertConfirmedsustainedalarmonanyofthefollowingradiationmonitorsresultingfromanuncontrolledfuelhandlingprocess:~R-2ContainmentAreaMonitor~R-5SpentFuelPit~R-12ContainmentNobleGasNUMARCIC:Majordamagetoirradiatedfuelorlossofwaterlevelthathasorwillresultintheuncoveringofirradiatedfueloutsidethereactorvessel.FPBloss/potentialloss:N/AModeApplicability:AllBasis:NUREG-0818,"EmergencyActionLevelsforLightWaterReactors,"formsthebasisforthisEAL.ThisEALisdefinedbythespecificareawhereirradiatedfuelislocatedsuchasreactorcavity,reactorvessel,orspentfuelpool.NUREG/CR-4982,"SevereAccidentinSpentFuelPoolsinSupport,ofGenericSafetyIssue82,"July1987,indicatesthatevenifcorrectiveactionsarenottaken,nopromptfatalitiesarepredicted,andthatriskofinjuryislow.Inaddition,NRCInformationNoticeNo.90-08,"KR-85HazardsfromDecayedFuel"presentsthefollowinginitsdiscussion:"Intheeventofaseriousaccidentinvolvingdecayedspentfuel,protectiveactionswouldbeneededforpersonnelonsite,whileoffsitedoses(assuminganexclusionarearadiusofonemilefromtheplantsite)wouldbewellbelowtheEnvironmentalProtecti'onAgency'sProtectiveActionGuides.Accordingly,itisimportanttobeabletoproperlysurveyandmonitorforKr-85intheeventofanaccidentwith'decayedspentfuel."2-16 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1WAn"uncontrolledfuelhandlingprocess"isdefinedasanyeventoractivityrelatedtothemovementofirradiatedfuelwhichresultsinunexpectedoruncontrolledconditions.Thisterminologyhasbeenspecificallyaddedtoexcludeanticipatedincreasesinarearadiationlevelsasaresultofactionsperformedinaccordancewithapprovedproceduresduringrefuelingoperations.Thus,anAlertClassificationforthiseventisappropriate.Escalation,ifappropriate,wouldoccurviaEmergencyCoordinatorjudgmentinEALCategory9.0.ThebasisfortheContainmentAreaMonitorsetpoint(50mR/hr)andSpentFuelPitmonitorsetpoint(25mH/hr)areaspentfuelhandlingaccidentandis,therefore,appropriateforthisEAL.PEG
 
AU2.1 Basis Reference(s):
: 1. ER-SFP.1 "Loss of Spent Fuel Pit Cooling"
: 2. AR-K-29
: 3. RF-65 series 2-15
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 2.0      Reactor Fuel        2.3    Refueling Accidents or Other Radiation Monitors 2.4.2 Alert Confirmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:
      ~   R-2 Containment Area Monitor
      ~   R-5 Spent Fuel Pit
      ~   R-12 Containment Noble Gas NUMARC IC:
Major damage to irradiated fuel or loss of water level that has or willresult in the uncovering of irradiated fuel outside the reactor vessel.
FPB loss/potential loss:
N/A Mode Applicability:
All Basis:
NUREG-0818, "Emergency Action Levels for Light Water Reactors," forms the basis for this EAL. This EAL is defined by the specific area where irradiated fuel is located such as reactor cavity, reactor vessel, or spent fuel pool.
NUREG/CR-4982, "Severe Accident in Spent Fuel Pools in Support, of Generic Safety Issue 82," July 1987, indicates that even ifcorrective actions are not taken, no prompt fatalities are predicted, and that risk of injury is low. In addition, NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" presents the following in its discussion:
    "In the event of a serious accident involving decayed spent fuel, protective actions would be needed for personnel on site, while offsite doses (assuming an exclusion area radius of one mile from the plant site) would be well below the Environmental Protecti'on Agency's Protective Action Guides. Accordingly, it is important to be able to properly survey and monitor for Kr-85 in the event of an accident with
    'decayed spent fuel."
2-16
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 W
An "uncontrolled fuel handling process" is defined as any event or activity related to the movement of irradiated fuel which results in unexpected or uncontrolled conditions. This terminology has been specifically added to exclude anticipated increases in area radiation levels as a result of actions performed in accordance with approved procedures during refueling operations.
Thus, an Alert Classification for this event is appropriate. Escalation, if appropriate, would occur via Emergency Coordinator judgment in EAL Category 9.0.
The basis for the Containment Area Monitor setpoint (50 mR/hr) and Spent Fuel Pit monitor setpoint (25 mH/hr) are a spent fuel handling accident and is, therefore, appropriate for this EAL.
PEG  


==Reference:==
==Reference:==
AA2.1BasisReference(s):1.2.3.P-9RadiationMonitoringSystemNUREG-0818,"EmergencyActionLevelsforLightWaterReactors,"NUREG/CR-4982,"SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82"2-17 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev12.0ReactorFuel'.3RefuelingAccidentsorOtherRadiationMonitors2.4.3AlertReportofvisualobservationofirradiatedfueluncoveredMBCARCIC:Majordamagetoirradiatedfuelorlossofwaterlevelthathasorwillresultintheuncoveringofirradiatedfueloutsidethereactorvessel.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALisdefinedbythespecificareaswhereirradiatedfuelislocatedsuchasreactorcavity,orspentfuelpool.Thereisnoindicationthatwaterlevelinthespentfuelpoolorrefuelingcavityhasdroppedtothelevelofthefuelotherthanbyvisualobservation.Sincethereisnolevelindicatingsysteminthefueltransfercanal,visualobservationoflossofwaterlevelwouldalsoberequired.SuQicienttimeexiststotakecorrectiveactionsfortheseconditionsandthereislittlepotentialforsubstantialfueldamage.NUREG/CR-4982"SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82"indicatesthatevenifcorrectiveactionsarenottaken,nopromptfatalitiesarepredictedandtheriskofinjuryislow.Inaddition,NRCInformationNoticeNo.90-08,"KR-85HazardsfromDecayedFuel"presentsthefollowingititsdiscussion:"Intheeventofaseriousaccidentinvolvingdecayedspentfuel,protectiveactionswouldben'cededforpersonnelonsite,whileoQ'sitedoses(assuminganexclusionarearadiusofonemilefromtheplantsite)wouldbewellbelowtheEnvironmentalProtectionAgency'sProtectiveActionGuides.Accordingly,itisimportanttobeabletoproperlysurvey2-18 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1andmonitorforKr-85intheeventofanaccidentwithdecayedspentfuel.Thus,anAlertClassificationforthiseventisappropriate.Escalation,ifappropriate,wouldoccurviaradioactivityreleasecategory5.0orEmergencyCoordinatorjudgmentinEALCategory9.0.ThisEALappliestospentfuelrequiringwatercoverageandisnotintendedtoaddressspentfuelwhichislicensedfordrystorage.PEG
 
AA2.1 Basis Reference(s):
: 1.     P-9 Radiation Monitoring System
: 2.     NUREG-0818, "Emergency Action Levels for Light Water Reactors,"
: 3.      NUREG/CR-4982, "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" 2-17
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 2.0    Reactor Fuel      '.3      Refueling Accidents or Other Radiation Monitors 2.4.3 Alert Report of visual observation of irradiated fuel uncovered MBCARC IC:
Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL is defined by the specific areas where irradiated fuel is located such as reactor cavity, or spent fuel pool.
There is no indication that water level in the spent fuel pool or refueling cavity has dropped to the level of the fuel other than by visual observation.
Since there is no level indicating system in the fuel transfer canal, visual observation of loss of water level would also be required.
SuQicient time exists to take corrective actions for these conditions and there is little potential for substantial fuel damage. NUREG/CR-4982 "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" indicates that even ifcorrective actions are not taken, no prompt fatalities are predicted and the risk of injury is low. In addition, NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" presents the following it its discussion:
      "In the event of a serious accident involving decayed spent fuel, protective actions would be n'ceded for personnel on site, while oQ'site doses (assuming an exclusion area radius of one mile from the plant site) would be well below the Environmental Protection Agency's Protective Action Guides. Accordingly, it is important to be able to properly survey 2-18
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 and monitor for Kr-85 in the event of an accident with decayed spent fuel.
Thus, an Alert Classification for this event is appropriate. Escalation, if appropriate, would occur via radioactivity release category 5.0 or Emergency Coordinator judgment in EAL Category 9.0.
This EAL applies to spent fuel requiring water coverage and is not intended to address spent fuel which is licensed for dry storage.
PEG  


==Reference:==
==Reference:==
AA2.2BasisReference(s):1.2.P-9RadiationMonitoringSystemNUREG/CR-4982"SevereAccidentinSpentFuelPoolsinSupportofGenericSafetyIssue82".NRCInformationNoticeNo.90-08,"KR-85HazardsfromDecayedFuel"2-19 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Thereactorvesselprovidesavolumeforthecoolantwhichcoversthereactorcore.Thereactorvesselandassociatedpressurepiping(reactorcoolantsystem)togetherprovideabarriertolimitthereleaseofradioactivematerialshouldthereactorfuelcladdingintegrityfail.TherearethreeRCSparameterswhichareindicativeofconditionswhichmayposeathreattoRCSorfuelcladdingintegrity:SCfLtlRR*(>>Tll1ST'fitl)RCSltgindicationsareutilizedtoindicatepotentialpipecrackswhichmaypropagatetoanextentthreateningfuelclad,RCSandcontainmentintegrity.RCSleakageofadegreerequiringECCStomaintainRCSinventoryposesadirectthreattofuelcladintegrity.Reactorvesselwaterlevelisalsodirectlyrelatedtothestatusofadequatecorecooling,andthereforefuelcladdingintegrity.nAsubsetofRCSleakage,excessiveprimarytosecondaryleakageinconjunctionwithunisolablesecondaryreleasestoenvironmentmayresultinlossesofcontainmentintegrityaswellasthreatenfuelcladintegrityformoresevereSGtuberuptures.AlfRCSAllglfdtlldlthattheinventorycontrolsystemsareinadequateinmaintainingRCSpressureandinventoryagainstmasslossthroughaleak.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.1.1UnusualEvent3.1RCSLeakageUnidentifiedorpressureboundaryleakage>10gpmORIdentifiedleakage>25gpmNUMARCIC:RCSleakagewhengreaterthan200'FFPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:TheconditionsofthisEALmaybeaprecursorofmoreseriousconditionsand,asaresult,isconsideredtobeapotentialdegradationofthelevelofsafetyoftheplant.The10gpmvalueforthe.unidentifiedleakageandpressureboundaryleakagewasselectedbecauseitisobservablewithnormalControlRoomindications.Smallervaluesmustbedeterminedthroughtime-consumingsurveillancetests(e.g.,massbalances).The25gpmvalueforidentifiedleakageissetatahighervaluebecauseofthesignificanceofidentifiedleakageincomparisontounidentifiedorpressureboundaryleakage.Onlyoperatingmodesinwhichthereisfuelinthereactorcoolantsystemandthesystemispressurizedarespecified.PEG
AA2.2 Basis Reference(s):
: 1. P-9 Radiation Monitoring System
: 2. NUREG/CR-4982 "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82".
NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" 2-19
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 The reactor vessel provides a volume for the coolant which covers the reactor core. The reactor vessel and associated pressure piping (reactor coolant system) together provide a barrier to limit the release of radioactive material should the reactor fuel cladding integrity fail.
There are three RCS parameters which are indicative of conditions which may pose a threat to RCS or fuel cladding integrity:
SCfLtlRR*                   (>>T l l    1ST    'fi tl )RCSl      tg indications are utilized to indicate potential pipe cracks which may propagate to an extent threatening fuel clad, RCS and containment integrity. RCS leakage of a degree requiring ECCS to maintain RCS inventory poses a direct threat to fuel clad integrity. Reactor vessel water level is also directly related to the status of adequate core cooling, and therefore fuel cladding integrity.
n                  A subset of RCS leakage, excessive primary to secondary leakage in conjunction with unisolable secondary releases to environment may result in losses of containment integrity as well as threaten fuel clad integrity for more severe SG tube ruptures.
Al      fRCS A ll gl f d                  t ll dl that the inventory control systems are inadequate in maintaining RCS pressure and inventory against mass loss through a leak.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System            3.1   RCS Leakage 3.1.1 Unusual Event Unidentified or pressure boundary leakage > 10 gpm OR Identified leakage > 25 gpm NUMARC IC:
RCS leakage when greater than 200      'F FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
The conditions of this EAL may be a precursor of more serious conditions and, as a result, is considered to be a potential degradation of the level of safety of the plant. The 10 gpm value for the. unidentified leakage and pressure boundary leakage was selected because it is observable with normal Control Room indications. Smaller values must be determined through time-consuming surveillance tests (e. g., mass balances). The 25 gpm value for identified leakage is set at a higher value because of the significance of identified leakage in comparison to unidentified or pressure boundary leakage.
Only operating modes in which there is fuel in the reactor coolant system and the system is pressurized are specified.
PEG  


==Reference:==
==Reference:==
SU5.1BasisReference(s):None


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.1RCSLeakage3.1.2AlertPrimarysystemleakage>46gpmMMARCIC:N/AFPBloss/potentialloss:RCSpotentiallossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALisbasedontheinabilitytomaintainnormalliquidinventorywithintheReactorCoolantSystem(RCS)bynormaloperationoftheChemicalandVolumeControlSystemwhichisconsideredastwopositivedisplacementchargingpumpsdischargingtothechargingheader.PEG
SU5.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System          3.1    RCS Leakage 3.1.2 Alert Primary system leakage > 46 gpm MMARC IC:
N/A FPB loss/potential loss:
RCS potential loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.
PEG  


==Reference:==
==Reference:==
RCS2.2BasisReference(s):1.FSARTable9.3.63-3 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.1.3SiteAreaEmergency3.1RCSLeakageRVLIScannotbemaintained>43%withnoRCPsrunningORWiththereactorvesselheadremoved,itisreportedthatwaterlevelinthereactorvesselisdroppinginanuncontrolledmannerandcoreuncoveryislikelyNUINARCIC:Lossofreactorvesselwaterlevelhasorwilluncoverfuelinthereactorvessel.FPBloss/potentialloss:Fuelcladpotentialloss,RCSlossModeApplicability:Basis:ThereactorvesselwaterlevelusedinthisEAListhetopofactivefuel(TAF).ThisvaluecorrespondstothelevelwhichisusedinCSFSTstoindicatechallengetocorecoolingandlossofthefuelcladbarrier.Thisistheminimumwaterleveltoassurecorecoolingwithoutfurtherdegradationoftheclad.SeverecoredamagecanoccurandreactorcoolantsystempressureboundaryintegritymaynotbeassuredifreactorvesselwaterlevelisnotmaintainedabovethatcorrespondingtoRVLISat43%.RVLISdynamicrangeindicationsarenotutilizedinthisEALsincetheRCPswouldnotberunningunderconditionswherevessellevelisapproachingTAF.Thus,declarationofaSiteAreaEmergencyiswarrantedundertheconditionsspecifiedbythisEAL.EscalationtoaGeneralEmergencywouldbeviaradioactivityreleasecategory5.0.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
RCS2.2 Basis Reference(s):
: 1. FSAR Table 9.3.6 3-3
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System          3.1     RCS Leakage 3.1.3 Site Area Emergency RVLIS cannot be maintained > 43% with no RCPs running OR With the reactor vessel head removed,   it is reported that water level in the reactor vessel is dropping in an uncontrolled manner and core uncovery is likely NUINARC IC:
Loss of reactor vessel water level has or will uncover fuel in the reactor vessel.
FPB loss/potential loss:
Fuel clad potential loss, RCS loss Mode Applicability:
Basis:
The reactor vessel water level used in this EAL is the top of active fuel (TAF).
This value corresponds to the level which is used in CSFSTs to indicate challenge to core cooling and loss of the fuel clad barrier. This is the minimum water level to assure core cooling without further degradation of the clad. Severe core damage can occur and reactor coolant system pressure boundary integrity may not be assured ifreactor vessel water level is not maintained above that corresponding to RVLIS at 43%. RVLIS dynamic range indications are not utilized in this EAL since the RCPs would not be running under conditions where vessel level is approaching TAF.
Thus, declaration of a Site Area Emergency is warranted under the conditions specified by this EAL. Escalation to a General Emergency would be via radioactivity release category 5.0.
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
SS5.1FC4.1BasisReference(s):1.FR-C.1"ResponsetoInadequateCoreCooling" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0ReactorCoolantSystem8.2PrimarytoSecondaryLeakage8.2.1UnusualEventReleaseofsecondarysidetoatmospherewithprimarytosecondaryleakage>0.1gpmpersteamgeneratorNUlVIARCIC:N/AFPBloss/potentialloss:ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesSGtubeleaksindicativeofalossofcontainment.Secondarysidereleasestoatmosphereincludethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmosphericreliefvalvesthatcannotbeisolatedonceisolationhasbeendirected.bytheEOPs.AsteamgeneratorwhichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Forsmallleaks,notexceedingthenormalchargingcapacitythresholdinRCSleakageEAL3.1.2,thisEALresultsinanUnusualEvent.Forlargerleaks,RCSleakageEAL3.2.2wouldresultinaSiteAreaEmergency.ForSGtuberuptureswhichmayinvolvemultiplesteamgeneratorsorunisolablesecondarylinebreaks,SGtuberuptureEAL4.2.1wouldalsoresultinaSiteAreaEmergency.PEG
 
SS5.1 FC4.1 Basis Reference(s):
: 1. FR-C.1 "Response to Inadequate Core Cooling"
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Reactor Coolant System          8.2    Primary to Secondary Leakage 8.2.1 Unusual Event Release of secondary side to atmosphere  with primary to secondary leakage >
0.1 gpm per steam generator NUlVIARCIC:
N/A FPB loss/potential loss:
Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses SG tube leaks indicative of a loss of containment.
Secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed. by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL. For small leaks, not exceeding the normal charging capacity threshold in RCS leakage EAL 3.1.2, this EAL results in an Unusual Event. For larger leaks, RCS leakage EAL 3.2.2 would result in a Site Area Emergency. For SG tube ruptures which may involve multiple steam generators or unisolable secondary line breaks, SG tube rupture EAL 4.2.1 would also result in a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
PC4.1BasisReference(s):1.TechnicalSpecificationsSection3.1.5.2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.2PrimarytoSecondaryLeakage3.2.2SiteAreaEmergencyUnisolablereleaseofsecondarysidetoatmospherewithprimarytosecondaryleakage)46gpmMMARCICN/AFPBloss/potentialloss:RCSpotentialloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesSGtubeleaksindicativeofalossofbothRCSandcontainmentbarriers.UnisolablesecondarysidereleasestoatmosphereincludethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmosphericreliefvalvesthatcannotbeisolatedonceisolationhasbeendirectedbytheEOPs.AsteamgeneratorwhichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Primarytosecondaryleakage)46gpmisbasedontheinabilitytomaintainnormalliquidinventorywithintheReactorCoolantSystem(RCS)bynormaloperationoftheChemicalandVolumeControlSystemwhichisconsideredastwopositivedisplacementchargingpumpsdischargingtothechargingheader.Forprimarytosecondaryleakage)46gpmintheabsenceofanysecondarytoatmosphererelease,anAlertwouldbedeclaredbasedonEAL3.1.2,ThisEALrepresentsthelossofbothRCSandcontainmentbarriersandthereforewarrantsdeclarationofaSiteAreaEmergency.PEG
 
PC4.1 Basis Reference(s):
: 1. Technical Specifications Section 3.1.5.2
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System          3.2    Primary to Secondary Leakage 3.2.2 Site Area Emergency Unisolable release of secondary side to atmosphere with primary to secondary leakage ) 46 gpm MMARC IC N/A FPB loss/potential loss:
RCS potential loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses SG tube leaks indicative of a loss of both RCS and containment barriers. Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL. Primary to secondary leakage ) 46 gpm is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header. For primary to secondary leakage ) 46 gpm in the absence of any secondary to atmosphere release, an Alert would be declared based on EAL 3.1.2, This EAL represents the loss of both RCS and containment barriers and therefore warrants declaration of a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
PC4.1+RCS2.2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.TechnicalSpecificationsSection3.1.5.22.E-3"SteamGeneratorTubeRupture"3.FSARTable9.3.6 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.2PrimarytoSecondaryLeakage3.2.3SiteAreaEmergencyReleaseofsecondarysidetoatmospherewithprimarytosecondaryleakage>0.1gpmpersteamgeneratorANDCoolantactivity)300pCi/ccofI-131MMARCIC:N/AFPBloss/potentialloss:Fuelcladloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesSGtubeleaksindicativeofalossofcontainmentinconjunctionwithalossoffuelcladding.UnisolablesecondarysidereleasestoatmosphereincludethosefromfeedlineorsteamlinebreaksaswellasstuckopensafetyoratmosphericreliefvalvesthatcannotbeisolatedonceisolationhasbeendirectedbytheEOPs.AsteamgeneratorwhichisrequiredtobeusedforplantcooldownwouldalsobecoveredunderthisEAL.Acoolantactivity)300pCi/ccofI-131indicatesalossoffuelcladding.RefertoEALN2.1.2basisThisconditionrepresentsalossofbothprimarycontainmentwiththelossoffuelcladdingandthuswarrantsdeclarationofaSiteAreaEmergency.PEG
 
PC4.1+ RCS2.2
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. Technical Specifications Section 3.1.5.2
: 2. E-3 "Steam Generator Tube Rupture"
: 3. FSAR Table 9.3.6
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System            3.2    Primary to Secondary Leakage 3.2.3 Site  Area Emergency Release of secondary side to atmosphere    with primary to secondary leakage >
0.1 gpm per steam generator AND Coolant activity ) 300 pCi/cc of I-131 MMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses SG tube leaks indicative of a loss of containment in conjunction with a loss of fuel cladding. Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL.
A coolant activity ) 300 pCi/cc of I-131 indicates a loss of fuel cladding. Refer to EAL N2.1.2 basis This condition represents a loss of both primary containment with the loss of fuel cladding and thus warrants declaration of a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
PC4.1+FC2.1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.TechnicalSpecificationsSection3.1.43-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev13.0ReactorCoolantSystem3.3RCSSubcooling3.3.1AlertRCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakageNUINARCIC:N/AFPBloss/potentialloss:RCSlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesconditionswhereleakagefromtheRCSisgreaterthanavailableinventorycontrolcapacitysuchthatalossofsubcoolinghasoccurred.ThelossofsubcoolingisthefundamentalindicationthattheinventorycontrolsystemsareinadequateinmaintainingRCSpressureandinventoryagainstthemasslossthroughtheleak.LossoftheRCSbarrierwarrantsdeclarationofanAlert.PEG
 
PC4.1+       FC2.1
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. Technical Specifications Section 3.1.4 3-10
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 3.0    Reactor Coolant System          3.3    RCS Subcooling 3.3.1 Alert RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage NUINARC IC:
N/A FPB loss/potential loss:
RCS loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through the leak.
Loss of the RCS barrier warrants declaration of an Alert.
PEG  


==Reference:==
==Reference:==
RCS2.1BasisReference(s):1.E-O,ReactorTripOrSafetyInjection3-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Thecontainmentstructureisanatmosphericvaporcontainmentsystem.ItformsaGssionproductbarrierdesignedtocontaintheradioactivefissionproductsgeneratedfromanypostulatedaccidentsoastoprecludeexceedingoffsiteexposurelimits.Thecontainmentstructureisalowleakagesystemhousingthereactorvessel,thereactorcoolantpiping,steamgeneratorsandotherbranchconnectionsofthereactorprimarysystem.Thecontainmentisequippedwithisolationvalvesforsystemswhichpenetratethecontainmentboundary.Thesevalvesautomaticallyactuatetoisolatesystemsunderemergencyconditions.TherearethreecontainmentparameterswhichareindicativeofconditionswhichmayposeathreattocontainmentintegrityorindicatedegradationofRCSorreactorfuelcladintegrity.~inIAbnormallyhighcontainmentpressureorfailureofcontainmentcoolingsystemsfollowingaLOCAareindicativeofpotentiallossesofthecontainmentbarrierintegrity.TheexistenceofanunisolableCIorCVIlinebreakoutsidecontainmentconstitutesalossofcontainmentintegrityaswellasalossofRCSboundary.InconsistentcontainmentresponsetoaknownLOCAisalsoindicativeofcontainmentlossinconjunctionwithRCSbarrierbreach.Shouldalossoffuelcladdingintegrityoccurundereitheroftheseconditions,thepotentialforreleaseoflargeamountsofradioactivematerialstotheenvironmentexists.mrwihn1SGtuberupturesinconjunctionwithasecondarysystemlinebreakresultinginreleasetotheenvironmentconstituteslossesofbothRCSandcontainmentintegrity.PrimarytosecondaryleakageinexcessofTechnicalSpecificationsinconjunctionwithfuelcladdamageandsecondarysystemleakagetotheenvironmentconstituteslossesoffuelclad,RCSandcontainmentintegrity.Thisconditionprovidesthepotentialforreleaseoflargeamountsofradioactivematerialstotheenvironment.~mi1nr'Theexistenceofcombustible'gasconcentrationsincontainmentposeaseverethreattocontainmentintegrityandareindicativeofseverelydegradedreactorcoreandRCSconditions.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.1ContainmentIntegrityStatus4.1.1UnusualEventBothdoorsopenoncontainmentairlock.ORInabilitytoclosecontainmentpressurerelieforpurgevalveswhichresultsinaradiologicalreleasepathwaytotheenvironmentNUMARCIC:N/AFPBloss/potentialloss:ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesanindicationthatunambiguouslyindicateslossofthecontainmentbarrierunderconditionswhencontainmentintegrityisrequired.Itisimportanttonotehowever,thatlossofcontainmentduetobothairlockdoorsbeingopeniseventdependent.Uponrecognition,shiftpersonnelwouldrapidlyrespondinanattempttoreestablishcontainmentintegrity.Ifthedoorscannotbereclosed,anylossoftheRCSbarrierthatoccurswiththedoorsopenwouldappearasaninconsistentLOCAresponse.Therefore,thiseventisnotusedasadefinitiveindicatoroflossoftheprimarycontainmentbarrierforpurposesofdefininghigherclassificationEALs.RatheritislefttotheEmergencyCoordinator'sjudgmentwhethersuchalosshasoccurred.'EG
RCS2.1 Basis Reference(s):
: 1. E-O, Reactor Trip Or Safety Injection 3-11
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 The containment structure is an atmospheric vapor containment system. It forms a Gssion product barrier designed to contain the radioactive fission products generated from any postulated accident so as to preclude exceeding offsite exposure limits.
The containment structure is a low leakage system housing the reactor vessel, the reactor coolant piping, steam generators and other branch connections of the reactor primary system. The containment is equipped with isolation valves for systems which penetrate the containment boundary.
These valves automatically actuate to isolate systems under emergency conditions.
There are three containment parameters which are indicative of conditions which may pose a threat to containment integrity or indicate degradation of RCS or reactor fuel clad integrity.
    ~         i    n I                  Abnormally high containment pressure or failure of containment cooling systems following a LOCA are indicative of potential losses of the containment barrier integrity.
The existence of an unisolable CI or CVI line break outside containment constitutes a loss of containment integrity as well as a loss of RCS boundary. Inconsistent containment response to a known LOCA is also indicative of containment loss in conjunction with RCS barrier breach. Should a loss of fuel cladding integrity occur under either of these conditions, the potential for release of large amounts of radioactive materials to the environment exists.
m        r                    wi h      n        1      SGtube ruptures in conjunction with a secondary system line break resulting in release to the environment constitutes losses of both RCS and containment integrity.
Primary to secondary leakage in excess of Technical Specifications in conjunction with fuel clad damage and secondary system leakage to the environment constitutes losses of fuel clad, RCS and containment integrity. This condition provides the potential for release of large amounts of radioactive materials to the environment.
    ~     m      i 1            n r        The existence of combustible'gas concentrations in containment pose a severe threat to containment integrity and are indicative of severely degraded reactor core and RCS conditions.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment        4.1    Containment Integrity Status 4.1.1 Unusual Event Both doors open on containment airlock
. OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment NUMARC IC:
N/A FPB loss/potential loss:
Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses an indication that unambiguously indicates loss of the containment barrier under conditions when containment integrity is required.
It is important to note however, that loss of containment due to both airlock doors being open is event dependent. Upon recognition, shift personnel would rapidly respond in an attempt to reestablish containment integrity. Ifthe doors cannot be reclosed, any loss of the RCS barrier that occurs with the doors open would appear as an inconsistent LOCA response. Therefore, this event is not used as a definitive indicator of loss of the primary containment barrier for purposes of defining higher classification EALs. Rather it is left to the Emergency Coordinator's judgment whether such a loss has occurred.
'EG  


==Reference:==
==Reference:==
PC7.1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.1ContainmentIntegrityStatus/4.1.2SiteAreaEmergency4RapiduncontrolleddecreaseincontainmentpressurefollowinginitialincreaseORLossofprimarycoolantinsidecontainmentwithcontainmentpressureorsumplevelresponsenotconsistentwithLOCAconditionsMBMRCIC:N/AFPBloss/potentialloss:RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:Rapidunexplainedlossofpressure(i.e.,notattributabletocontainmentsprayorFanCoolingUnitsorcondensationeffects)followinganinitialpressureincreaseindicatesalossofbothRCSandcontainmentintegrity.Containmentpressureandsumplevelsshouldincreaseasaresultofth'massandenergyreleaseintocontainmentfromaLOCA.Thus,sumplevelorpressurenotincreasingindicatescontainmentbypass(V-sequence)andalossofcontainmentintegrity.ThisEALindicateslossofbothRCSandcontainmentandthereforewarrantsdeclarationofaSiteAreaEmergency.PEG
 
PC7.1
 
OSSI-92-402A-4-REG  Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment        4.1  Containment Integrity Status
                                                                /
4.1.2 Site Area Emergency 4
Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions MBMRC IC:
N/A FPB loss/potential loss:
RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
Rapid unexplained loss of pressure (i. e., not attributable to containment spray or Fan Cooling Units or condensation effects) following an initial pressure increase indicates a loss of both RCS and containment integrity.
Containment pressure and sump levels should increase as a result of th' mass and energy release into containment from a LOCA. Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.
This EAL indicates loss of both RCS and containment and therefore warrants declaration of a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
PC2.1PC2.2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.Alarmresponseprocedure,AR-C-18,Revision62.Alarmresponseprocedure,AR-C-19,Revision43.R.E.GinnaUpdatedFSAR,Figure6.2-3through6.2-5 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.1ContainmentIntegrityStatus4.1.3SiteAreaEmergencyEither:CIorCVIvalve(s)notclosedwhenrequiredfollowingconfirmedLOCAORInabilitytoisolateanyprimarysystemdischargingoutsidecontainmentANDRadiologicalreleasepathwaytotheenvironmentexistsMMARCIC:N/AFPBloss/potentialloss:RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALisintendedtoaddressincompletecontainmentisolationthatallowsdirectreleasetotheenvironment.ItrepresentsalossofboththeRCSandcontainmentbarrierandthereforewarrantsdeclarationofaSiteAreaEmergency.FailureofCIorCVIvalvestoisolateisintendedtoaddressincompletecontainmentisolationthatallowsdirectreleasetotheenvironment.ItrepresentsalossofboththeRCSandcontainmentbarrier.ConfirmationofaIOCAshouldbebasedondiagnosticactivitiesconsistentwithE-0"ReactorTriporSafetyInjection.""Inabilitytoisolateanyprimarysystemdischargingoutsidecontainment"isintendedtoaddressotherprimarysystems,eitherdirectorindirect,whichtheinabilitytoisolateindicatelossofbothRCSandcontainment.PEG
 
PC2.1 PC2.2
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. Alarm response procedure, AR-C-18, Revision 6
: 2. Alarm response procedure, AR-C-19, Revision 4
: 3. R. E. Ginna Updated FSAR, Figure 6.2-3 through 6.2-5
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment          4.1    Containment Integrity Status 4.1.3 Site Area Emergency Either:
CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists MMARC IC:
N/A FPB loss/potential loss:
RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier and therefore warrants declaration of a Site Area Emergency.
Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier. Confirmation of a I OCA should be based on diagnostic activities consistent with E-0 "Reactor Trip or Safety Injection."
"Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment.
PEG  


==Reference:==
==Reference:==
PC3.1


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.FR-2.1"ResponsetoHighContainmentPressure" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment'4.lContainmentIntegrityStatus4.1.4GeneralEmergencySafetyinjectionsignalduetoLOCAwithlessthanminimumoperablecontainmentheatremovalequipment,Table4.3ANDAnyindicatorsoffuelcladloss,Table4.1Table4.3Minimum0erableContainmentHeatRemovalEuimentCNMTPressureRecircFans0erableSraPumsReuired<28psigN/A>28psigTable4.1FuelCladLossIndicators1.Coolantactivity>300p.Ci/ccofI-1312.ContainmentradmonitorR-29/R-30reading>100H/hr3.LetdownMonitorR-9reading>10H/hr4.REDpathinF-0.2,CORECOOLINGMMARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSloss,ContainmentpotentiallossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALrepresentsapotentiallossofcontainmentinconjunctionwithlossesofbothRCSandfuelclad.
PC3.1
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1ApotentiallossofcontainmentisconsideredtoexistinthatthecontainmentheatremovaVdepressurizationsystems(e.g.,containmentsprays,Recirc.Fans,butnotincludingcontainmentventingstrategies)areeitherlostorperforminginadegradedmanner,asindicatedbyplantparameterssuchascontainmentpressure,pressurizerlevelandsteamlinepressureinexcessofthesetpointsatwhichtheequipmentwassupposedtohaveactuated.RCSisalsoassumedtobelostinthisconditionduetoexceedingsafetyinjectioninitiationsetpoints:containmentpressure()4psig)orlowpressurizer(<1723psig).Table4.1presentsfuelcladlossindicatorswhichrepresent2-5%cladfailures.RefertoEAL0's2.1.2,2.2.2,and2.3.2forbasesoftheseindicators.PEG
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. FR-2.1 "Response to High Containment Pressure"
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 4.0    Containment        '4.l    Containment Integrity Status 4.1.4 General Emergency Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Table 4.3    Minimum 0 erable Containment Heat Removal E ui ment CNMT Pressure      Recirc Fans 0 erable              S ra Pum sRe uired
  <28 psig                                                        N/A
  >28 psig Table 4.1    Fuel Clad Loss Indicators
: 1. Coolant activity > 300 p.Ci/cc of I-131
: 2. Containment rad monitor R-29/R-30 reading >100 H/hr
: 3. Letdown Monitor R-9 reading > 10 H/hr
: 4. RED path in F-0.2, CORE COOLING MMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL represents a potential loss of containment in conjunction with losses of both RCS and fuel clad.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 A potential loss of containment is considered to exist in that the containment heat removaVdepressurization systems (e. g., containment sprays, Recirc.
Fans, but not including containment venting strategies) are either lost or performing in a degraded manner, as indicated by plant parameters such as containment pressure, pressurizer level and steam line pressure in excess of the setpoints at which the equipment was supposed to have actuated.
RCS is also assumed to be lost in this condition due to exceeding safety injection initiation setpoints: containment pressure ()4 psig) or low pressurizer (< 1723 psig).
Table 4.1 presents fuel clad loss indicators which represent 2 - 5% clad failures. Refer to EAL 0's 2.1.2, 2.2.2, and 2.3.2 for bases of these indicators.
PEG  


==Reference:==
==Reference:==
PC2.5+FC2.1,FC5.1andFC6.1BasisReference(s):l.2.3.4.5.6.7.8.TechnicalSpecifications,Table3.5-4,pg.3.5-17R.E.GinnaUFSAR,Section6.2.2.1.2.4,pg.6.2-28TechnicalSpecifications,Article5.2.1,pg.5.2-1FR-Z.1,ResponsetoHighContainmentPressure,Revision3R.E.GinnaUFSAR,Section6.2.2.1,pg.6.2-24bR.E.GinnaUFSAR,Section6.2.2.2,pg.6.2-32andFigure6.2-11EPIP2-16,CoreDamageEstimationP-9,RadiationMonitoringSystem,Revision67,Section2.2.2.6,pg.P-9:2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.1ContainmentIntegrityStatus4.1.5GeneralEmergencyEither:RapiduncontrolleddecreaseincontainmentpressurefollowinginitialincreaseORLossofprimarycoolantinsidecontainmentwithcontainmentpressureorsumplevelresponsenotconsistentwithLOCAconditionsANDAnyindicatorsoffuelcladdamage,Table4.2Table4.2FuelCladDamageIndicatorsORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300pCi/ccofI-131ContainmentradmonitorR-29/R-30reading>100EhrLetdownMonitorR-9reading>10R/hrMMARCIC:N/AFPBloss/potentialloss:Fuelcladpotentialloss/loss,RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALindicateslossofbothRCSandcontainmentwithlossorpotentiallossofthefuelcladdingandthereforewarrantsdeclarationofaGeneralEmergency.,4-10


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Rapidunexplainedlossofpressure(i.e.,notattributabletocontainmentsprayorFanCoolingUnitsorcondensationeffects)followinganinitialpressureincreaseindicatesalossofbothRCSandcontainmentintegrity.ContainmentpressureandsumplevelsshouldincreaseasaresultofthemassandenergyreleaseintocontainmentfromaLOCA.Thus,sumplevelorpressurenotincreasingindicatescontainmentbypass(V-sequence)andalossofcontainmentintegrity.Table4.2presentsfuelcladlossandpotentiallossindicators:~ORANGEorREDpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basisCoolantactivity>300p,Ci/ccofI-131:RefertoEAL&#xb9;2.1.2basis~Containmentradmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10H/hr:RefertoEAL&#xb9;2.2.2basisPEG
PC2.5+        FC2.1, FC5.1 and FC6.1 Basis Reference(s):
: l. Technical Specifications, Table 3.5-4, pg. 3.5-17
: 2. R. E. Ginna UFSAR, Section 6.2.2.1.2.4, pg. 6.2-28
: 3. Technical Specifications, Article 5.2.1, pg. 5.2-1
: 4. FR-Z.1, Response to High Containment Pressure, Revision 3
: 5. R. E. Ginna UFSAR, Section 6.2.2.1, pg. 6.2-24b
: 6. R. E. Ginna UFSAR, Section 6.2.2.2, pg. 6.2-32 and Figure 6.2-11
: 7. EPIP 2-16, Core Damage Estimation
: 8. P-9, Radiation Monitoring System, Revision 67, Section 2.2.2.6, pg. P-9:2
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment          4.1  Containment Integrity Status 4.1.5 General Emergency Either:
Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Table 4.2  Fuel Clad Damage Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 pCi/cc of I-131 Containment rad monitor R-29/R-30 reading >100 Ehr Letdown Monitor R-9 reading > 10 R/hr MMARC IC:
N/A FPB loss/potential loss:
Fuel clad potential loss/loss, RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.,
4-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Rapid unexplained loss of pressure (i. e., not attributable to containment spray or Fan Cooling Units or condensation effects) following an initial pressure increase indicates a loss of both RCS and containment integrity.
Containment pressure and sump levels should increase as a result of the mass and energy release into containment from a LOCA. Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.
Table 4.2 presents fuel clad loss and potential loss indicators:
    ~ ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL &#xb9;1.1.1 basis
    ~ RED path in F-0.3, Heat Sink: Refer to EAL &#xb9;1.2.1 basis Coolant activity > 300 p,Ci/cc of I-131: Refer to EAL &#xb9;2.1.2 basis
    ~ Containment rad monitor reading >100 R/hr: Refer to EAL &#xb9;2.3.2 basis
    ~ Letdown Monitor R-9 reading > 10 H/hr: Refer to EAL &#xb9;2.2.2 basis PEG


==Reference:==
==Reference:==
PC2.1/PC2.2+FC1.2,FC1.3,FC2.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):l.2.3.45.6.7.8.9.10.Alarmresponseprocedure,AR-C-18,Revision6Alarmresponseprocedure,AR-C-19,Revision4R.E.GinnaUpdatedFSAR,Figure6.2-3through6.2-5EPIP2-16,CoreDamageEstimationCSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequateCoreCooling,Revision7FR-C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"RadiationMonitoringSystem"4-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.1ContainmentIntegrityStatus4.1.6GeneralEmergencyEither:"CIorCVIvalve(s)notclosedwhenrequiredfollowingconfirmedLOCAORInabilitytoisolateanyprimarysystemdischargingoutsidecontainmentANDRadiologicalreleasepathwaytotheenvironmentexistsANDAnyindicatorsoffuelcladdamage,Table4.2Table4.2FuelCladDamaeIndicatorsORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300p,Ci/ccofI-131ContainmentradmonitorR-29/R-30reading>100R/hrLetdownMonitorR-9reading>10R/hrMMARCIC:N/AFPBloss/potentialloss:Fuelcladloss/potentialloss,RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALindicateslossofbothRCSandcontainmentwithlossorpotentiallossofthefuelcladdingandthereforewarrantsdeclarationofaGeneralEmergency.FailureofCIorCVIvalvestoisolateisintendedtoaddressincompletecontainmentisolationthatallowsdirectreleasetotheenvironment.ItrepresentsalossofboththeRCSandcontainmentbarrier.4-12 OSSI-92-402A-4-REGGinnaEAITechnicalBasesDocument,Rev1"Inabilitytoisolateanyprimarysystemdischargingoutsidecontainment"isintendedtoaddressotherprimarysystems,eitherdirectorindirect,whichtheinabilitytoisolateindicatelossofbothRCSandcontainmentTable4.2presentsfuelcladlossandpotentiallossindicators:~ORANGEpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basis~Coolantactivity>300pCi/ccofI-131:RefertoEAL&#xb9;2.1.2basisContainmentradmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10H/hr:RefertoEAL&#xb9;2.2.2basisPEG
 
PC2.1/PC2.2+       FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
: l. Alarm response procedure, AR-C-18, Revision 6
: 2. Alarm response procedure, AR-C-19, Revision 4
: 3. R. E. Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 4      EPIP 2-16, Core Damage Estimation
: 5. CSFST F-0.2, Core Cooling, Revision 3
: 6. CSFST F-0.3, Heat Sink, Revision 3
: 7. FR-C.1, Response to Inadequate Core Cooling, Revision 7
: 8. FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a
: 9. FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3
: 10. P-9 "Radiation Monitoring System" 4-11
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment          4.1  Containment Integrity Status 4.1.6 General Emergency Either:
CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Table 4.2    Fuel Clad Dama    e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 p,Ci/cc of I-131 Containment rad monitor R-29/R-30 reading >100 R/hr Letdown Monitor R-9 reading > 10 R/hr MMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.
Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier.
4-12
 
OSSI-92-402A-4-REG                          Ginna EAI Technical Bases Document, Rev 1 "Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment Table 4.2 presents fuel clad loss and potential loss indicators:
    ~ ORANGE path in F-0.2, Core Cooling: Refer to EAL &#xb9;1.1.1 basis
    ~ RED path in F-0.3, Heat Sink: Refer to EAL &#xb9;1.2.1 basis
    ~ Coolant activity > 300 pCi/cc of I-131: Refer to EAL &#xb9;2.1.2 basis Containment rad monitor reading >100 R/hr: Refer to EAL &#xb9;2.3.2 basis
    ~ Letdown Monitor R-9 reading > 10 H/hr: Refer to EAL &#xb9;2.2.2 basis PEG


==Reference:==
==Reference:==
PC3.1+FC1.2,FC1.3,FC2.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):1.2.3.45.6.7.8.9.10.FR-2.1"ResponsetoHighContainmentPressure"CSFSTF-0.2,"CoreCooling"FR-C.l,"ResponsetoInadequateCoreCooling"EPIP2-16,CoreDamageEstimationCSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequateCoreCooling,Revision7FR;C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"Radiatio'nMonitoringSystem"4-13 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Contaixunent4.2SGTubeRupturew/SecondaryRelease4.2.1SiteAreaEmergencyUnisolablesecondarysidelinebreakwithSGtuberuptureasidentifiedinE-3"SteamGeneratorTubeRupture"NMGQtCIC:N/AFPBloss/potentialloss:RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALisintendedtoaddressthefullspectrumofSteamGenerator(SG)tuberuptureeventsinconjunctionwithalossofcontainmentduetoasignificantsecondarylinebreak.ThisEALaddressesrupturedSG(s)withanunisolablesecondarylinebreakcorrespondingtothelossof2of3fissionproductbarriers(RCSbarrierandcontainmentbarrier).Thisallowsthedirectreleaseofradioactivefissionandactivationproductstotheenvironment.Resultantoffsitedoseratesareafunctionofmanyvariables.Examplesinclude:coolantactivity,actualleakrate,SGcarryover,iodinepartitioning,andmeteorology.Theindicationsutilizedshouldbeconsistentwiththediagnosticactivitiesoftheemergencyoperatingprocedures(EOPs),ifavailable.Thisshouldincludeindicationofreductioninprimarycoolantinventory,increasedsecondaryradiationlevels,andanuncontrolledorcompletedepressurizationoftherupturedSG.Secondaryradiationincreasesshouldbeobservedviaradiationmonitoringofcondenserairejectordischarge,SGblowdown,mainsteam,and/orSGsamplingsystem.Determinationofthe"uncontrolled"depressurizationoftherupturedSGshouldbebasedonindicationthatthepressuredecreaseintherupturedsteamgeneratorisnotafunctionofoperatoraction.ThisshouldpreventdeclarationbasedonadepressurizationthatresultsfromanEOPinducedcooldownoftheRCSthatdoesnotinvolvetheprolongedreleaseofcontaminatedsecondarycoolantfromtheaffectedSG4-14 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1totheenvironment.ThisEALencompassessteambreaks,feedbreaks,andstuckopensafetyorreliefvalves.PEG
 
PC3.1+   FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
: 1. FR-2.1 "Response to High Containment Pressure"
: 2. CSFST F-0.2, "Core Cooling"
: 3. FR-C.l, "Response to Inadequate Core Cooling" 4      EPIP 2-16, Core Damage Estimation
: 5. CSFST F-0.2, Core Cooling, Revision 3
: 6. CSFST F-0.3, Heat Sink, Revision 3
: 7. FR-C.1, Response to Inadequate Core Cooling, Revision 7
: 8. FR;C.2, Response to Degraded Core Cooling, Revision 6, step 9.a
: 9. FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3
: 10. P-9 "Radiatio'n Monitoring System" 4-13
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Contaixunent        4.2    SG Tube    Rupture w/ Secondary Release 4.2.1  Site Area Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" NMGQtC IC:
N/A FPB loss/potential loss:
RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL is intended to address the full spectrum of Steam Generator (SG) tube rupture events in conjunction with a loss of containment due to a significant secondary line break. This EAL addresses ruptured SG(s) with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier). This allows the direct release of radioactive fission and activation products to the environment. Resultant offsite dose rates are a function of many variables.
Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.
The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), ifavailable. This should include indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG. Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam, and/or SG sampling system. Determination of the "uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action. This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the affected SG 4-14
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 to the environment. This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.
PEG  


==Reference:==
==Reference:==
RCS3.1BasisReference(s):1.E-3"SteamGeneratorTubeRupture"4-15 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.2SGTubeRupturew/SecondaryRelease4.2.2GeneralEmergencyUnisolablesecondarysidelinebreakwithSGtuberuptureasidentifiedinE-3"SteamGeneratorTubeRupture"ANDAnyindicatorsoffuelcladdamage,Table4.2Table4.2FuelCladDamaeIndicatorsORANGEorREDpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoolantactivity>300p.Ci/ccofI-131ContainmentradmonitorR-29/R-30reading>100R/hrLetdownMonitorR-9reading>10R/hrNUMARCIC:N/AFPBloss/potentialloss:Fuelcladloss/potentialloss,RCSloss,ContainmentlossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALisintendedtoaddressthefullspectrumofSteamGenerator(SG)tuberuptureeventsinconjunctionwithalossofcontainmentduetoasignificantsecondarylinebreakwithactualorpotentiallossofthefuelcladintegrity.ThisEALaddressesrupturedSG(s)withanunisolablesecondarylinebreakcorrespondingtothelossof2of3fissionproductbarriers(RCSbarrierandcontainmentbarrier)withtheactualorpotentiallossofthethird(fuelcladding).Thisallowsthedirectreleaseofradioactivefissionandactivationproductstotheenvironment.Resultantoffsitedoseratesareafunctionofmanyvariables.Examplesinclude:coolantactivity,actualleakrate,SGcarryover,iodinepartitioning,andmeteorology.4-16 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Theindicationsutilizedshouldbeconsistentwiththediagnosticactivitiesoftheemergencyoperatingprocedures(EOPs),ifavailable.Thisshouldinclude.indicationofreductioninprimarycoolantinventory,increasedsecondaryradiationlevels,andanuncontrolledorcompletedepressurizationoftherupturedSG.Secondaryradiationincreasesshouldbeobservedviaradiationmonitoringofcondenserairejectordischarge,SGblowdown,mainsteam,.and/orSGsamplingsystem.Determinationofthe"uncontrolled"depressurizationoftherupturedSGshouldbebasedonindicationthatthepressuredecreaseintherupturedsteamgeneratorisnotafunctionofoperatoraction.ThisshouldpreventdeclarationbasedonadepressurizationthatresultsfromanEOPinducedcooldownoftheRCSthatdoesnotinvolvetheprolongedreleaseofcontaminatedsecondarycoolantfromtheafFectedSGtotheenvironment.ThisEALencompassessteambreaks,feedbreaks,andstuckopensafetyorreliefvalves.Table4.2presentsfuelcladlossandp'otentiallossindicators:~ORANGEorREDpathinF-0.2,CoreCooling:RefertoEAL&#xb9;1.1.1basis~REDpathinF-0.3,HeatSink:RefertoEAL&#xb9;1.2.1basis~Coolantactivity>300pCi/ccofI-131:RefertoEAL&#xb9;2.1.2basis~Containmentradmonitorreading>100R/hr:RefertoEAL&#xb9;2.3.2basis~LetdownMonitorR-9reading>10R/hr:RefertoEAL&#xb9;2.2.2basisThisconditionrepresentsalossofbothRCSandprimarycontainmentwiththelossorpotentiallossoffuelcladdingandthuswarrantsdeclarationofaGeneralEmergency.PEG
 
RCS3.1 Basis Reference(s):
: 1. E-3 "Steam Generator Tube Rupture" 4-15
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 4.0    Containment          4.2    SG Tube Rupture w/ Secondary Release 4.2.2 General Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Table 4.2    Fuel Clad Dama    e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 p.Ci/cc of I-131 Containment rad monitor R-29/R-30 reading >100 R/hr Letdown Monitor R-9 reading > 10 R/hr NUMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL is intended to address the full spectrum of Steam Generator (SG) tube rupture events in conjunction with a loss of containment due to a significant secondary line break with actual or potential loss of the fuel clad integrity. This EAL addresses ruptured SG(s) with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier) with the actual or potential loss of the third (fuel cladding). This allows the direct release of radioactive fission and activation products to the environment. Resultant offsite dose rates are a function of many variables. Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.
4-16
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), ifavailable. This should include          .
indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG. Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam,
.and/or SG sampling system. Determination of the "uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action. This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the afFected SG to the environment. This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.
Table 4.2 presents fuel clad loss and p'otential loss indicators:
      ~ ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL &#xb9;1.1.1 basis
      ~ RED path in F-0.3, Heat Sink: Refer to EAL &#xb9;1.2.1 basis
      ~ Coolant activity > 300 pCi/cc of I-131: Refer to EAL &#xb9;2.1.2 basis
      ~ Containment rad monitor reading >100 R/hr: Refer to EAL &#xb9;2.3.2 basis
      ~ Letdown Monitor R-9 reading > 10 R/hr: Refer to EAL &#xb9;2.2.2 basis This condition represents a loss of both RCS and primary containment with the loss or potential loss of fuel cladding and thus warrants declaration of a General Emergency.
PEG  


==Reference:==
==Reference:==
RCS3.1+FC1.2,FC1.3,FC2.1,FC3.1,FC3.2,FC4.1,FC5.1andFC6.1BasisReference(s):1.2.3.45.6.'7.8.TechnicalSpecificationsSection3.1.5.2EPIP2-16,CoreDamageEstimationCSFSTF-0.2,CoreCooling,Revision3CSFSTF-0.3,HeatSink,Revision3FR-C.1,ResponsetoInadequateCoreCooling,Revision7FR-C.2,ResponsetoDegradedCoreCooling,Revision6,step9.aFR-C.2,ResponsetoDegradedCoreCooling,Revision6,Note,pg.3P-9"RadiationMonitoringSystem"4-17 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev14.0Containment4.3CombustibleGasConcentrations4.3.1GeneralEmergency>4%hydrogenconcentrationincontainmentMJMARCIC:N/AFPBloss/potentialloss:Fuelcladloss,RCSloss,ContainmentpotentiallossModeApplicability:Poweroperation,hotshutdownBasis:Existenceofanexplosivemixture(4%hydrogen)meansahydrogenandoxygenconcentrationofatleastthelowerdeflagrationlimitcurveexists.Whenhydrogenandoxygenconcentrationsreachorexceedthedeflagrationlimits,imminentlossofthecontainmentbarrierexists.Togeneratesuchlevelsofcombustiblegas,lossofthefuelcladandRCSbarriersmusthaveoccurred.ThisEALrepresentslossofbothfuelcladand,RCSwiththepotentiallossofcontainmentandthereforewarrantsdeclarationofaGeneralEmergency.PEG
 
RCS 3.1+     FC1.2, FC1.3, FC2.1, FC3.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):
: 1. Technical Specifications Section 3.1.5.2
: 2. EPIP 2-16, Core Damage Estimation
: 3. CSFST F-0.2, Core Cooling, Revision 3 4      CSFST F-0.3, Heat Sink, Revision 3
: 5. FR-C.1, Response to Inadequate Core Cooling, Revision 7
: 6. FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a
'7.     FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3
: 8. P-9 "Radiation Monitoring System" 4-17
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 4.0    Containment        4.3    Combustible Gas Concentrations 4.3.1  General Emergency
> 4% hydrogen concentration    in containment MJMARC IC:
N/A FPB loss/potential loss:
Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:
Power operation, hot shutdown Basis:
Existence of an explosive mixture (4 % hydrogen) means a hydrogen and oxygen concentration of at least the lower deflagration limit curve exists.
When hydrogen and oxygen concentrations reach or exceed the deflagration limits, imminent loss of the containment barrier exists. To generate such levels of combustible gas, loss of the fuel clad and RCS barriers must have occurred.
This EAL represents loss of both fuel clad and,RCS with the potential loss of containment and therefore warrants declaration of a General Emergency.
PEG  


==Reference:==
==Reference:==
PC2.4BasisReference(s):1.FR-Z.1"ResponsetoHighContainmentPressure"4-18 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0ManyEALsare'asedonactualorpotentialdegradationoffissionproductbarriersbecauseoftheincreasedpotentialforo&#xc3;siteradioactivityrelease.Degradationoffissionproductbarriersthough,isnotalwaysapparentvianon-radiologicalsymptoms.Therefore,directindicationofincreasedradiologicaleffluentsorarearadiationlevelsareappropriatesymptomsforemergencyclassification.Atlowerlevels,abnormalradioactivityreleasesmaybeindicativeofafailureofcontainmentsystemsorprecursorstomoresignificantreleases.Athigherreleaserates,offsiteradiologicalconditionsmayresultwhichrequireoffsiteprotectiveactions.Increasedarearadiationlevelsinplantmayalsobeindicativeofthefailureofcontainmentsystemsorprecludeaccesstoplantvitalequipmentnecessarytoensureplantsafety.Therearetwobasicindicationsofradioactivityreleaseratesandoneforarearadiationlevelswhichwarrantemergencyclassifications.DiiiiiifBliii'i'gsystemsprovidesarapidassessmentmechanismtodeterminereleasesinexcessofclassifiablelimits.P.Projectedoffsitedoses(basedoneffluentmonitorreadings)oractualoffsitefieldmeasurementsindicatingdosesordoseratesaboveclassifiablelimits.:Sustainedgeneralarearadiationlevelsinexcessofthoseindicatinglossofcontrolofradioactivematerialsorthoselevelswhichmayprecludeaccesstovitalplantareasalsowarrantemergencyclassification.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.1EffluentMonitors5.1.1UnusualEventAvalidreadingonanymonitorsTable5.1column"NUE"for)60min.unlesssampleanalysiscanconfirmreleaserates<2xtechnicalspecificationswithinthistimeperiod.Table5.1EffluentMonitorClassificationThresholdsMonitorNUEAlertR-11R-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00p,Ci/cc0.533p,Ci/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33p,Ci/cc115.00p,Ci/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrNU1KARCIC:AnyunplannedreleaseofgaseousorliquidradioactivitytotheenvironmentthatexceedstwotimestheradiologicalTechnicalSpecificationsfor60minutesorlonger.FPBloss/potentialloss:N/AModeApplicability:
PC2.4 Basis Reference(s):
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0Basis:The"valueshown"foreachmonitoristwotimesthecalculatedTechnicalSpecificationreleaseratesasspecifiedinP-9section2.4.Unplannedreleasesinexcessoftwotimesthesitetechnicalspecificationsthatcontinuefor60minutesorlongerrepresentanuncontrolledsituationandhence,apotentialdegradationinthelevelofsafety.Thefinalintegrateddose(whichisverylowintheUnusualEventemergencyclass)isnottheprimaryconcernhere;itisthedegradationinplantcontrolimpliedbythefactthatthereleasewasnotisolatedwithin60minutes.Therefore,itisnotintendedthatthereleasebeaveragedover60minutes.Forexample,areleaseof4timesT/Sfor30minutesdoesnotexceedthisinitiatingcondition.Further,theEmergencyCoordinatorshouldnotwaituntil60minuteshaselapsed,butshoulddeclaretheeventassoonasitisdeterminedthatthereleasedurationhasorwilllikelyexceed60minutes.MonitorindicationsarecalculatedonthebasisofthemethodologyofthesiteOffsiteDoseCalculationManual(ODCM).Annualaveragemeteorologyisused.Validmeansthataradiationmonitorreadinghasbeenconfirmedbytheoperatorstobecorrect.PEG
: 1. FR-Z.1 "Response to High Containment Pressure" 4-18
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 0 Many EALs are'ased on actual or potential degradation of fission product barriers because of the increased potential for o&#xc3;site radioactivity release.
Degradation of fission product barriers though, is not always apparent via non-radiological symptoms. Therefore, direct indication of increased radiological effluents or area radiation levels are appropriate symptoms for emergency classification.
At lower levels, abnormal radioactivity releases may    be indicative of a failure of containment systems or precursors to more significant releases. At higher release rates, offsite radiological conditions may result which require offsite protective actions. Increased area radiation levels in plant may also be
                                                                  'i indicative of the failure of containment systems or preclude access to plant vital equipment necessary to ensure plant safety.
There are two basic indications of radioactivity release rates and one for area radiation levels which warrant emergency classifications.
Di    iii    ii f Bl i           ii systems provides a rapid assessment mechanism to determine releases
                                                                                'g in excess of classifiable limits.
P                                                 Projected offsite doses (based on effluent monitor readings) or actual offsite field measurements indicating doses or dose rates above classifiable limits.
: Sustained general area radiation levels in excess of those indicating loss of control of radioactive materials or those levels which may preclude access to vital plant areas also warrant emergency classification.
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation                5.1    Effluent Monitors 5.1.1 Unusual Event
                                                                )
A valid reading on any monitors Table 5.1 column "NUE" for 60 min. unless sample analysis can confirm release rates < 2 x technical specifications within this time period.
Table 5.1  Effluent Monitor Classification Thresholds Monitor              NUE            Alert R-11            1.62E6 cpm    N/A              N/A                  N/A R-12            7.80E6 cpm    1.07E7 cpm        N/A                  N/A R-13            2.20E4 cpm    N/A              N/A                  N/A R-14            6.40E5 cpm    1.61E6 cpm        N/A                  N/A R-15            4.00E5 cpm    2.31E7 cpm        N/A                  N/A R-18            3.60E5 cpm    offscale hi      N/A                  N/A R-12A(7/9)      N/A            N/A                6.00 p,Ci/cc        60.00    pCi/cc R-14A(7/9)      N/A            N/A                0.533 p,Ci/cc        5.33      p,Ci/cc R-15 A(7/9)    N/A            N/A                11.50 pCi/cc          115.00  p,Ci/cc R-31/32 1 ARV        N/A            1.900  mR/hr      19.0 mR/hr            190  mR/hr 1 Safety      N/A            0.951  mR/hr      9.51 mR/hr          95.1  mRhr 2 Safety      N/A            0.476  mR/hr      4.76 mR/hr          47.6  m R/hr 3 Safety      N/A            0.317  mR/hr      3.17 mR/hr          31.7  mR/hr 4 Safety      N/A            0.238  mR/hr      2.38 mR/hr          23.8  mR/hr NU1KARC IC:
Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.
FPB loss/potential loss:
N/A Mode Applicability:
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 Basis:
The "value shown" for each monitor is two times the calculated Technical Specification release rates as specified in P-9 section 2.4.
Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. The final integrated dose (which is very low in the Unusual Event emergency class) is not the primary concern here; it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes. Therefore, it is not intended that the release be averaged over 60 minutes. For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.
Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes.
Monitor indications are calculated on the basis of the methodology of the site Offsite Dose Calculation Manual (ODCM). Annual average meteorology is used.
Valid means that a radiation monitor reading has been confirmed by the operators to be correct.
PEG  


==Reference:==
==Reference:==
AU1.1BasisReference(s):1.2.3.4.5.6.EPIP2-3EmergencyReleaseRateDeterminationP-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessmentTechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.3"CalculationsforNU)~CEALs"byP.S.PolfleitFileEAL.XLSRD-15.0ODCM5.3 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.1EffluentMonitors5.1.2Alert.AvalidreadingonanymonitorsTable5.1column"Alert"for>15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"Alert"withinthistimeperiod.MonitorTable5.1EfQuentMonitorClassificationThresholdsNUEQE,R-11R-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50pCi/cc19.0mEVhr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrTable5.2DoseProjection/Env.MeasurementClassificationThresholdsTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr 0
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0NUINARCIC:Anyunplannedreleaseofgaseousorliquidradioactivitytotheenvironmentthatexceeds200timesradiologicalTechnicalSpecificationsfor15minutesorlonger.FPBloss/potentialloss:N/AModeApplicability:Basis:ThiseventescalatesfromtheUnusualEventbyescalatingthemagnitudeofthereleasebyafactorof100.Proratingthe500mR/yrcriterionforbothtime(8766hr/yr)andthe200multiplier,theassociatedsiteboundarydoseratewouldbe10mR/hr.Therequiredreleasedurationwasreducedto15minutesinrecognitionoftheincreasedseverity.MonitorindicationsarecalculatedonthebasisofthemethodologyoftheEPIP2-18ControlRoomDoseAssessment.Annualaveragemeteorologyisused.Aspreviouslystated;the10mR/hrvalueisbasedonaprorationof200timesthe500mR/yrbasisofthe10CFR20non-occupationalMPClimits,roundeddownto10mR/hr.Thevaluesforthegaseouseffluentradiationmonitorsarebaseduponnotexceeding10mR/hratthesiteboundaryasaresultoftherelease.TheconversionfactorsarebaseduponthemixtureofnoblegaspresentinreactorcoolantduringtheV25/82tuberupture-normaloperations.Sincethereisnohighrangemonitorassociatedwithliquide6luentmonitorR-18andthe200xTechnicalSpecificationvalueisbeyondit'supperscale,anindicationof"offscalehi"isconservativelyused.Validmeansthataradiationmonitorreadinghasbeenconfirmedbytheoperatorstobecorrect.


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0PEG
AU1.1 Basis Reference(s):
: 1. EPIP 2-3 Emergency Release Rate Determination
: 2. P-9 Radiation Monitoring System
: 3. EPIP 2-18 Control Room Dose Assessment
: 4. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
: 5.    "Calculations for NU)~C EALs" by P.S. Polfleit File EAL.XLS
: 6. RD-15.0 ODCM 5.3
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation                5.1    Effluent Monitors 5.1.2  Alert
.A valid reading on any monitors Table 5.1 column "Alert" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "Alert" within this time period.
Table 5.1  EfQuent Monitor Classification Thresholds Monitor              NUE                                                      QE, R-11            1.62E6  cpm    N/A              N/A                  N/A R-12            7.80E6  cpm    1.07E7 cpm        N/A                  N/A R-13            2.20E4  cpm    N/A              N/A                  N/A R-14            6.40E5  cpm    1.61E6 cpm        N/A                  N/A R-15            4.00E5  cpm    2.31E7 cpm        N/A                  N/A R-18            3.60E5  cpm    offscale hi      N/A                  N/A R-12 A(7/9)    N/A            N/A              6.00 pCi/cc          60.00    pCi/cc R-14A(7/9)      N/A            N/A              0.533 pCi/cc          5.33    pCi/cc R-15 A(7/9)    N/A            N/A                11.50 pCi/cc        115.00  pCi/cc R-31/32 1 ARV        N/A            1.900  mR/hr      19.0 mEVhr          190 mR/hr 1 Safety      N/A            0.951  mR/hr      9.51 mR/hr            95.1 mRhr 2 Safety      N/A            0.476  mR/hr      4.76 mR/hr            47.6 m R/hr 3 Safety      N/A            0.317  mR/hr      3.17 mR/hr            31.7 mR/hr 4 Safety      N/A            0.238  mR/hr      2.38 mR/hr            23.8 mR/hr Table 5.2    Dose Projection/ Env. Measurement Classification Thresholds TEDE                            10 mR              100 mR              1000 mR CDE Thyroid                    N/A                500 mR              5000 mR TEDE rate                      10  mR/hr          100 mR/hr            1000 mR/hr CDE Thyroid rate                N/A                500 mR/hr            5000 mR/hr
 
0 OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 NUINARC IC:
Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This event escalates from the Unusual Event by escalating the magnitude of the release by a factor of 100. Prorating the 500 mR/yr criterion for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr. The required release duration was reduced to 15 minutes in recognition of the increased severity.
Monitor indications are calculated on the basis of the methodology of the EPIP 2-18 Control Room Dose Assessment. Annual average meteorology is used.
As previously stated; the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits, rounded down to 10 mR/hr. The values for the gaseous effluent radiation monitors are based upon not exceeding 10 mR/hr at the site boundary as a result of the release.
The conversion factors are based upon the mixture of noble gas present in reactor coolant during the V25/82 tube rupture - normal operations.
Since there is no high range monitor associated with liquid e6luent monitor R-18 and the 200x Technical Specification value is beyond it's upper scale, an indication of "offscale hi" is conservatively used.
Valid means that a radiation monitor reading has been confirmed by the operators to be correct.
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 0 PEG


==Reference:==
==Reference:==
AA1.1BasisReference(s):1.2.3.45.EPIP2-3EmergencyReleaseRateDeterminationP-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessmentTechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.3"CalculationsforNUMARCEALs"byP.S.PolfleitFileEAL.XLS OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.1EffluentMonitors5.1.3SiteAreaEmergencyAvalidreadingonanymonitorsTable5.1column"SAE"for)15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"SAE"withinthistimeperiod.MonitorTable5.1EfHuentMonitorClassificationThresholdsAlertR-11R-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4Safety1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533pCi/cc11.50p,Ci/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mR/hr95.1mRhr47.6mR/hr31.7mEUhr23.8mR/hrTable5.2DoseProjection/Env.MeasurementClassificationThresholdsAlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0MBCARCIC:Boundarydoseresultingfromanactualorimminentreleaseofgaseousradioactivityexceeds100mRemTEDEor500mRCDEThyroidfortheactualorprojecteddurationoftherelease.FPBloss/potentialloss:N/AModeApplicability:Basis:ThevaluesshownweredeterminedutilizingEPIP2-18"ControlRoomDoseAssessment"basedupona100mRwholebodyexposure.Thecalculationsmadetheassumptionofneutralstabilityandan8mphwindspeed.Theseconditionsrepresentannualaveragemeteorology.Themostrestrictivex/Qvaluesatthe0-0.5miledistancewereused.EPIP2-18specifiesthatwholebodydoseislimitingwithrespecttoemergencyclassificationandprotectiveactionrecommendationsbasedupontheassumptionofanoblegastoiodineratioof1E-4.The100mRintegrateddoseisbasedontheproposed10CFR20annualaveragepopulationexposure.Thisvaluealsoprovidesadesirablegradient(oneorderofmagnitude)betweentheAlert,SiteAreaEmergency,andGeneralEmergencyclasses.ItisdeemedthatexposureslessthanthislimitarenotconsistentwiththeSiteAreaEmergencyclassdescription.The500mRintegratedchildthyroiddosewasestablishedinconsiderationofthe1:5ratiooftheEPAProtectiveActionGuidelinesforwholebodythyroid.Integrateddosesaregenerallynotmonitoredinreal-time.Inestablishingtheemergencyactionlevels,adurationofonehourisassumed,basedonasiteboundarydoseof100mR/hourwholebodyor500mR/hourchildthyroid,whicheverismorelimiting(dependsonsourcetermassumptions).AlthoughEPIP2-18providesforR-3V32releasedeterminations,thevariabilityofresultsbaseduponthenumberofARV'sand/orSV'sprecludestheuseofanysinglemonitordefaultvalueforthesemonitors.Validmeansthataradiationmonitorreadinghasbeencon6rmedbytheoperatorstobecorrect.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0PEG
AA1.1 Basis Reference(s):
: 1. EPIP 2-3 Emergency Release Rate Determination
: 2. P-9 Radiation Monitoring System
: 3. EPIP 2-18 Control Room Dose Assessment 4      Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
: 5.    "Calculations for NUMARC EALs" by P.S. Polfleit File EAL.XLS
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation                5.1    Effluent Monitors 5.1.3 Site Area Emergency A valid reading on any monitors Table 5.1 column "SAE" for ) 15 min. unless dose assessment can confirm releases are below Table 5.2 column "SAE" within this time period.
Table 5.1    EfHuent Monitor Classification Thresholds Monitor                              Alert R-11            1.62E6 cpm      N/A              N/A                  N/A R-12            7.80E6 cpm      1.07E7 cpm        N/A                  N/A R-13            2.20E4 cpm      N/A              N/A                  N/A R-14            6.40E5 cpm      1.61E6 cpm        N/A                  N/A R-15            4.00E5 cpm      2.31E7 cpm        N/A                  N/A R-18            3.60E5 cpm      offscale hi      N/A                  N/A R-12A(7/9)      N/A            N/A              6.00 pCi/cc          60.00    pCi/cc R-14A(7/9)      N/A            N/A              0.533 pCi/cc          5.33      pCi/cc R-15 A(7/9)    N/A            N/A                11.50 p,Ci/cc        115.00    pCi/cc R-31/32 1 ARV        N/A            1.900  mR/hr      19.0 mR/hr          190  mR/hr 1 Safety      N/A            0.951  mR/hr      9.51  mR/hr          95.1  mRhr 2 Safety      N/A            0.476  mR/hr      4.76  mR/hr          47.6  m R/hr 3 Safety      N/A            0.317  mR/hr      3.17  mR/hr          31.7  mEUhr 4 Safety      N/A            0.238  mR/hr      2.38  mR/hr          23.8  mR/hr Table 5.2    Dose Projection/ Env. Measurement Classification Thresholds Alert TEDE                            10 mR              100 mR              1000 mR CDE Thyroid                    N/A                500 mR              5000 mR TEDE rate                      10  mR/hr          100 mR/hr            1000 mR/hr CDE Thyroid rate                N/A                500 mR/hr            5000 mR/hr
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 0 MBCARC IC:
Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
The values shown were determined utilizing EPIP 2-18 "Control Room Dose Assessment" based upon a 100 mR whole body exposure. The calculations made the assumption of neutral stability and an 8 mph wind speed. These conditions represent annual average meteorology. The most restrictive x/Q values at the 0 - 0.5 mile distance were used. EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of 1E-4.
The 100 mR integrated dose is based on the proposed 10CFR20 annual average population exposure. This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes. It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class description. The 500 mR integrated child thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.
Integrated doses are generally not monitored in real-time. In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 100 mR/hour whole body or 500 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).
Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.
Valid means that a radiation monitor reading has been con6rmed by the operators to be correct.
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 0 PEG


==Reference:==
==Reference:==
AS1.1BasisReference(s):1.2.3.45.P-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessmentFSARTable2.3"CalculationsforMJMARCEALs"byP.S.PolfleitFileEAL.XLSRD-15.0ODCMTables3,5and7 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.1.4GeneralEmergency5.1EQ1uentMonitorsAvalidreadingonanymonitorsTable5.1column"GE"for>15min.unlessdoseassessmentcanconfirmreleasesarebelowTable5.2column"GE"withinthistimeperiod.Table5.1EfQuentMonitorClassificationThresholdsMonitorR-11R-12R-13R-14R-15R-18R-12A(7/9)R-14A(7/9)R-15A(7/9)R-31/321ARV1Safety2Safety3Safety4SafetyNUE1.62E6cpm7.80E6cpm2.20E4cpm6.40E5cpm4.00E5cpm3.60E5cpmN/AN/AN/AN/AN/AN/AN/AN/AAlertN/A1.07E7cpmN/A1.61E6cpm2.31E7cpmoffscalehiN/AN/AN/A1.900mR/hr0.951mR/hr0.476mR/hr0.317mR/hr0.238mR/hrN/AN/AN/AN/AN/AN/A6.00pCi/cc0.533p,Ci/cc11.50pCi/cc19.0mR/hr9.51mR/hr4.76mR/hr3.17mR/hr2.38mR/hrN/AN/AN/AN/AN/AN/A60.00pCi/cc5.33pCi/cc115.00pCi/cc190mEUhr95.1mRhr47.6mR/hr31.7mR/hr23.8mR/hrTable5.2DoseProjection/Env.MeasurementClassificationThresholdsTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mR/hr5000mR/hr5-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0NUIVCARCIC:Boundarydoseresultingfromanactualorimminentreleaseofgaseousradioactivityexceeds1000mRemTEDEor5000mRCDEThyroidfortheactualorprojecteddurationofthereleaseusingactualmeteorology.FPBloss/potentialloss:N/AModeApplicability:Basis:ThevaluesshownweredeterminedutilizingEPIP2-18"ControlRoomDoseAssessment"basedupona1000mRwholebodyexposure.Thecalculationsmadetheassumptionofneutralstabilityandan8mphwindspeed.Theseconditionsrepresentannualaveragemeteorology.EPIP2-18specifiesthatwholebodydoseislimitingwithrespecttoemergencyclassificationandprotectiveactionrecommendationsbasedupontheassumptionofanoblegastoiodineratiooflE-4.The1000mRwholebodyandthe5000mRchildthyroidintegrateddosearebasedontheEPAprotectiveactionguidancewhichindicatesthatpublicprotectiveactionsareindicatedifthedoseexceeds1remwholebodyor5remchildthyroid.ThisisconsistentwiththeemergencyclassdescriptionforaGeneralEmergency.ThislevelconstitutestheupperlevelofthedesirablegradientfortheSiteAreaEmergency.Integrateddosesaregenerallynotmonitoredinreal-time.Inestablishingtheemergencyactionlevels,adurationofonehourisassumed,basedonasiteboundarydoseof1000mR/hourwholebodyor5000mR/hourchildthyroid,whicheverismorelimiting(dependsonsourcetermassumptions).AlthoughEPIP2-18providesforR-3V32releasedeterminations,thevariabilityofresultsbaseduponthenumberofARV'sand/orSV'sprecludestheuseofanysinglemonitordefaultvalueforthesemonitors.Validmeansthataradiationmonitorreadinghasbeen,con6rmedbytheoperatorstobecorrect.5-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0PEG
 
AS1.1 Basis Reference(s):
: 1. P-9 Radiation Monitoring System
: 2. EPIP 2-18 Control Room Dose Assessment
: 3. FSAR Table 2.3 4      "Calculations for MJMARC EALs" by P.S. Polfleit File EAL.XLS
: 5. RD-15.0 ODCM Tables 3, 5 and 7
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation                  5.1   EQ1uent Monitors 5.1.4 General Emergency A valid reading on any monitors Table 5.1 column "GE" for >         15 min. unless dose assessment    can confirm releases are below Table 5.2 column "GE" within this time period.
Table 5.1    EfQuent Monitor Classification Thresholds Monitor              NUE                Alert R-11            1.62E6  cpm      N/A                N/A                  N/A R-12            7.80E6  cpm      1.07E7 cpm        N/A                  N/A R-13            2.20E4  cpm      N/A                N/A                  N/A R-14            6.40E5  cpm      1.61E6 cpm        N/A                    N/A R-15            4.00E5  cpm      2.31E7 cpm        N/A                    N/A R-18            3.60E5  cpm      offscale hi        N/A                    N/A R-12A(7/9)      N/A              N/A                6.00 pCi/cc            60.00 pCi/cc R-14A(7/9)      N/A              N/A                0.533 p,Ci/cc          5.33    pCi/cc R-15 A(7/9)    N/A              N/A                11.50 pCi/cc          115.00 pCi/cc R-31/32 1 ARV        N/A              1.900  mR/hr      19.0 mR/hr            190 mEUhr 1 Safety      N/A              0.951  mR/hr      9.51 mR/hr            95.1 mRhr 2 Safety      N/A              0.476  mR/hr      4.76 mR/hr            47.6 m R/hr 3 Safety      N/A              0.317  mR/hr      3.17 mR/hr            31.7 mR/hr 4 Safety      N/A              0.238  mR/hr      2.38 mR/hr            23.8 mR/hr Table 5.2      Dose Projection  / Env. Measurement Classification Thresholds TEDE                              10 mR              100 mR                1000 mR CDE Thyroid                      N/A              500 mR                5000 mR TEDE rate                        10 mR/hr          100 mR/hr            1000 mR/hr CDE Thyroid rate                  N/A              500 mR/hr              5000 mR/hr 5-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 NUIVCARC IC:
Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
The values shown were determined utilizing EPIP 2-18 "Control Room Dose Assessment" based upon a 1000 mR whole body exposure. The calculations made the assumption of neutral stability and an 8 mph wind speed. These conditions represent annual average meteorology. EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of lE-4.
The 1000 mR whole body and the 5000 mR child thyroid integrated dose are based on the EPA protective action guidance which indicates that public protective actions are indicated ifthe dose exceeds 1 rem whole body or 5 rem child thyroid. This is consistent with the emergency class description for a General Emergency. This level constitutes the upper level of the desirable gradient for the Site Area Emergency.
Integrated doses are generally not monitored in real-time. In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 1000 mR/hour whole body or 5000 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).
Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.
Valid means that a radiation monitor reading has been, con6rmed by the operators to be correct.
5-11
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 0 PEG


==Reference:==
==Reference:==
AG1.1*BasisReference(s):l.2.3.4P-9'RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessmentFSARTable2.3"CalculationsforMV~CEALs"byP.S.PolQeitFileEAL.XLS5-12 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2.1UnusualEventConfirmedsampleanalysesforgaseousorliquidreleaserates>2xtechnicalspecificationslimitsfor>60min.NUINARCIC:AnyunplannedreleaseofgaseousorliquidradioactivitytotheenvironmentthatexceedstwotimestheradiologicalTechnicalSpecificationsfor60minutesorlonger.FPBloss/potentialloss:N/AModeApplicability:Basis:Unplannedreleasesinexcessoftwotimesthesitetechnicalspecificationsthatcontinuefor60minutesorlongerrepresentanuncontrolledsituationandhence,apotentialdegradationinthelevelofsafety.Thefinalintegrateddose(whichisverylowintheUnusualEventemergencyclass)isnottheprimaryconcernhere;itisthedegradationinplantcontrolimpliedbythefactthatthereleasewasnotisolatedwithin60minutes.Therefore,itisnotintendedthatthereleasebeaveragedover60minutes.Forexample,areleaseof4timesT/Sfor30minutesdoesnotexceedthisinitiatingcondition.Further,theEmergencyCoordinatorshouldnotwaituntil60minuteshaselapsed,butshoulddeclaretheeventassoonasitisdeterminedthatthereleasedurationhasorwilllikelyexceed60minutesPEG
 
AG1.1 Basis Reference(s):
: l. P-9'Radiation Monitoring System
: 2. EPIP 2-18 Control Room Dose Assessment
: 3. FSAR Table 2.3 4      "Calculations for MV~C EALs" by P.S. PolQeit File EAL.XLS 5-12
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.2    Dose Projections/ Environmental Measurements/Release                Rates 5.2.1  Unusual Event Confirmed sample analyses for gaseous or liquid release rates > 2 x technical specifications limits for > 60 min.
NUINARC IC:
Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. The final integrated dose (which is very low in the Unusual Event emergency class) is not the primary concern here; it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes. Therefore, it is not intended that the release be averaged over 60 minutes. For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.
Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes PEG


==Reference:==
==Reference:==
AU1.25-13 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0BasisReference(s):,1.TechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.35-14 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2.2AlertConfirmedsampleanalysesforgaseousorliquidreleaserates)200xtechnicalspecificationslimitsfor>15min.NUINARCIC:Anyunplannedreleaseofgaseousorliquidradioactivitytotheenvironmentthatexceeds200timesradiologicalTechnicalSpecificationsfor15minutesorlonger.FPBloss/potentialloss:N/AModeApplicability:Basis:Confirmedsampleanalysesinexcessoftwohundredtimesthesitetechnicalspecificationsthatcontinuefor15minutesorlongerrepresentanuncontrolledsituationandhence,apotentialdegradationinthelevelofsafety.ThiseventescalatesfromtheUnusualEventbyincreasingthemagnitudeofthereleasebyafactorof100overtheUnusualEventlevel(i.e.,200timesTechnicalSpecifications).Proratingthe500mR/yrbasisofthe10CFR20non-occupationalMPClimitsforbothtime(8766hr/yr)andthe200multiplier,theassociatedsiteboundarydoseratewouldbe10mR/hr.Therequiredreleasedurationwasreducedto15minutesinrecognitionoftheincreasedseverity.PEG
 
AU1.2 5- 13
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):,
: 1. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3 5-14
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.2    Dose Projections/ Environmental Measurements/ Release Rates 5.2.2 Alert Confirmed sample analyses for gaseous or liquid release rates      ) 200 x technical specifications limits for > 15 min.
NUINARC IC:
Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Confirmed sample analyses in excess of two hundred times the site technical specifications that continue for 15 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i. e.,
200 times Technical Specifications). Prorating the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr. The required release duration was reduced to 15 minutes in recognition of the increased severity.
PEG  


==Reference:==
==Reference:==
AA1.25-15 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0BasisReference(s):1.TechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.35-16 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2.3AlertDoseprojectionsorfieldsurveysresultingfromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"Alert"atthesiteboundaryorbeyond.Table5.2DoseProjection/Env.MeasurementClassificationThresholdsAlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mB/hrN/A100mR500mR100mR/hr500mR/hr1000mR5000mR1000mH/hr5000mR/hrNUMARCIC:Anyunplannedreleaseofgaseousorliquidradioactivitytotheenvironmentthatexceeds200timesradiologicalTechnicalSpecificationsfor15minutesorlongerFPBloss/potentialloss:N/AModeApplicability:Basis.Offsiteintegrateddosesinexcessof10mRTEDEordoseratesinexcessof10mR/hrTEDErepresentanuncontrolledsituationandhence,apotentialdegradationinthelevelofsafety.ThiseventescalatesfromtheUnusualEventbyincreasingthemagnitudeofthereleasebyafactorof100overtheUnusualEventlevel(i.e.,200timesTechnicalSpecifications).Proratingthe5-17 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0500mR/yrbasisof10CFR20forbothtime(8766hr/yr)andthe200multiplier,theassociatedsiteboundarydoseratewouldbe10mR/hr.Aspreviouslystated,the10mR/hrvalueisbasedonaprorationof200timesthe500mR/yrbasisof10CFR20,roundeddownto10mR/hr.PEG
 
AA1.2 5-15
 
OSSI-92-402A-4-RE G                    Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):
: 1. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3 5-16
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.2    Dose Projections/ Environmental Measurements/ Release Rates 5.2.3 Alert Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates > Table 5.2 column "Alert" at the site boundary or beyond.
Table 5.2    Dose Projection  / Env. Measurement Classification Thresholds Alert TEDE                            10 mR              100 mR              1000 mR CDE Thyroid                      N/A              500 mR                5000 mR TEDE rate                        10 mB/hr          100 mR/hr            1000 mH/hr CDE Thyroid rate                N/A              500 mR/hr            5000 mR/hr NUMARC IC:
Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer FPB loss/potential loss:
N/A Mode Applicability:
Basis.
Offsite integrated doses in excess of 10 mR TEDE or dose rates in excess of 10 mR/hr TEDE represent an uncontrolled situation and hence, a potential degradation in the level of safety. This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i. e., 200 times Technical Specifications). Prorating the 5-17
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 0 500 mR/yr basis of 10CFR20 for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.
As previously stated, the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of 10CFR20, rounded down to 10 mR/hr.
PEG  


==Reference:==
==Reference:==
AA1.2BasisReference(s):2.3.4TechnicalSpecifications,AmendmentNo.24,Article's3.9.1.1thru3.9.2.3EPIP2-3EmergencyReleaseRateDeterminationP-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessment5-18


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2.4SiteAreaEmergencyDoseprojectionsorfieldsurveysresultingfromactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"SAE"atthesiteboundaryorbeyond.Table5.2DoseProjection/Env.MeasurementClassificationThresholdsTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mR/hrN/A100mR500mR100mH/hr500mH/hr1000mR5000mR1000mH/hr5000mH/hrNUINARCIC:Boundarydoseresultingfromanactualorimminentreleaseofgaseousradioactivityexceeds100mRemTEDEor500mRCDEThyroidfortheactualorprojecteddurationoftherelease.FPBloss/potentialloss:N/AModeApplicability:'Basis:The100mRintegratedTEDEdoseinthisEALisbasedontheproposed10CFR20annualaveragepopulationexposure.Thisvaluealsoprovidesadesirablegradient(oneorderofmagnitude)betweentheAlert,SiteAreaEmergency,andGeneralEmergencyclasses.ItisdeemedthatexposureslessthanthislimitarenotconsistentwiththeSiteAreaEmergencyclass5-19 OSSI-92-402A-4-BEGGinnaEALTechnicalBasesDocument,Rev0description.The500mRintegratedCDEthyroiddosewasestablishedinconsiderationofthe1:5ratiooftheEPAProtectiveActionGuidelinesforwholebodythyroid.Inestablishingthedoserateemergencyactionlevels,adurationofonehourisassumed.Therefore,thedoserateEALsarebasedonasiteboundarydoserateof100mR/hrTEDEor500mRlhrCDEthyroid,whicheverismorelimiting.PEG
AA1.2 Basis Reference(s):
Technical Specifications, Amendment No. 24, Article's 3.9.1.1 thru 3.9.2.3
: 2. EPIP 2-3 Emergency Release Rate Determination
: 3. P-9 Radiation Monitoring System 4      EPIP 2-18 Control Room Dose Assessment 5-18
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.2    Dose Projections/ Environmental Measurements/ Release Rates 5.2.4 Site Area Emergency Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates > Table 5.2 column "SAE" at the site boundary or beyond.
Table 5.2    Dose Projection  / Env. Measurement Classification Thresholds TEDE                            10 mR              100 mR              1000 mR CDE Thyroid                      N/A              500 mR                5000 mR TEDE rate                        10 mR/hr          100 mH/hr            1000 mH/hr CDE Thyroid rate                N/A                500 mH/hr            5000 mH/hr NUINARC IC:
Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.
FPB loss/potential loss:
N/A Mode Applicability:
'Basis:
The 100 mR integrated TEDE dose in this EAL is based on the proposed 10CFR20 annual average population exposure. This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes. It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class 5-19
 
OSSI-92-402A-4-BEG                        Ginna EAL Technical Bases Document, Rev 0 description. The 500 mR integrated CDE thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid. In establishing the dose rate emergency action levels, a duration of one hour is assumed. Therefore, the dose rate EALs are based on a site boundary dose rate of 100 mR/hr TEDE or 500 mRlhr CDE thyroid, whichever is more limiting.
PEG  


==Reference:==
==Reference:==
AS1.3AS1.4BasisReference(s):2.3.TechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.3EPIP2-3EmergencyReleaseRateDeterminationP-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessmentt5-20 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.2DoseProjections/EnvironmentalMeasurements/ReleaseRates5.2.5GeneralEmergencyDoseprojectionsorfieldsurveysresultingRomactualorimminentreleasewhichindicatedoses/doserates>Table5.2column"GE"atthesiteboundaryorbeyond.Table5.2DoseProection/Env.MeasurementClassificationThresholdsAlertTEDECDEThyroidTEDErateCDEThyroidrate10mRN/A10mH/hrN/A100mR500mR100mH/hr500mR/hr1000mR5000mR1000mH/hr5000mH/hrNUIHARCICBoundarydoseresultingfromanactualorimminentreleaseofgaseousradioactivityexceeds1000mRemTEDEor5000mRCDEThyroidfortheactualorprojecteddurationofthereleaseusingactualmeteorology.FPBloss/potentialloss:N/AModeApplicability:Basis:TheGeneralEmergencyvaluesofTable5.2arebasedontheboundarydoseresultingfromanactualorimminentreleaseofgaseousradioactivitythatexceeds1000mRTEDEor5000mRCDEthyroidfortheactualorprojecteddurationoftherelease.The1000mRTEDEandthe5000mRCDEthyroidintegrateddosearebasedontheEPAprotectiveactionguidancewhich5-21 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0indicatesthatpublicprotectiveactionsareindicatedifthedoseexceeds1remTEDEor5remCDEthyroid.ThisisconsistentwiththeemergencyclassdescriptionforaGeneralEmergency.ThislevelconstitutestheupperlevelofthedesirablegradientfortheSiteAreaEmergency.Actualmeteorologyisspecificallyidentifiedsinceitgivesthemostaccuratedoseassessment.Actualmeteorology(includingforecasts)shouldbeusedwheneverpossible.Inestablishingthedoserateemergencyactionlevels,adurationofonehourisassumed.Therefore,thedoserateEALsarebasedonasiteboundarydoserateof1000mR/hrTEDEor5000mR/hrCDEthyroid,whicheverismorelimiting.PEG
 
AS1.3 AS1.4 Basis Reference(s):
Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
: 2. EPIP 2-3 Emergency Release Rate Determination
: 3. P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment t
5-20
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.2    Dose Projections/ Environmental Measurements/ Release Rates 5.2.5 General Emergency Dose projections or field surveys resulting Rom actual or imminent release which indicate doses / dose rates > Table 5.2 column "GE" at the site boundary or beyond.
Table 5.2    Dose Pro ection  / Env. Measurement Classification Thresholds Alert TEDE                            10 mR            100 mR                1000 mR CDE Thyroid                    N/A                500 mR                5000 mR TEDE rate                        10 mH/hr          100 mH/hr            1000 mH/hr CDE Thyroid rate                N/A                500 mR/hr            5000 mH/hr NUIHARC IC Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
The General Emergency values of Table 5.2 are based on the boundary dose resulting from an actual or imminent release of gaseous radioactivity that exceeds 1000 mR TEDE or 5000 mR CDE thyroid for the actual or projected duration of the release. The 1000 mR TEDE and the 5000 mR CDE thyroid integrated dose are based on the EPA protective action guidance which 5-21
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 0 indicates that public protective actions are indicated ifthe dose exceeds 1 rem TEDE or 5 rem CDE thyroid. This is consistent with the emergency class description for a General Emergency. This level constitutes the upper level of the desirable gradient for the Site Area Emergency. Actual meteorology is specifically identified since it gives the most accurate dose assessment.
Actual meteorology (including forecasts) should be used whenever possible.
In establishing the dose rate emergency action levels, a duration of one hour is assumed. Therefore, the dose rate EALs are based on a site boundary dose rate of 1000 mR/hr TEDE or 5000 mR/hr CDE thyroid, whichever is more limiting.
PEG  


==Reference:==
==Reference:==
AG1.3AG1.4~BasisReference(s):2.3.4TechnicalSpecifications,AmendmentNo.24,Articles3.9.1.1thru3.9.2.3EPIP2-3EmergencyReleaseRateDeterminationP-9RadiationMonitoringSystemEPIP2-18ControlRoomDoseAssessment5-22 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.3AreaRadiationLevels5.3.1UnusualEventAnysustaineddirectARMreadings>100xalarmoroffscalehiresultingfromanuncontrolledprocessMMARCIC:Unexpectedincreaseinplantradiationorairborneconcentration.FPBloss/potentialloss:N/AModeApplicability:Basis:Validelevatedarearadiationlevelsusuallyhavelongleadtimesrelativetothepotentialforradiologicalreleasebeyondthesiteboundary,thusimpacttopublichealthandsafetyisverylow.ItshouldbenotedthattheCASandSASdonothaveinstalledradiationmonitors.Therefore,evaluationofthisEALwouldrequiresurveyoftheseareas.ThisEALaddressesunplannedincreasesinradiationlevelsinsidetheplant.Theseradiationlevelsrepresentadegradationinthecontrolofradioactivematerialandapotentialdegradationinthelevelofsafetyoftheplant.Arearadiationlevelsabove100timesthealarmsetpointhavebeenselectedbecausetheyarereadilyidentifiableonARMinstrumentation.SinceARMsetpointsarenominallysetonedecadeovernormallevels,100timesthealarmsetpointprovidesanappropriatethresholdforemergencyclassification.ForthoseARMswhoseupperrangelimitarelessthan100timesthealarmsetpoint,avalueofoffscalehighisused.ThisEALescalatestoanAlert,iftheincreasesimpairthelevelofsafeplantoperation.
 
00 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0PEG
AG1.3 AG1.4
~
Basis Reference(s):
Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
: 2. EPIP 2-3 Emergency Release Rate Determination
: 3. P-9 Radiation Monitoring System 4      EPIP 2-18 Control Room Dose Assessment 5-22
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.3    Area Radiation Levels 5.3.1 Unusual Event Any sustained direct ARM readings > 100 x alarm or offscale hi resulting from an uncontrolled process MMARC IC:
Unexpected increase in plant radiation or airborne concentration.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Valid elevated area radiation levels usually have long lead times relative to the potential for radiological release beyond the site boundary, thus impact to public health and safety is very low. It should be noted that the CAS and SAS do not have installed radiation monitors. Therefore, evaluation of this EAL would require survey of these areas.
This EAL addresses unplanned increases in radiation levels inside the plant.
These radiation levels represent a degradation in the control of radioactive material and a potential degradation in the level of safety of the plant. Area radiation levels above 100 times the alarm setpoint have been selected because they are readily identifiable on ARM instrumentation. Since ARM setpoints are nominally set one decade over normal levels, 100 times the alarm setpoint provides an appropriate threshold for emergency classification. For those ARMs whose upper range limit are less than 100 times the alarm setpoint, a value of offscale high is used. This EAL escalates if to an Alert, the increases impair the level of safe plant operation.
 
0 0
 
OSSI-92-402A-4-REG    Ginna EAL Technical Bases Document, Rev 0 PEG


==Reference:==
==Reference:==
AU2.4.BasisReference(s):None5-24 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.3AreaRadiationLevels5.3.2AlertSustainedarearadiationlevels)15ma/hrineither:ControlRoomORCentralAlarmStationandSecondaryAlarmStationIVUMARCIC:Releaseofradioactivematerialorincreasesinradiationlevelswithinthefacilitythatimpedesoperationofsystemsrequiredtomaintainsafeoperationsortoestablishormaintaincoldshutdown.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddressesincreasedradiationlevelsthatimpedenecessaryaccesstooperatingstationsrequiringcontinuousoccupancytomaintainsafeplantoperationorperformasafeplantshutdown.AreasrequiringcontinuousoccupancyincludetheControlRoom,thecentralalarmstation(CAS)andthesecondarysecurityalarmstation(SAS).ThesecurityalarmstationsareincludedinthisEALbecauseoftheirimportancetopermittingaccesstoareasrequiredtoassuresafeplantoperations.Thevalueof15mR/hrisderivedfromtheGDC19valueof5remin30dayswithadjustmentforexpectedoccupancytimes.AlthoughSectionIII.D.3ofNUREG-0737,"ClarificationofTMIActionPlanRequirements",providesthatthe15mR/hrvaluecanbeaveragedoverthe30days,thevalueisusedherewithoutaveraging.A30daydurationimpliesaneventpotentiallymoresignificantthananAlert.5-25 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0Itistheimpairedabilitytooperatetheplantthatresultsintheactualorpotentialdegradationofthelevelofsafetyoftheplant.ThecauseormagnitudeoftheincreaseinradiationlevelsisnotaconcernofthisEAL.TheEmergencyCoordinatormustconsiderthesourceorcauseoftheincreasedradiationlevelsanddetermineifanyotherEALsmaybeinvolved.Forexample,adoserateof15mR/hrintheControlRoommaybeaprobleminitself.However,theincreasemayalsobeindicativeofhighdoseratesinthecontainmentduetoaLOCA.Inthislattercase,aSiteAreaEmergencyoraGeneralEmergencymaybeindicatedbyotherEALcategories.ThisEALisnotintendedtoapplytoanticipatedtemporaryradiationincreasesduetoplannedevents(e.g.,radwastecontainermovement,depletedresintransfers,etc.).PEG
 
AU2.4
. Basis Reference(s):
None 5-24
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.3    Area Radiation Levels 5.3.2 Alert Sustained area radiation levels ) 15 ma/hr in either:
Control Room OR Central Alarm Station and Secondary Alarm Station IVUMARCIC:
Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses increased radiation levels that impede necessary access to operating stations requiring continuous occupancy to maintain safe plant operation or perform a safe plant shutdown. Areas requiring continuous occupancy include the Control Room, the central alarm station (CAS) and the secondary security alarm station (SAS). The security alarm stations are included in this EAL because of their importance to permitting access to areas required to assure safe plant operations.
The value of 15 mR/hr is derived from the GDC 19 value of 5 rem in 30 days with adjustment for expected occupancy times. Although Section III.D.3 of NUREG-0737, "Clarification of TMI Action Plan Requirements", provides that the 15 mR/hr value can be averaged over the 30 days, the value is used here without averaging. A 30 day duration implies an event potentially more significant than an Alert.
5-25
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant. The cause or magnitude of the increase in radiation levels is not a concern of this EAL.
The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine ifany other EALs may be involved.
For example, a dose rate of 15 mR/hr in the Control Room may be a problem in itself. However, the increase may also be indicative of high dose rates in the containment due to a LOCA. In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.
This EAL is not intended to apply to anticipated temporary radiation increases due to planned events (e. g., radwaste container movement, depleted resin transfers, etc.).
PEG  


==Reference:==
==Reference:==
AA3.1BasisReference(s):1.GDC192.NUREG-0737,"Clari6cationofTMIActionPlanRequirements",SectionIII.D.33.P-9RadiationMonitoringSystemRev.675-26 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev05.0RadioactivityRelease/AreaRadiation5.3AreaRadiationLevels5.3.3AlertSustainedabnormalarearadiationlevels>8R/hrwithinanyareas,Table5.3ANDAccessisrequiredtoestablishormaintaincoldshutdown.Table5.3PlantAreas~ReactorContainmentBuilding~AuxiliaryBuilding~TurbineBuilding~EmergencyDieselBuilding~ScreenHouse~StandbyAuxiliaryFeedwaterBuildingNUMARCIC:Releaseofradioactivematerialorincreasesinradiationlevelswithinthefacilitythatimpedesoperationofsystemsrequiredtomaintainsafeoperationsortoestablishormaintaincoldshutdown.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddressesincreasedradiationlevelsinareasrequiringinfrequentaccessinordertomaintainsafeplantoperationorperformasafeplantshutdown.Arearadiationlevelsatorabove8H/hrareindicativeofradiationfieldswhichmaylimitpersonnelaccessoradverselyaffectequipmentwhoseoperationmaybeneededtoassureadequatecorecoolingorshutdownthereactor.ThebasisofthevalueisdescribedinNMPCmemoFileCode5-27 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev0NMP31027"ExposureGuidelinesForUnusual/AccidentConditions".TheareasselectedareconsistentwiththoselistedinotherEALsandrepresentthosestructureswhichhousesystemsandequipmentnecessaryforthesafeoperationandshutdownoftheplant.Itistheimpairedabilitytooperatetheplantthatresultsintheactualorpotentialdegradationofthelevelofsafetyoftheplant.ThecauseormagnitudeoftheincreaseinradiationlevelsisnotaconcernofthisEAL.TheEmergencyCoordinatormustconsiderthesourceorcauseoftheincreasedradiationlevelsanddetermineifanyotherEALmaybeinvolved.Forexample,adoserateof8R/hrmaybeaprobleminitself.However,theincreasemayalsobeindicativeofhighdoseratesinthecontainmentduetoaLOCA.Inthislattercase,aSiteAreaEmergencyoraGeneralEmergencymaybeindicatedbyotherEALcategories.ThisEALisnotmeanttoapplytoincreasesinthecontainmentradiationmonitorsastheseareeventswhichareaddressedinotherEALs.Norisitintendedtoapplytoanticipatedtemporaryradiationincreasesduetoplannedevents(e.g.,radwastecontainermovement,depleteresintransfers,etc.).PEG
 
AA3.1 Basis Reference(s):
: 1.     GDC 19
: 2.     NUREG-0737, "Clari6cation of TMI Action Plan Requirements",
Section III.D.3
: 3.     P-9 Radiation Monitoring System Rev. 67 5-26
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 5.0    Radioactivity Release / Area Radiation 5.3    Area Radiation Levels 5.3.3 Alert Sustained abnor mal area radiation levels > 8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.
Table 5.3    Plant Areas
                    ~ Reactor Containment Building
                    ~ Auxiliary Building
                    ~ Turbine Building
                    ~ Emergency Diesel Building
                    ~ Screen House
                    ~ Standby Auxiliary Feedwater Building NUMARC IC:
Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses increased radiation levels in areas requiring infrequent access in order to maintain safe plant operation or perform a safe plant shutdown. Area radiation levels at or above 8 H/hr are indicative of radiation fields which may limit personnel access or adversely affect equipment whose operation may be needed to assure adequate core cooling or shutdown the reactor. The basis of the value is described in NMPC memo File Code 5-27
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 0 NMP31027 "Exposure Guidelines For Unusual/Accident Conditions". The areas selected are consistent with those listed in other EALs and represent those structures which house systems and equipment necessary for the safe operation and shutdown of the plant.
It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant. The cause or magnitude of the increase in radiation levels is not a concern of this EAL.
The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine ifany other EAL may be involved.
For example, a dose rate of 8 R/hr may be a problem in itself. However, the increase may also be indicative of high dose rates in the containment due to a LOCA. In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.
This EAL is not meant to apply to increases in the containment radiation monitors as these are events which are addressed in other EALs. Nor is it intended to apply to anticipated temporary radiation increases due to planned events (e. g., radwaste container movement, deplete resin transfers, etc.).
PEG  


==Reference:==
==Reference:==
AA3.2BasisReference(s):1.NiagaraMohawkPowerCorporationmemoFileCodeNMP31027"ExposureGuidelinesForUnusuaVAccidentConditions",Revision1,3/18/935-28 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Lossofvitalplantelectricalpowercancompromiseplantsafetysystemoperabilityincludingdecayheatremovalandemergencycorecoolingsystemswhichmaybenecessarytoensurefissionproductbarrierintegrity.Theeventsofthiscategoryhavebeengroupedintothefollowingtwolossofelectricalpowertypes:APr'hiscategoryincludeslossesofonsiteand/oro6'siteACpowersourcesincludingstationblackoutevents.fDPr'hiscategoryinvolvestotallossesofvitalplant125vdcpowersources.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.1.1UnusualEvent6.1LossofACPowerSourcesLossofabilitytosupplypowertothesafeguardbusesfromoffsitecircuits751and767for>15min.NUINARCIC:Lossofalloffsitepowertoessentialbussesforgreaterthan15minutes.FPBloss/potentialloss:N/AModeApplicability:Basis:ProlongedlossofalloFsiteACpowerreducesrequiredredundancyandpotentiallydegradesthelevelofsafetyoftheplantbyrenderingtheplantmorevulnerabletoacompletelossofACpower(stationblackout).Fifteenminuteswasselectedasathresholdtoexcludetransientormomentarypowerlosses.PEG
AA3.2 Basis Reference(s):
: 1. Niagara Mohawk Power Corporation memo File Code NMP31027 "Exposure Guidelines For UnusuaVAccident Conditions", Revision        1, 3/18/93 5-28
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Loss of vital plant electrical power can compromise plant safety system operability including decay heat removal and emergency core cooling systems which may be necessary to ensure fission product barrier integrity.
The events of this category have been grouped into the following two loss of electrical power types:
A P      r        'his  category includes losses of onsite and/or o6'site AC power sources including station blackout events.
fD    P    r        'his category involves total losses    of vital plant 125 vdc power sources.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures              6.1   Loss of AC Power Sources 6.1.1 Unusual Event Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for > 15 min.
NUINARC IC:
Loss of all offsite power to essential busses for greater than 15 minutes.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
Prolonged loss of all oFsite AC power reduces required redundancy and potentially degrades the level of safety of the plant by rendering the plant more vulnerable to a complete loss of AC power (station blackout). Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.
PEG  


==Reference:==
==Reference:==
SU1.1BasisReference(s):1.RGE-6"4160VElectricalDistributionSystem"2.RGE-7"480VDistribution" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.1LossofACPowerSources6.1.2AlertLossof'allsafeguardsbusACpowerfor>15min.NUlKARCIC:LossofalloffsitepowerandlossofallonsiteACpowertoessentialbussesduringcoldshutdown,refuelingordefueledmode.FPBloss/potentialloss:N/AModeApplicability:ColdShutdown,Refueling,DefueledBasis:LossofallACpowercompromisesallplantsafetysystemsrequiringelectricpower.ThisEALisindicatedby:lossofallo6'siteANDonsiteACpowertosafeguardsbuses14/18AND16/17forgreaterthan15minutes.Whenincoldshutdown,refueling,ordefueledmodetheeventcanbeclassifiedasanAlert,becauseofthesigni6cantlyreduceddecayheat,lowertemperatureandpressure,increasingthetimetorestoreoneoftheemergencybusses,relativetothatspeci6edfortheSiteAreaEmergencyEAL.EscalatingtotheSiteAreaEmergency,ifappropriate,isbyAbnormalRadLevels/RadiologicalEfHuent,orEmergencyCoordinatorJudgmentICs.Fifteenminuteswasselectedasathresholdtoexcludetransientormomentarypowerlosses.PEG
 
SU1.1 Basis Reference(s):
: 1. RGE-6 "4160V Electrical Distribution System"
: 2.     RGE-7 "480V Distribution "
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures                6.1    Loss of AC Power Sources 6.1.2  Alert Loss of'all safeguards bus AC power for > 15 min.
NUlKARC IC:
Loss of all offsite power and loss of all onsite AC power to essential busses during cold shutdown, refueling or defueled mode.
FPB loss/potential loss:
N/A Mode Applicability:
Cold Shutdown, Refueling, Defueled Basis:
Loss of all AC power compromises all plant safety systems requiring electric power. This EAL is indicated by: loss of all o6'site AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes. When in cold shutdown, refueling, or defueled mode the event can be classified as an Alert, because of the signi6cantly reduced decay heat, lower temperature and pressure, increasing the time to restore one of the emergency busses, relative to that speci6ed for the Site Area Emergency EAL. Escalating to the Site Area Emergency, ifappropriate, is by Abnormal Rad Levels/Radiological EfHuent, or Emergency Coordinator Judgment ICs. Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.
PEG  


==Reference:==
==Reference:==
SA1.1BasisReference(s):1.RGE-6"4160VElectricalDistributionSystem" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.1.3Alert6.1LossofACPowerSourcesAvailablesafeguardtrainACpowerreducedtoonlyoneofthefollowingfor>15min.:~EDG1A(14/18)~EDG1B(16/17)~StationAuxiliaryTransformer12A~StationAuxiliaryTransformer12B1%JMARCIC:ACpowercapabilitytoessentialbussesreducedtoasinglepowersourceforgreaterthan15minutessuchthatanyadditionalsinglefailurewouldresultinstationblackoutwithreactorcoolant>200'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:TheconditionindicatedbythisEAListhedegradationoftheoffsitepowerwithaconcurrentfailureofoneemergencygeneratortosupplypowertoitsemergencybusses.AnotherrelatedconditioncouldbethelossofalloFsitepowerandlossofonsiteemergencydieselswithonlyonetrainofemergencybussesbeingfedfromtheunitmaingenerator,orthelossofonsiteemergencydieselswithonlyonetrainofemergencybussesbeingfedfromoffsitepower.ThesubsequentlossofthissinglepowersourcewouldescalatetheeventtoaSiteAreaEmergency.PEG
 
SA1.1 Basis Reference(s):
: 1. RGE-6 "4160V Electrical Distribution System"
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures            6.1   Loss of AC Power Sources 6.1.3 Alert Available safeguard train AC power reduced to only one of the following for >
15 min.:
      ~   EDG 1A (14/18)
      ~   EDG 1B (16/17)
      ~   Station Auxiliary Transformer 12A
      ~   Station Auxiliary Transformer 12B 1%JMARC IC:
AC power capability to essential busses reduced to a single power source for greater than 15 minutes such that any additional single failure would result in station blackout with reactor coolant > 200 'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
The condition indicated by this EAL is the degradation of the offsite power with a concurrent failure of one emergency generator to supply power to its emergency busses. Another related condition could be the loss of all oFsite power and loss of onsite emergency diesels with only one train of emergency busses being fed from the unit main generator, or the loss of onsite emergency diesels with only one train of emergency busses being fed from offsite power. The subsequent loss of this single power source would escalate the event to a Site Area Emergency.
PEG  


==Reference:==
==Reference:==


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.RGE-6"4160VElectricalDistribution"2.RGE-7"480vDistribution" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.1LossofACPowerSources6.1.4SiteAreaEmergencyLossofallsafeguardsbusACpowerfor>15min.NUINARCIC:LossofalloffsitepowerandlossofallonsiteACpowertoessentialbusseswithreactorcoolant>200'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:LossofallACpowercompromisesallplantsafetysystemsrequiringelectricpower.ThisEALisindicatedby:lossofalloffsiteANDonsiteACpowertosafeguardsbuses14/18AND16/17forgreaterthan15minutes.ProlongedlossofallACpowerwillcausecoreuncoveryandlossofcontainmentintegrity,thusthiseventcanescalatetoaGeneralEmergency.Thetimedurationshouldbeselectedtoexcludetransientormomentarypowerlosses,butshouldnotexceed15minutes.PEG
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. RGE-6 "4160V Electrical Distribution"
: 2. RGE-7 "480v Distribution"
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures                6.1    Loss of AC Power Sources 6.1.4 Site Area Emergency Loss of all safeguards bus AC power for > 15 min.
NUINARC IC:
Loss of all offsite power and loss of all onsite AC power to essential busses with reactor coolant > 200 'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
Loss of all AC power compromises all plant safety systems requiring electric power. This EAL is indicated by: loss of all offsite AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes. Prolonged loss of all AC power will cause core uncovery and loss of containment integrity, thus this event can escalate to a General Emergency. The time duration should be selected to exclude transient or momentary power losses, but should not exceed 15 minutes.
PEG  


==Reference:==
==Reference:==
SS1.1BasisReference(s):1.RGE-6"4160VElectricalDistribution"2.RGE-7"480vDistribution" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.1.5GeneralEmergency6.1LossofACPowerSourcesLossofallsafeguardsbusACpowerANDeither:Powerrestorationtoanysafeguardsbusisnotlikelyin54hrsORActualorimminententryintoORANGEorREDpathonF-0.2,"CORECOOLING"NUMARCIC:ProlongedlossofalloffsitepowerandprolongedlossofallonsiteACpowerwithreactorcoolant>200'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:LossofallACpowercompromisesallplantsafetysystemsrequiringelectricpower.ProlongedlossofallACpowerwillleadtolossoffuelclad,RCS,andcontainment.AlthoughthisEALmaybeviewedasredundanttotheRPVWaterLevelEALs,itsinclusionisnecessarytobetterassuretimelyrecognitionandemergencyresponse.ThisEALisspecifiedtoassurethatintheunlikelyeventofprolongedstationblackout,timelyrecognitionoftheseriousnessoftheeventoccursandthatdeclarationofaGeneralEmergencyoccursasearlyasisappropriate,basedonareasonableassessmentoftheeventtrajectory.Thelikelihoodofrestoringatleastoneemergencybusshouldbebasedonarealisticappraisalofthesituationsinceadelayinanupgradedecisionbasedononlyachanceofmitigatingtheeventcouldresultinalossofvaluabletimeinpreparingandimplementingpublicprotectiveactions.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Inaddition,undertheseconditions,fissionproductbarriermonitoringcapabilitymaybedegraded.AlthoughitmaybedifBculttopredictwhenpowercanberestored,theEmergencyCoordinatorshoulddeclareaGeneralEmergencybasedontwomajorconsiderations:1.ArethereanypresentindicationsthatcorecoolingisalreadydegradedtothepointthatLossorPotentialLossoffissionproductbarriersisimminent?2.Iftherearenopresentindicationsofsuchcorecoolingdegradation,howlikelyisitthatpowercanberestoredintimetoassurethatalossoftwobarrierswithapotentiallossofthethirdbarriercanbeprevented?Thus,indicationofcontinuingcorecoolingdegradationmustbebasedonfissionproductbarriermonitoringwithparticularemphasisonEmergencyCoordinatorjudgmentasitrelatestoimminentlossorpotentiallossoffissionproductbarriersanddegradedabilitytomonitorfissionproductbarriers.ThetimetorestoreACpowerisbasedonsiteblackoutcopinganalysisperformedinconformancewith10CFR50.63andRegulatoryGuide1.155,"StationBlackout",withappropriateallowanceforoffsiteemergencyresponse.PEG
SS1.1 Basis Reference(s):
: 1. RGE-6 "4160V Electrical Distribution"
: 2. RGE-7 "480v Distribution"
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures              6.1   Loss of AC Power Sources 6.1.5 General Emergency Loss of all safeguards bus AC power AND either:
Power restoration to any safeguards bus is not likely in 5 4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2, "CORE COOLING" NUMARC IC:
Prolonged loss of all offsite power and prolonged loss of all onsite AC power with reactor coolant > 200 'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
Loss of all AC power compromises all plant safety systems requiring electric power. Prolonged loss of all AC power will lead to loss of fuel clad, RCS, and containment. Although this EAL may be viewed as redundant to the RPV Water Level EALs, its inclusion is necessary to better assure timely recognition and emergency response.
This EAL is specified to assure that in the unlikely event of prolonged station blackout, timely recognition of the seriousness of the event occurs and that declaration of a General Emergency occurs as early as is appropriate, based on a reasonable assessment of the event trajectory.
The likelihood of restoring at least one emergency bus should be based on a realistic appraisal of the situation since a delay in an upgrade decision based on only a chance of mitigating the event could result in a loss of valuable time in preparing and implementing public protective actions.
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 In addition, under these conditions, fission product barrier monitoring capability may be degraded. Although it may be difBcult to predict when power can be restored, the Emergency Coordinator should declare a General Emergency based on two major considerations:
: 1. Are there any present indications that core cooling is already degraded to the point that Loss or Potential Loss of fission product barriers is imminent?
: 2. Ifthere are no present indications of such core cooling degradation, how likely is it that power can be restored in time to assure that a loss of two barriers with a potential loss of the third barrier can be prevented?
Thus, indication of continuing core cooling degradation must be based on fission product barrier monitoring with particular emphasis on Emergency Coordinator judgment as it relates to imminent loss or potential loss of fission product barriers and degraded ability to monitor fission product barriers.
The time to restore AC power is based on site blackout coping analysis performed in conformance with 10CFR50.63 and Regulatory Guide 1.155, "Station Blackout", with appropriate allowance for offsite emergency response.
PEG  


==Reference:==
==Reference:==
SG1.1BasisReference(s):1.2.3.4F-0.2,"CORECOOLING,"NRClettertoDr.MecredydatedV30/92"REGinnaNuclearPowerPlantStationBlackoutAnalysis(TACM68548)RGE-6"4160vElectricalDistributionSystem"RGE-7"480vDistribution" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.2.1UnusualEvent6.2LossofDCPowerSources<105vdcbusvoltageindicationson125vdcbatteries1Aand1Bfor>15min.MMARCIC:UnplannedlossofrequiredDCpowerduringcoldshutdownorrefuelingmodeforgreaterthan15minutes.FPBloss/potentialloss:N/AModeApplicability:ColdShutdown,RefuelingBasis:ThepurposeofthisEAListorecognizealossofDCpowercompromisingtheabilitytomonitorandcontroltheremovalofdecayheatduringcoldshutdownorrefuelingoperations.ThisEALisintendedtobeanticipatoryinasmuchastheoperatingcrewmaynothavenecessaryindicationandcontrolofequipmentneededtorespondtotheloss.Thebusvoltageisbasedontheminimumbusvoltagenecessaryfortheoperationofsafetyrelatedequipment.Thisvoltagevalueincorporatesamarginofatleast15minutesofoperationbeforetheonsetofinabilitytooperateloads.PEG
 
SG1.1 Basis Reference(s):
: 1.       F-0.2, "CORE COOLING,"
: 2.       NRC letter to Dr. Mecredy dated V30/92 "RE Ginna Nuclear Power Plant Station Blackout Analysis (TAC M68548)
: 3.      RGE-6 "4160v Electrical Distribution System" 4        RGE-7 "480v Distribution"
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures              6.2   Loss of DC Power Sources 6.2.1 Unusual Event
< 105  vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.
MMARC IC:
Unplanned loss of required DC power during cold shutdown or refueling mode for greater than 15 minutes.
FPB loss/potential loss:
N/A Mode Applicability:
Cold Shutdown, Refueling Basis:
The purpose of this EAL is to recognize a loss of DC power compromising the ability to monitor and control the removal of decay heat during cold shutdown or refueling operations. This EAL is intended to be anticipatory in as much as the operating crew may not have necessary indication and control of equipment needed to respond to the loss.
The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment. This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.
PEG  


==Reference:==
==Reference:==
SU7.1BasisReference(s):1.RGE-9"InstrumentBusandDCPowerSystem" OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev16.0ElectricalFailures6.2.2SiteAreaEmergency6.2LossofDCPowerSources>105vdcbusvoltageindicationson125vdcbatteries1Aand1B.for>15min.NUINARCIC:LossofallvitalDCpowerwithreactorcoolant>200'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:LossofallDCpowercompromisesabilitytomonitorandcontrolplantsafetyfunctions.ProlongedlossofallDCpowerwillcausecoreuncoveringandlossofcontainmentintegritywhenthereissignificantdecayheatandsensibleheatinthereactorsystem.EscalationtoaGeneralEmergencywouldoccurbyotherEALcategories.Fifteenminuteswasselectedasathresholdtoexcludetransientormomentarypowerlosses.Thebusvoltageisbasedontheminimumbusvoltagenecessaryfortheoperationofsafetyrelatedequipment.Thisvoltagevalueincorporatesamarginofatleast15minutesofoperationbeforetheonsetofinabilitytooperateloads.PEG
 
SU7.1 Basis Reference(s):
: 1. RGE-9 "Instrument Bus and DC Power System"
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 6.0    Electrical Failures              6.2   Loss of DC Power Sources 6.2.2 Site Area Emergency
  > 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B
. for > 15 min.
NUINARC IC:
Loss of all vital DC power  with reactor coolant > 200 'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
Loss of all DC power compromises ability to monitor and control plant safety functions. Prolonged loss of all DC power will cause core uncovering and loss of containment integrity when there is significant decay heat and sensible heat in the reactor system. Escalation to a General Emergency would occur by other EAL categories. Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.
The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment. This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.
PEG  


==Reference:==
==Reference:==
SS3.1BasisReference(s):1.RGE-9"InstrumentBusandDCPowerSystem"6-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Numerousplantsystemrelatedequipmentfailureeventswhichwarrantemergencyclassification,basedupontheirpotentialtoposeactualorpotentialthreatstoplantsafety,havebeenidentifiedinthiscategory.Theeventsofthiscategoryhavebeengroupedintothefollowingeventtypes:T'OnlyoneEALfallsunderthiseventtyperelatedtothefailureoftheplanttobebroughttotherequiredplantoperatingconditionrequiredbytechnicalspecifications.milrrnr1mvinThiscategoryincludeseventswhichareindicativeoflossesofoperabilityofsafetysystemssuchasECCS,isolationfunctions,ControlRoomhabitabilityorcoldandhotshutdowncapabilities.fn'nA1n''liCertaineventswhichdegradetheplantoperatorsabilitytoeffectivelyassessplantconditionsorcommunicatewithessentialpersonnelwithinorexternaltotheplantwarrantemergencyclassification.Underthiseventtypearelossesofannunciatorsand/orcommunicationequipment.7-1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.1TechnicalSpeci6cationRequirements7.1.1Unusual'EventPlantisnotbroughttorequiredoperatingmodewithinTechnicalSpecificationsLCOActionStatementTime.1%UAIARCIC:InabilitytoreachrequiredshutdownwithinTechnicalSpecificationLimits.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:LimitingConditionsofOperation(LCOs)requiretheplanttobebroughttoarequiredshutdownmodewhentheTechnicalSpecificationrequiredconfigurationcannotberestored.Dependingonthecircumstances,thismayormaynotbeanemergencyorprecursortoamoreseverecondition.Inanycase,theinitiationofplantshutdownrequiredbythesiteTechnicalSpecificationrequiresaonehourreportunder10CFR50.72(b)non-emergencyevents.TheplantiswithinitssafetyenvelopewhenbeingshutdownwithintheallowableactionstatementtimeintheTechnicalSpecifications.AnimmediateNotificationofanUnusualEventisrequiredwhentheplantisnotbroughttotherequiredoperatingmodewithintheallowableactionstatementtimeintheTechnicalSpecifications.DeclarationofanUnusualEventisbasedonthetimeatwhichtheLCO-specifiedactionstatementtimeperiodelapsesunderthesiteTechnicalSpecificationsandisnotrelatedtohowlongaconditionmayhaveexisted.OtherrequiredTechnicalSpecificationshutdownsthatinvolveprecursorstomoreseriouseventsareaddressedbyotherEALs.7-2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
 
SS3.1 Basis Reference(s):
: 1. RGE-9 "Instrument Bus and DC Power System" 6-10
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 Numerous plant system related equipment failure events which warrant emergency classification, based upon their potential to pose actual or potential threats to plant safety, have been identified in this category.
The events of this category have been grouped into the following event types:
T                           Only one EAL falls under this event type related to the failure of the plant to be brought to the required plant operating condition required by technical specifications.
m il r        r nr1        m v        i n This category includes events which are indicative of losses of operability of safety systems such as ECCS, isolation functions, Control Room habitability or cold and hot shutdown capabilities.
fn'nA1                            n'             'li Certain events which degrade the plant operators ability to effectively    assess plant conditions or communicate with essential personnel within or external to the plant warrant emergency classification. Under this event type are losses of annunciators and/or communication equipment.
7-1
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures          7.1  Technical Speci6cation Requirements 7.1.1 Unusual'Event Plant is not brought to required operating mode within Technical Specifications LCO Action Statement Time.
1%UAIARC IC:
Inability to reach required shutdown within Technical Specification Limits.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
Limiting Conditions of Operation (LCOs) require the plant to be brought to a required shutdown mode when the Technical Specification required configuration cannot be restored. Depending on the circumstances, this may or may not be an emergency or precursor to a more severe condition. In any case, the initiation of plant shutdown required by the site Technical Specification requires a one hour report under 10CFR50.72 (b) non-emergency events. The plant is within its safety envelope when being shut down within the allowable action statement time in the Technical Specifications. An immediate Notification of an Unusual Event is required when the plant is not brought to the required operating mode within the allowable action statement time in the Technical Specifications. Declaration of an Unusual Event is based on the time at which the LCO-specified action statement time period elapses under the site Technical Specifications and is not related to how long a condition may have existed. Other required Technical Specification shutdowns that involve precursors to more serious events are addressed by other EALs.
7-2
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
SU2.1BasisReference(s):1.TechnicalSpecificationsSection3.07-3 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.2SystemFailuresorControlRoomEvacuation7.2.1UnusualEventReportofmainturbinefailureresultingincasingpenetrationordamagetoturbinesealsorgeneratorseals.NUMARCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/AModeApplicability:PowerOperation,hotshutdownBasis:ThisEALisintendedtoaddressmainturbinerotatingcomponentfailuresofsuf6cientmagnitudetocauseobservabledamagetotheturbinecasingortothesealsoftheturbinegenerator.Ofmajorconcernisthepotentialforleakageofcombustiblefluids(lubricatingoils)andgases(hydrogencooling)totheplantenvirons.ActualfiresandflammablegasbuildupareappropriatelyclassifiedthroughotherEALs.ThisEALisconsistentwiththedefinitionofanUnusualEventwhilemaintainingtheanticipatorynaturedesiredandrecognizingtherisktonon-safetyrelatedequipment.PEG
 
SU2.1 Basis Reference(s):
: 1. Technical Specifications Section 3.0 7-3
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures        7.2  System Failures or Control Room Evacuation 7.2.1  Unusual Event Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.
NUMARC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Power Operation, hot shutdown Basis:
This EAL is intended to address main turbine rotating component failures of suf6cient magnitude to cause observable damage to the turbine casing or to the seals of the turbine generator. Of major concern is the potential for leakage of combustible fluids (lubricating oils) and gases (hydrogen cooling) to the plant environs. Actual fires and flammable gas build up are appropriately classified through other EALs. This EAL is consistent with the definition of an Unusual Event while maintaining the anticipatory nature desired and recognizing the risk to non-safety related equipment.
PEG  


==Reference:==
==Reference:==
HU1.6BasisReference(s):None7-4 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.2SystemFailuresorControlRoomEvacuation7.2.2AlertTurbinefailuregeneratedmissilesresultinanyvisiblestructuraldamagetoplantvitalequipmentNUINARCIC:Naturalanddestructivephenomenaaffectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:PowerOperations,HotShutdownBasis:ThisEALaddressesthethreattosafetyrelatedequipmentimposedbymissilesgeneratedbymainturbinerotatingcomponentfailures.Theinvolvedequipmentincludessafety-relatedequipment,theircontrols,andtheirpowersupplies.ThisEALisconsistentwiththedefinitionofanALERTinthat,ifmissileshavedamagedorpenetratedareascontainingsafety-relatedequipment,thepotentialexistsforsubstantialdegradationofthelevelofsafetyoftheplant.PEG
 
HU1.6 Basis Reference(s):
None 7-4
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures      7.2    System Failures or Control Room Evacuation 7.2.2 Alert Turbine failure generated missiles result in any visible structural damage to plant vital equipment NUINARC IC:
Natural and destructive phenomena affecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Power Operations, Hot Shutdown Basis:
This EAL addresses the threat to safety related equipment imposed by missiles generated by main turbine rotating component failures. The involved equipment includes safety-related equipment, their controls, and their power supplies. This EAL is consistent with the definition of an ALERT in that, ifmissiles have damaged or penetrated areas containing safety-related equipment, the potential exists for substantial degradation of the level of safety of the plant.
PEG  


==Reference:==
==Reference:==
HA1.6BasisReference(s):None7-5 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.2SystemFailuresorControlRoomEvacuation7.2.3AlertEntryintoAP-CR.1"ControlRoomInaccessability"MMARCIC:Controlroomevacuationhasbeeninitiated.FPBloss/potentialloss:N/AModeApplicability:AllBasis:WiththeControlRoomevacuated,additionalsupport,monitoringanddirectionthroughtheTechnicalSupportCenterand/orotheremergencyoperationscenterisnecessary.InabilitytoestablishplantcontrolfromoutsidetheControlRoomwillescalatethiseventtoaSiteAreaEmergency.PEG
 
HA1.6 Basis Reference(s):
None 7-5
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures        7.2    System Failures or Control Room Evacuation 7.2.3 Alert Entry into AP-CR.1 "Control Room Inaccessability" MMARC IC:
Control room evacuation has been initiated.
FPB loss/potential loss:
N/A Mode Applicability:
All Basis:
With the Control Room evacuated, additional support, monitoring and direction through the Technical Support Center and/or other emergency operations center is necessary. Inability to establish plant control from outside the Control Room will escalate this event to a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
HA5.1BasisReference(s):1.AP-CR.1ControlRoomInaccessibility7-6 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures17.2SystemFailuresorControlRoomEvacuation7.2.4AlertReactorcoolanttemperaturecannotbemaintained<200'FNUINARCIC:Inabilitytomaintainplantincoldshutdown.FPBloss/potentialloss:N/AModeApplicability:ColdShutdown,RefuelingBasis:hThisEALaddressescompletelossoffunctionsrequiredforcorecoolingduringrefuelingandcoldshutdownmodes.EscalationtoSiteAreaEmergencyorGeneralEmergencywouldbethroughotherEALs.AreactorcoolanttemperatureincreasethatapproachesorexceedsthecoldshutdowntechnicalspecificationlimitwarrantsdeclarationofanAlertirrespectiveoftheavailabilityoftechnicalspecificationrequiredfunctionstomaintaincoldshutdown.TheconcernofthisEAListhelossofabilitytomaintaintheplantincoldshutdownwhichisdefinedbyreactorcoolanttemperatureandnottheoperabilityofequipmentwhichsupportsremovalofheatfromthereactor.PEG
 
HA5.1 Basis Reference(s):
: 1. AP-CR.1 Control Room Inaccessibility 7-6
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures          7.2    System Failures or Control Room 1                    Evacuation 7.2.4 Alert Reactor coolant temperature cannot be maintained < 200         'F NUINARC IC:
Inability to maintain plant in cold shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
Cold Shutdown, Refueling Basis:
h This EAL addresses complete loss of functions required for core cooling during refueling and cold shutdown modes. Escalation to Site Area Emergency or General Emergency would be through other EALs.
A reactor coolant temperature increase that approaches or exceeds the cold shutdown technical specification limit warrants declaration of an Alert irrespective of the availability of technical specification required functions to maintain cold shutdown. The concern of this EAL is the loss of ability to maintain the plant in cold shutdown which is defined by reactor coolant temperature and not the operability of equipment which supports removal of heat from the reactor.
PEG  


==Reference:==
==Reference:==
SA3.17-7 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.AP-RHR.1"LossofRHR"2.TechnicalSpecificationsSection1.23,AP-RHR-2"LossofRHRWhileOperatingatReducedRCSInventoryConditions"7-8 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1'7.0EquipmentFailures7.2SystemFailuresorControlRoomEvacuation7.2.5SiteAreaEmergencyControlRoomevacuationANDCorecoolingcannotbeestablishedperAP-CR.1"ControlRoomInaccessibility"in~20min.MJMARCIC:Controlroomevacuationhasbeeninitiatedandcontrolofcorecoolingcannotbeestablished.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALindicatesthatexpeditioustransferofsafetysystemshasnotoccurredbutfissionproductbarrierdamagemaynotyetbeindicated.Thetimeintervalfortransferisbasedonanalysisorassessmentsastohowquicklycontrolmustbereestablishedwithoutcoreuncoveringand/orcoredamage.Thedesigncriteriafortheremoteshutdownequipmentspecifiesthatcontrolofsafetysystemsmustbeabletobeachievedwithoutresultingincoreuncoveryorcoredamage.REGNPSAppendixRsubmittalindicates20minutesisthemaximumtimeforwhichcontrolofplantsafetysystemsshouldoccurunderworstcaseconditions.Therefore,20minutesiswithinthedesigncriteriaoftheremoteshutdownequipment.Incoldshutdownandrefuelingmodes,operatorconcernisdirectedtowardmaintainingcorecoolingsuchasisdiscussedinGenericLetter88-17,"LossofDecayHeatRemoval."Inpoweroperation,andhotshutdownmodes,operatorconcernisprimarilydirectedtowardmaintainingcriticalsafetyfunctionsandtherebyassuringfissionproductbarrie'rintegrity.7-9 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
 
SA3.1 7-7
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. AP-RHR.1 "Loss of RHR"
: 2. Technical Specifications Section 1.2 3,     AP-RHR-2 "Loss of RHR While Operating at Reduced RCS Inventory Conditions" 7-8
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1
'7.0    Equipment Failures        7.2  System Failures or Control Room Evacuation 7.2.5 Site Area Emergency Control Room evacuation AND Core cooling cannot be established per AP-CR.1 "Control Room Inaccessibility" in ~ 20 min.
MJMARC IC:
Control room evacuation has been initiated and control of core cooling cannot be established.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL indicates that expeditious transfer of safety systems has not occurred but fission product barrier damage may not yet be indicated. The time interval for transfer is based on analysis or assessments as to how quickly control must be reestablished without core uncovering and/or core damage.
The design criteria for the remote shutdown equipment specifies that control of safety systems must be able to be achieved without resulting in core uncovery or core damage. REGNPS Appendix R submittal indicates 20 minutes is the maximum time for which control of plant safety systems should occur under worst case conditions. Therefore, 20 minutes is within the design criteria of the remote shutdown equipment.
In cold shutdown and refueling modes, operator concern is directed toward maintaining core cooling such as is discussed in Generic Letter 88-17, "Loss of Decay Heat Removal." In power operation, and hot shutdown modes, operator concern is primarily directed toward maintaining critical safety functions and thereby assuring fission product barrie'r integrity.
7-9
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
HS2.1BasisReference(s):1.AP-CR.1ControlRoomInaccessibility2.AppendixRSection6.4.5page6-353.GenericLetter88-17,"LossofDecayHeatRemoval."7-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.3LossofIndications/Alarms/CommunicationCapability7.3.1UnusualEventUnplannedlossofannunciatorsorindicationsonanyControlRoomPanels,Table7.3for>15min.ANDIncreasedsurveillanceisrequiredforsafeplantoperationTable7.3VitalControlRoomPanelsAAABCDEF0NUINARCIC:Unplannedlossofmostorallsafetysystemannunciationorindicationinthecontrolroomforgreaterthan15minuteswithreactorcoolanttemperature>2OO'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:ThisEALrecognizesthedifhcultyassociatedwithmonitoringchangingplantconditionswithouttheuseofamajorportionoftheannunciationorindicationequipment.Recognitionoftheavailabilityofcomputerbasedindicationequipmentisconsidered(PPCSandSAS)."Unplanned"lossofannunciatorsorindicatorsexcludesscheduledmaintenanceandtestingactivities.ItisnotintendedthatplantpersonnelperformadetailedcountoftheinstrumentationlostbuttheuseofjudgmentbytheShiftSupervisorasthethresholdfordeterminingtheseverityoftheplantconditions.Thisjudgment7-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1issupportedbythespecificopinionoftheShikSupervisorthatadditionaloperatingpersonnelwillberequiredtoprovideincreasedmonitoringofsystemoperationto,safelyoperatetheplant.Itisfurtherrecognizedthatmostplantdesignsprovideredundantsafetysystemindicationpoweredfromseparateuninterruptablepowersupplies.Whilefailureofalargeportionofannunciatorsismorelikelythanafailureofalargeportionofindications,theconcernisincludedinthisEALduetodifficultyassociatedwithassessmentofplantconditions.Thelossofspecific,orseveral,safetysystemindicatorsshouldremainafunctionofthatspecificsystemorcomponentoperabilitystatus.ThiswillbeaddressedbytheirspecificTechnicalSpecification.TheinitiationofaTechnicalSpecificationimposedplantshutdownrelatedtotheinstrumentlosswillbereportedvia10CFR50.72.IftheshutdownisnotincompliancewiththeTechnicalSpecificationaction,theUnusualEventisbasedonEAL7.1.1,InabilitytoReachRequiredShutdownWithinTechnicalSpecificationLimits.AnnunciatorsorindicatorsforthisEALmustincludethoseidentifiedintheAbnormalOperatingprocedures,intheEmergencyOperatingProcedures,andinotherEALs(e.g.,area,process,and/oreffluentradmonitors,etc.).Fifteenminuteswasselectedasathresholdtoexcludetransientormomentarypowerlosses.Duetothelimitednumberofsafetysystemsinoperationduringcoldshutdown,refueling,anddefueledmodes,thisEALisnotapplicableduringthesemodesofoperation.ThisUnusualEventwillbeescalatedtoanAlertifatransientisinprogressduringthelossofannunciationorindication.PEG
 
HS2.1 Basis Reference(s):
: 1. AP-CR.1 Control Room Inaccessibility
: 2. Appendix R Section 6.4.5 page 6-35
: 3. Generic Letter 88-17, "Loss of Decay Heat Removal."
7-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 7.0      Equipment Failures        7.3    Loss  of Indications /Alarms /
Communication Capability 7.3.1    Unusual Event Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for > 15 min.
AND Increased surveillance is required for safe plant operation Table 7.3      Vital Control Room Panels A    AA      B      C      D      E      F      0 NUINARC IC:
Unplanned loss of most or all safety system annunciation or indication in the control room for greater than 15 minutes with reactor coolant temperature >
2OO   'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
This EAL recognizes the difhculty associated with monitoring changing plant conditions without the use of a major portion of the annunciation or indication equipment. Recognition of the availability of computer based indication equipment is considered (PPCS and SAS).
"Unplanned" loss of annunciators or indicators excludes scheduled maintenance and testing activities.
It is not intended that plant personnel  perform a detailed count of the instrumentation lost but the use ofjudgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions. This judgment 7-11
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 is supported by the specific opinion of the Shik Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to, safely operate the plant.
It is further recognized that most plant designs  provide redundant safety system indication powered from separate uninterruptable power supplies.
While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is included in this EAL due to difficultyassociated with assessment of plant conditions. The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status. This willbe addressed by their specific Technical Specification. The initiation of a Technical Specification imposed plant shutdown related to the instrument loss willbe reported via 10CFR50.72. Ifthe shutdown is not in compliance with the Technical Specification action, the Unusual Event is based on EAL 7.1.1, Inability to Reach Required Shutdown Within Technical Specification Limits.
Annunciators or indicators for this EAL must include those identified in the Abnormal Operating procedures, in the Emergency Operating Procedures, and in other EALs (e. g., area, process, and/or effluent rad monitors, etc.).
Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.
Due to the limited number of safety systems in operation during cold shutdown, refueling, and defueled modes, this EAL is not applicable during these modes of operation.
This Unusual Event willbe escalated to an Alert ifa transient is in progress during the loss of annunciation or indication.
PEG  


==Reference:==
==Reference:==
SU3.1BasisReference(s):None7-12 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.3LossofIndications/Alarms/CommunicationCapability7.3.2UnusualEventLossofallcommunicationscapabilityaffectingtheabilitytoeither:PerformroutineoperationsORNotifyoffsiteagenciesorpersonnelNUMARCIC:Unplannedlossofallonsiteoroffsitecommunicationscapabilities.FPBloss/potentialloss:~N/AModeApplicability:Basis:ThepurposeofthisEAListorecognizealossofcommunicationscapabilitythateitherdefeatstheplantoperationsstaffabilitytoperformroutinetasksnecessaryforplantope'rationsortheabilitytocommunicateproblemswithoffsiteauthorities.Thelossofoffsitecommunicationsabilityisexpectedtobesignificantlymorecomprehensivethantheconditionaddressedby10CFR50.72.Theonsitecommunicationslossmustencompassthelossofallmeansofroutinecommunications(i.e.,phones,soundpoweredphonesystems,pagepartysystem,and'radios/walkietalkies).Theoffsitecommunicationslossmustencompassthelossofallmeansofcommunicationswithoffsiteauthorities.ThisshouldincludeENS,Belllines,FAXtransmissions,anddedicatedphonesystems.ThisEALisintendedtobeusedonlywhenextraordinarymeansarebeingutilizedtomakecommunicationspossible(relayingofinformationfromradiotransmissions,individualsbeingsenttooffsitelocations,etc.).7-13 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1.PEG
 
SU3.1 Basis Reference(s):
None 7-12
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures        7.3    Loss  of Indications /Alarms /
Communication Capability 7.3.2 Unusual Event Loss of all communications capability affecting the ability to either:
Perform routine operations OR Notify offsite agencies or personnel NUMARC IC:
Unplanned loss of all onsite or offsite communications capabilities.
FPB loss/potential loss:
~
N/A Mode Applicability:
Basis:
The purpose of this EAL is to recognize a loss of communications capability that either defeats the plant operations staff ability to perform routine tasks necessary for plant ope'rations or the ability to communicate problems with offsite authorities. The loss of offsite communications ability is expected to be significantly more comprehensive than the condition addressed by 10CFR50.72.
The onsite communications loss must encompass the loss of all means of routine communications (i. e., phones, sound powered phone systems, page party system, and'radios/walkie talkies).
The offsite communications loss must encompass the loss of all means of communications with offsite authorities. This should include ENS, Bell lines, FAX transmissions, and dedicated phone systems. This EAL is intended to be used only when extraordinary means are being utilized to make communications possible (relaying of information from radio transmissions, individuals being sent to offsite locations, etc.).
7-13
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1
.PEG  


==Reference:==
==Reference:==
SU6.1BasisReference(s):1.A-56,"CommunicationSystemsatGinnaStation"7-14 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.3LossofIndications/Alarms/CommunicationCapability7.3.3AlertUnplannedlossofannunciatorsorindicationsonanyControlRoomPanels,.Table7.3for>15min.ANDIncreasedsurveillanceisrequiredforsafeplantoperationANDeither:AplanttransientinprogressORPPCSandSASareunavailableTable7.3VitalControlRoomPanelsAABCDEFGNUMARCIC:Unplannedlossofmostorallsafetysystemannunciationorindicationincontrolroomwitheither(1)asignificanttransientinprogress,or(2)compensatorynon-alarmingindicatorsareunavailablewithreactorcoolant>200'F.FPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:ThisEALrecognizesthedifBcultyassociatedwithmonitoringchangingplant'onditionswithouttheuseofamajorportionoftheannunciationorindicationequipmentduringatransient.Recognitionoftheavailabilityofcomputerbasedindicationequipmentisconsidered(PPCS,SAS,etc.)."Unplanned"lossofannunciatorsorindicatorsdoesnotincludescheduledmaintenanceandtestingactivities.7-15 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1ItisnotintendedthatplantpersonnelperformadetailedcountoftheinstrumentationlostbuttheuseofjudgmentbytheShiftSupervisorasthethresholdfordeterminingtheseverityoftheplantconditions.ThisjudgmentissupportedbythespecificopinionoftheShiftSupervisorthatadditionaloperatingpersonnelwillberequiredtoprovideincreasedmonitoringofsystemoperationtosafelyoperatetheplant.Itisfurtherrecognizedthatmostplantdesignsprovideredundantsafetysystemindicationpoweredfromseparateuninterruptablepowersupplies.Whilefailureofalargeportionofannunciatorsismorelikelythanafailureofalargeportionofindications,theconcernisUicludedinthisEALduetodifFicultyassociatedwithassessmentofplantconditions.Thelossofspecific,orseveral,safetysystemindicatorsshouldremainafunctionofthatspecificsystemorcomponentoperabilitystatus,ThiswillbeaddressedbythespecificTechnicalSpecification.TheinitiationofaTechnicalSpecificationimposedplantshutdownrelatedtotheinstrumentlosswillbereportedvia10CFR50.72.AnnunciatorsorindicatorsforthisEALincludesthoseidentifiedintheAbnormalOperatingProcedures,intheEmergencyOperatingProcedures,andinotherEALs(e.g.,area,process,and/oreffluentradmonitors,etc.)."Significanttransient"includesresponsetoautomaticormanuallyinitiatedfunctionssuchastrips,runbacksinvolvinggreaterthan25%thermalpowerchange,ECCSinjections,orthermalpoweroscillationsof10%orgreater.Ifbothamajorportionoftheannunciationsystemandallcomputermonitoringareunavailabletotheextentthattheadditionaloperatingpersonnelarerequiredtomonitorindications,theAlertisrequired.Duetothelimitednumberofsafetysystemsinoperationduringcoldshutdown,refuelinganddefueledmodes,noEALisindicatedduringthesemodesofoperation.ThisAlertwillbeescalatedtoaSiteAreaEmergencyiftheoperatingcrewcannotmonitorthetransientinprogress,PEG
 
SU6.1 Basis Reference(s):
: 1. A-56, "Communication Systems at Ginna Station" 7-14
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 7.0      Equipment Failures        7.3    Loss  of Indications /Alarms /
Communication Capability 7.3.3 Alert Unplanned loss of annunciators or indications on any Control Room Panels,
. Table 7.3 for > 15 min.
AND Increased surveillance is required for safe plant operation AND either:
A plant transient in progress OR PPCS and SAS are unavailable Table 7.3      Vital Control Room Panels AA    B      C      D    E      F      G NUMARC IC:
Unplanned loss of most or all safety system annunciation or indication in control room with either (1) a significant transient in progress, or (2) compensatory non-alarming indicators are unavailable with reactor coolant >
200   'F.
FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
This EAL recognizes the difBculty associated with monitoring changing plant
'onditions without the      use of a major portion of the annunciation or indication equipment during a transient. Recognition of the availability of computer based indication equipment is considered (PPCS, SAS, etc.).
  "Unplanned" loss of annunciators or indicators does not include scheduled maintenance and testing activities.
7-15
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use ofjudgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions. This judgment is supported by the specific opinion of the Shift Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to safely operate the plant.
It is further recognized that most plant designs  provide redundant safety system indication powered from separate uninterruptable power supplies.
While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is Uicluded in this EAL due to difFiculty associated with assessment of plant conditions. The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status, This willbe addressed by the specific Technical Specification. The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.
Annunciators or indicators for this EAL includes those identified in the Abnormal Operating Procedures, in the Emergency Operating Procedures, and in other EALs (e. g., area, process, and/or effluent rad monitors, etc.).
"Significant transient" includes response to automatic or manually initiated functions such as trips, runbacks involving greater than 25% thermal power change, ECCS injections, or thermal power oscillations of 10% or greater.
Ifboth a major portion of the annunciation system and all computer monitoring are unavailable to the extent that the additional operating personnel are required to monitor indications, the Alert is required.
Due to the limited number of safety systems in operation during cold shutdown, refueling and defueled modes, no EAL is indicated during these modes of operation.
This Alert will be escalated to a Site Area Emergency    ifthe operating  crew cannot monitor the transient in progress, PEG  


==Reference:==
==Reference:==
SA4.1BasisReference(s):None7-16 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev17.0EquipmentFailures7.3LossofIndications/Alarms/CommunicationCapability7.3.4SiteAreaEmergencyLossofannunciatorsorindicationsonanyControlRoomPanels,Table7.3ANDCompletelossofabilitytomonitorallcriticalsafetyfunctionstatusANDAplanttransientinprogressTable7.3VitalControlRoomPanelsAAABCDE'GNUIKARCIC:Inabilitytomonitorasignificanttransientinprogresswithreactorcoolant>200DFFPBloss/potentialloss:N/AModeApplicability:Poweroperation,hotshutdownBasis:ThisEALrecognizestheinabilityoftheControlRoomstafftomonitortheplantresponsetoatransient.ASiteAreaEmergencyisconsideredtoexistiftheControlRoomstaffcannotmonitorsafetyfunctionsneededforprotectionofthepublic.AnnunciatorsforthisEALshouldbelimitedtoincludethoseidentifiedintheAbnormalOperatingProcedures,intheCSFST'sandEmergencyOperatingProcedures,andinotherEALs(e.g.,rad"monitors,etc.)."Significanttransient"includesresponsetoautomaticormanuallyinitiatedfunctionssuchasscrams,runbacksinvolvinggreaterthan25lothermal7-17 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1powerchange,ECCSinjections,orthermalpoweroscillationsof10%orgreater.Indicationsneededtomonitorcriticalsafetyfunctionsnecessaryfor'rotectionofthepublicmustincludeControlRoomindications,computergeneratedindicationsanddedicatedannunciationcapability.Thespecificindicationsshouldbethoseusedtodeterminesuchfunctionsastheabilitytoshutdownthereactor,maintainthecorecooledandinaeoolablegeometry,toremoveheatfromthecore,tomaintainthereactorcoolantsystemintact,andtomaintaincontainmentintact."Planned"actionsareexcludedfromtheEALsincethelossofinstrumentationofthismagnitudeisofsuchsignificanceduringatransientthatthecauseofthelossisnotanamelioratingfactor.PEG
 
SA4.1 Basis Reference(s):
None 7-16
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 7.0    Equipment Failures          7.3    Loss  of Indications /Alarms /
Communication Capability 7.3.4 Site Area Emergency Loss of annunciators or indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Table 7.3      Vital Control Room Panels A    AA      B      C      D    E'             G NUIKARC IC:
Inability to monitor a significant transient in progress with reactor coolant >
200 DF FPB loss/potential loss:
N/A Mode Applicability:
Power operation, hot shutdown Basis:
This EAL recognizes the inability of the Control Room staff to monitor the plant response to a transient. A Site Area Emergency is considered to exist if the Control Room staff cannot monitor safety functions needed for protection of the public.
Annunciators for this EAL should be limited to include those identified in the Abnormal Operating Procedures, in the CSFST's and Emergency Operating Procedures, and in other EALs (e. g., rad "monitors, etc.).
"Significant transient" includes response to automatic or manually initiated functions such as scrams, runbacks involving greater than 25 lo thermal 7-17
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev  1 power change, ECCS injections, or thermal power oscillations of 10% or greater.
Indications needed to monitor critical safety functions necessary for of the public must include Control Room indications, computer  'rotection generated indications and dedicated annunciation capability. The specific indications should be those used to determine such functions as the ability to shut down the reactor, maintain the core cooled and in a eoolable geometry, to remove heat from the core, to maintain the reactor coolant system intact, and to maintain containment intact.
"Planned" actions are excluded from the EAL since the loss of instrumentation of this magnitude is of such significance during a transient that the cause of the loss is not an ameliorating factor.
PEG  


==Reference:==
==Reference:==
SS6.1BasisReference(s):None7-18 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Hazardsarethosenon-plantsystemrelatedeventswhichcandirectlyorindirectlyimpactplantoperationorreactorplantandpersonnelsafety.Theeventsofthiscategoryhavebeengroupedintothefollowingtypes:PMtgpldt*dtptpintotheProtectedAreaaswellasbombthreatsandsabotageattempts.Alsoaddressedareactualsecuritycompromisesthreateninglossofphysicalcontroloftheplant.Plplglltt*dtpldreactorsafety.AppropriateforclassificationarefireswithinthesiteProtectedAreaorwhichmayaffectoperabilityofvitalequipment.EM-dttg-tMloccurringeventswhichcancausedamagetoplantfacilitiessuchasaircraftcrashes,missileimpacts,toxicorflammablegasleaksorexplosionsfromwhateversource.Ett',tqddwhichhavepotentialtocausedamagetoplantstructuresorequipmentsignificantenoughtothreatenpersonnelorplantsafety.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.1.1UnusualEvent8.1SecurityThreatsBombdeviceorotherindicationofattemptedsabotagediscoveredwithinplantProtectedArea.ORAnysecurityeventwhichrepresentsapotentialdegradationinthelevelofsafetyoftheplant.MMARCIC:Confirmedsecurityeventwhichindicatesapotentialdegradationinthelevelofsafetyoftheplant.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALisbasedontheREGNPSSecurityContingencyPlan.Securityeventswhichdonotrepresentatleastapotentialdegradationinthelevelofsafetyoftheplant,arereportedunder10CFR73.71orinsomecasesunder10CFR50.72,TheplantProtectedAreaboundaryiswithinthesecurityisolationzoneandisdefinedinthesecurityplan.BombdevicesdiscoveredwithintheplantvitalareawouldresultinEALescalation.PEG
SS6.1 Basis Reference(s):
None 7-18
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Hazards are those non-plant system related events which can directly or indirectly impact plant operation or reactor plant and personnel safety.
The events of this category have been grouped into the following types:
PM      tgp ld                t    *d tp t p into the Protected Area as well as bomb threats and sabotage attempts.
Also addressed are actual security compromises threatening loss of physical control of the plant.
Pl        p    lg ll    tt*   d t p          l reactor safety. Appropriate for classification are fires within the site d
Protected Area or which may affect operability of vital equipment.
E        M - d          t      tg        -   t Ml occurring events which can cause damage to plant facilities such as explosions from whatever source.
E            t t      ',
aircraft crashes, missile impacts, toxic or flammable gas leaks or tqd which have potential to cause damage to plant structures or equipment significant enough to threaten personnel or plant safety.
d
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                        8.1   Security Threats 8.1.1 Unusual Event Bomb device or other indication of attempted sabotage discovered within plant Protected Area.
OR Any security event which represents a potential degradation in the level of safety of the plant.
MMARC IC:
Confirmed security event which indicates a potential degradation in the level of safety of the plant.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL is based on the REGNPS Security Contingency Plan. Security events which do not represent at least a potential degradation in the level of safety of the plant, are reported under 10CFR73.71 or in some cases under 10CFR50.72, The plant Protected Area boundary is within the security isolation zone and is defined in the security plan. Bomb devices discovered within the plant vital area would result in EAL escalation.
PEG  


==Reference:==
==Reference:==
HU4.1HU4.2BasisReference(s):1.REGNPSSecurityContingencyPlan OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.1.2Alert8.1SecurityThreatsIntrusionintoplantProtectedAreabyanadversary.ORAnysecurityeventwhichrepresentsanactualsubstantialdegradationofthelevelofsafetyoftheplant.MMARCIC:Securityeventinaplantprotectedarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisclassofsecurityeventsrepresentsanescalatedthreattoplantsafetyabovethatcontainedintheUnusualEvent,ForthepurposesofthisEAL,theintrusionbyunauth'orizedpersonnelinsidetheProtectedAreaboundarycanbeconsideredasignificantsecuritythreat.IntrusionintoavitalareabyunauthorizedpersonnelwillescalatethiseventtoaSiteAreaEmergency.PEG
 
HU4.1 HU4.2 Basis Reference(s):
: 1.     REGNPS Security Contingency Plan
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.1     Security Threats 8.1.2  Alert Intrusion into plant Protected Area by an adversary.
OR Any security event which represents an actual substantial degradation of the level of safety of the plant.
MMARC IC:
Security event in a plant protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This class of security events represents an escalated threat to plant safety above that contained in the Unusual Event, For the purposes of this EAL, the intrusion by unauth'orized personnel inside the Protected Area boundary can be considered a significant security threat. Intrusion into a vital area by unauthorized personnel will escalate this event to a Site Area Emergency.
PEG  


==Reference:==
==Reference:==
HA4.1HA4.2BasisReference(s):1.REGNPSSecurityContingencyPlan8.3 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.1.3SiteAreaEmergency8.1SecurityThreats.Intrusionintoaplantsecurityvitalareabyanadversary.ORAnysecurityeventwhichrepresentsactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.MMARCIC:Securityeventinaplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisclassofsecurityeventsrepresentsanescalatedthreattoplantsafetyabovethatcontainedintheAlertinthatunauthorizedpersonnelhaveprogressedfromtheProtectedAreatothevitalarea.PEG
 
HA4.1 HA4.2 Basis Reference(s):
: 1. REGNPS Security Contingency Plan 8.3
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.1   Security Threats.
8.1.3 Site Area Emergency Intrusion into a plant security vital area by an adversary.
OR Any security event which represents actual or likely failures of plant systems needed to protect the public.
MMARC IC:
Security event in a plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This class of security events represents an escalated threat to plant safety above that contained in the Alert in that unauthorized personnel have progressed from the Protected Area to the vital area.
PEG  


==Reference:==
==Reference:==
HS1.1HS1.2BasisReference(s):1.REGNPSSecurityContingencyPlan OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.1.4GeneralEmergency8.1SecurityThreatsSecurityeventwhichresultsin:LossofplantcontrolfromtheControlRoomORLossofremoteshutdowncapabilityNUMARCICSecurityeventresultinginlossofabilitytoreachandmaintaincoldshutdown.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALencompassesconditionsunderwhichunauthorizedpersonnelhavetakenphysicalcontrolofvitalareasrequiredtoreachandmaintainsafeshutdown.PEG
 
HS1.1 HS1.2 Basis Reference(s):
: 1. REGNPS Security Contingency Plan
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.1   Security Threats 8.1.4 General Emergency Security event which results in:
Loss of plant control from the Control Room OR Loss of remote shutdown capability NUMARC IC Security event resulting in loss of ability to reach and maintain cold shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL encompasses conditions under which unauthorized personnel have taken physical control of vital areas required to reach and maintain safe shutdown.
PEG  


==Reference:==
==Reference:==
HG1.1HG1.2BasisReference(s):1.REGNPSSecurityContingencyPlan OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1~8.0Hazards8.2.1UnusualEvent8.2FireorExplosionConfirmedfireinanyplantarea,Table8.2or8.3notextinguishedin<15min.ofControlRoomnotification:Table8.2PlantAreas~TurbineBuilding~TSCServiceBuilding~ContaminatedStorageBuildingTable8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseNUIYIARCICFirewithinprotectedareaboundarynotextinguishedwithin15minutesofdetection.FPBloss/potentialloss:N/AModeApplicability:
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Basis:ThepurposeofthisEAListoaddressthemagnitudeandextentoffiresthatmaybepotentiallysignificantprecursorstodamagetosafetysystems.Thisexcludessuchitemsasfireswithinadministrationbuildings,waste-basketfires,andothersmallfiresofnosafetyconsequence.PEG
HG1.1 HG1.2 Basis Reference(s):
: 1. REGNPS Security Contingency Plan
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1
~
8.0    Hazards                        8.2   Fire or Explosion 8.2.1 Unusual Event Confirmed fire in any plant area, Table 8.2 or 8.3 not extinguished in < 15 min. of Control Room notification:
Table 8.2      Plant Areas
                  ~ Turbine Building
                  ~ TSC Service Building
                  ~ Contaminated Storage Building Table 8.3      Plant Vital Areas
                  ~ Control Building
                  ~ Reactor Containment Building
                  ~ Auxiliary Building
                  ~ Intermediate Building
                  ~ Emergency Diesel Building
                  ~ Standby Auxiliary Feedwater Building
                  ~ Screen House NUIYIARCIC Fire within protected area boundary not extinguished within 15 minutes of detection.
FPB loss/potential loss:
N/A Mode Applicability:
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Basis:
The purpose of this EAL is to address the magnitude and extent of fires that may be potentially significant precursors to damage to safety systems. This excludes such items as fires within administration buildings, waste-basket fires, and other small fires of no safety consequence.
PEG  


==Reference:==
==Reference:==
HU2.1BasisReference(s):1.SitePlotPlan OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.2.2Alert8.2FireorExplosionFireorexplosioninanyplantarea,Table8.2orTable8.3whichresultsinEITHER:~visibledamagetoplantequipmentorstructuresneededforsafeplantoperationOR~whichaffectssafetysystemoperabilityasindicatedbydegradedsystemperformanceTable8.2PlantAreas~TurbineBuilding~TSC~ServiceBuilding~ContaminatedStorageBuildingTable8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseNUIKARCIC:Fireorexplosionaffectingtheoperabilityofplantsafetysystemsrequiredtoestablishormaintainsafeshutdown.FPBloss/potentialloss:N/AModeApplicability:All OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Basis:Thelistedareascontainfunctionsandsystemsrequiredforthesafeshutdownoftheplant.TheREGNPSsafeshutdownanalysiswasconsultedforequipmentandplantareasrequiredfortheapplicablemode.Withregardtoexplosions,onlythoseexplosionsofsuQicientforcetodamagepermanentstructuresorequipmentrequiredforsafeoperation,orwhichresultsindegradedperformanceofsafetysystemswithintheidentifiedplantareasshouldbeconsidered.Asusedhere,anexplosionisarapid,violent,unconfinedcombustion,oracatastrophicfailureofpressurizedequipment,thatpotentiallyimpartssignificantenergytonearbystructuresandmaterials.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.ThewordingofthisEALdoesnotimplythatanassessmentofsafetysystemperformanceisintendedtobeperformed,ratherthatasaresultoftheevent,safetysystemparametersymptomsaredegradedasaresultoftheevent.ThedeclarationofanAlertandtheactivationoftheTSCwillprovidetheEmergencyCoordinatorwiththeresourcesneededtoperformdamageassessments.TheEmergencyCoordinatoralsoneedstoconsideranysecurityaspectsoftheexplosions.PEG
 
HU2.1 Basis Reference(s):
: 1.     Site Plot Plan
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.2   Fire or Explosion 8.2.2 Alert Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:
    ~ visible damage to plant equipment or structures needed for safe plant operation OR
    ~   which affects safety system operability as indicated by degraded system performance Table 8.2      Plant Areas
                ~ Turbine Building
                ~ TSC
                ~ Service Building
                ~ Contaminated Storage Building Table 8.3      Plant Vital Areas
                ~ Control Building
                ~ Reactor Containment Building
                ~ Auxiliary Building
                ~ Intermediate Building
                ~ Emergency Diesel Building
                ~ Standby Auxiliary Feedwater Building
                ~ Screen House NUIKARC IC:
Fire or explosion affecting the operability of plant safety systems required to establish or maintain safe shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
All
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 Basis:
The listed areas contain functions and systems required for the safe shutdown of the plant. The REGNPS safe shutdown analysis was consulted for equipment and plant areas required for the applicable mode.
With regard to explosions, only those explosions of suQicient force to damage permanent structures or equipment required for safe operation, or which results in degraded performance of safety systems within the identified plant areas should be considered. As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to nearby structures and materials. No attempt is made in this EAL to assess the actual magnitude of the damage. The wording of this EAL does not imply that an assessment of safety system performance is intended to be performed, rather that as a result of the event, safety system parameter symptoms are degraded as a result of the event. The declaration of an Alert and the activation of the TSC will provide the Emergency Coordinator with the resources needed to perform damage assessments. The Emergency Coordinator also needs to consider any security aspects of the explosions.
PEG  


==Reference:==
==Reference:==
HA2.1BasisReference(s):1.SitePlotPlan OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.3.1UnusualEvent8.3Man-MadeEventsVehiclecrashintoorprojectilewhichimpactsplantstructuresorsystemswithinProtectedAreaboundaryNUIKARCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/A~ModeApplicability:Basis:TheProtectedAreaboundaryiswithinthesecurityisolationzoneandisdefinedinthesitesecurityplan.ThisEALaddressessuchitemsasplane,helicopter,train,barge,carortruckcrash,orimpactofotherprojectilesthatmaypotentiallydamageplantstructurescontainingfunctionsandsystemsrequiredforsafeshutdownoftheplant.Ifthecrashisconfirmedtoaffectaplantvitalarea,theeventmaybeescalatedtoAlert.PEG
 
HA2.1 Basis Reference(s):
: 1. Site Plot Plan
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                            8.3   Man-Made Events 8.3.1 Unusual Event Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary NUIKARC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A
~
Mode Applicability:
Basis:
The Protected Area boundary is within the security isolation zone and is defined in the site security plan.
This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of other projectiles that may potentially damage plant structures containing functions and systems required for safe shutdown of the plant. Ifthe crash is confirmed to affect a plant vital area, the event may be escalated to Alert.
PEG  


==Reference:==
==Reference:==
HU1.4BasisReference(s):1.SitePlotPlan8-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.3.2UnusualEvent8.3Man-MadeEventsReportbyplantpersonnelofanexplosionwithinProtectedAreaboundaryresultinginvisibledamagetopermanentstructuresorequipmentNUINARCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/AModeApplicability:Basis:TheProtectedAreaboundaryiswithinthesecurityisolationzoneandisdefinedinthesitesecurityplan.ForthisEAL,onlythoseexplosionsofsufBcientforcetodamagepermanentstructuresorequipmentwithintheProtectedAreashouldbeconsidered.Asusedhere,anexplosionisarapid,violent,unconfinedcombustion,oracatastrophicfailureofpressurizedequipment,thatpotentiallyimpartssignificantenergytonearbystructuresandmaterials.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.Theoccurrenceoftheexplosionwithreportsofevidenceofdamage(e.g.,deformation,scorching)issufficientfordeclaration.TheEmergencyCoordinatoralsoneedstoconsideranysecurityaspectsoftheexplosion.PEG
 
HU1.4 Basis Reference(s):
: 1. Site Plot Plan 8-10
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                            8.3   Man-Made Events 8.3.2 Unusual Event Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment NUINARC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
The Protected Area boundary is within the security isolation zone and is defined in the site security plan.
For this EAL, only those explosions of sufBcient force to damage permanent structures or equipment within the Protected Area should be considered. As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to near by structures and materials. No attempt is made in this EAL to assess the actual magnitude of the damage. The occurrence of the explosion with reports of evidence of damage (e. g., deformation, scorching) is sufficient for declaration. The Emergency Coordinator also needs to consider any security aspects of the explosion.
PEG  


==Reference:==
==Reference:==
HU1.5BasisReference(s):1.SitePlotPlan8-11 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.3.3UnusualEvent8.3Man-MadeEventsReportordetectionoftoxicorflammablegasesthatcouldenterorhaveenteredwithintheProtectedAreaboundaryinamountsthatcouldafFectthe~healthofplantpersonnelorsafeplantoperationORReportbylocal,countyorstateofficialsforpotentialevacuationofsitepersonnelbasedonoffsiteeventNUMARCIC:Releaseoftoxicorflammablegasesdeemeddetrimentaltosafeoperationoftheplant.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALisbasedonreleasesinconcentrationswithinthesiteboundarythat=willafFectthehealthofplantpersonnelorafFectingthesafeoperationoftheplantwiththeplantbeingwithintheevacuationareaofanofFsiteevent(i.e.,tankertruckaccidentreleasingtoxicgases,etc.).TheevacuationareaisasdeterminedfromtheDOTEvacuationTablesforSelectedHazardousMaterials,intheDOTEmergencyResponseGuideforHazardousMaterials.Shouldanexplosionoccurwithinaspecifiedplantarea,anAlertwouldbedeclaredbasedonEAL8.2.2.,PEG
 
HU1.5 Basis Reference(s):
: 1. Site Plot Plan 8-11
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                            8.3   Man-Made Events 8.3.3 Unusual Event Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could afFect the
  ~
health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event NUMARC IC:
Release of toxic or flammable gases deemed detrimental to safe operation of the plant.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL is based on releases in concentrations within the site boundary that
  =will afFect the health of plant personnel or afFecting the safe operation of the plant with the plant being within the evacuation area of an ofFsite event (i. e.,
tanker truck accident releasing toxic gases, etc.). The evacuation area is as determined from the DOT Evacuation Tables for Selected Hazardous Materials, in the DOT Emergency Response Guide for Hazardous Materials.
Should an explosion occur within a specified plant area, an Alert would be declared based on EAL 8.2.2.
,   PEG  


==Reference:==
==Reference:==
HU3.1HU3.28-12 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocumentRev1BasisReference(s):None8-13


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.3.4Alert8.3Man-MadeEventsVehiclecrashorprojectileimpactwhichprecludespersonnelaccesstoordamagesequipmentinplantvitalareas,Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseNUINARCIC:NaturalanddestructivephenomenaafFectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddresseseventsthatmayhaveresultedinaplantvitalareabeingsubjectedtoforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpretedasmandatingalengthydamageassessmentpriortoclassification.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.ThisEALaddressessuchitemsasplane,helicopter,train,barge,carortruckcrash,orimpactofprojectilesintoaplantvitalarea.8-14 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
HU3.1 HU3.2 8-12
 
OSSI-92-402A-4-REG    Ginna EAL Technical Bases DocumentRev 1 Basis Reference(s):
None 8-13
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                            8.3   Man-Made Events 8.3.4 Alert Vehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 Table 8.3        Plant Vital Areas
                ~ Control Building
                ~ Reactor Containment Building
                ~ Auxiliary Building
                ~ Intermediate Building
                ~ Emergency Diesel Building
                ~ Standby Auxiliary Feedwater Building
                ~ Screen House NUINARC IC:
Natural and destructive phenomena afFecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.
This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of projectiles into a plant vital area.
8- 14
 
OSSI-92-402A-4-REG    Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
HA1.5BasisReference(s):None8-15 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.3.5Alert8.3Man-MadeEventsReportordetectionoftoxicorflammablegaseswithinaplantarea,Table8.3,inconcentrationsthatwillbelifethreateningtoplantpersonnelorprecludeaccesstoequipmentneededforsafeplantoperationTable8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseMMARCIC:Releaseoftoxicorflammablegaseswithinafacilitystructurewhichjeopardizesoperationofsystemsrequiredtomaintainsafeoperationsortoestablishormaintaincoldshutdown.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALisbasedongasesthathaveenteredaplantstructureprecludingaccesstoequipmentnecessaryforthesafeoperationoftheplant.ThisEALappliestobuildingsandareascontiguoustoplantvitalareasorothersignificantbuildingsorareas.TheintentofthisEALisnottoincludebuildings(i.e.,warehouses)orotherareasthatarenotcontiguousorimmediatelyadjacenttoplantvitalareas.Itisappropriatethatincreasedmonitoringbedonetoascertainwhetherconsequentialdamagehasoccurred.8-16 OSSI-92-402A-4-REGGinnaEALTech'nicalBasesDocument,Rev1PEG
 
HA1.5 Basis Reference(s):
None 8-15
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.3   Man-Made Events 8.3.5 Alert Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation Table 8.3      Plant Vital Areas
                  ~ Control Building
                  ~ Reactor Containment Building
                  ~ Auxiliary Building
                  ~ Intermediate Building
                  ~ Emergency Diesel Building
                  ~ Standby Auxiliary Feedwater Building
                  ~ Screen House MMARC IC:
Release of toxic or flammable gases within a facility structure which jeopardizes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL is based on gases that have entered a plant structure precluding access to equipment necessary for the safe operation of the plant. This EAL applies to buildings and areas contiguous to plant vital areas or other significant buildings or areas. The intent of this EAL is not to include buildings (i. e., warehouses) or other areas that are not contiguous or immediately adjacent to plant vital areas. It is appropriate that increased monitoring be done to ascertain whether consequential damage has occurred.
8-16
 
OSSI-92-402A-4-REG    Ginna EAL Tech'nical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
HA3.1HA3.2BasisReference(s):None8-17 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.1UnusualEvent8.4NaturalEventsEarthquakefeltinplantbyanyoperatorANDConfirmationofearthquakeofanintensity)0.01gperSC-5"EarthquakeEmergencyPlan".MMARCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/AModeApplicability:Basis:REGNPSseismicinstrumentationactuatesat0.01g.Damagetosomeportionsofthesitemayoccurbutitshouldnotaffectabilityofsafetyfunctionstooperate.Methodsofdetectioncanbebasedoninstrumentationvalidatedbyareliablesource,operatorassessment,orindicationreceivedfromoutsideagencies.Asde6nedintheEPRI-sponsored"GuidelinesforNuclearPlantResponsetoanEarthquake",datedOctober1989,a"feltearthquake"is:"AnearthquakeofsuQicientintensitysuchthat:(a)theinventorygroundmotionisfeltatthenuclearplantsiteandrecognizedasanearthquakebasedonaconsensusofControlRoomoperatorsondutyatthetime,and(b)forplantswithoperableseismicinstrumentation,theseismicswitchesoftheplantareactivated.Formostplantswithseismicinstrumentation,theseismicswitchesaresetatanaccelerationofabout0.01g."PEG
 
HA3.1 HA3.2 Basis Reference(s):
None 8-17
 
OS SI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.4   Natural Events 8.4.1 Unusual Event Earthquake felt inplant by any operator AND Confirmation of earthquake of an intensity    ) 0.01 g per SC-5 "Earthquake Emergency Plan".
MMARC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
REGNPS seismic instrumentation actuates at 0.01 g.
Damage to some portions of the site may occur but it should not affect ability of safety functions to operate. Methods of detection can be based on instrumentation validated by a reliable source, operator assessment, or indication received from outside agencies. As de6ned in the EPRI-sponsored "Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989, a "felt earthquake" is:
    "An earthquake of suQicient intensity such that: (a) the inventory ground motion is felt at the nuclear plant site and recognized as an earthquake based on a consensus of Control Room operators on duty at the time, and (b) for plants with operable seismic instrumentation, the seismic switches of the plant are activated. For most plants with seismic instrumentation, the seismic switches are set at an acceleration of about 0.01 g."
PEG  


==Reference:==
==Reference:==
HU1.18-18 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1BasisReference(s):1.SC-5EarthquakeEmergencyPlan2.EPRIdocument,"GuidelinesforNuclearPlantResponsetoanEarthquake",datedOctober19898-19 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4NaturalEvents8.4.2UnusualEventReportbyplantpersonneloftornadowithinplantProtectedAreaboundaryM;5hVKCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALisbasedontheassumptionthatatornadostriking(touchingdown)withintheProtectedAreaboundarymayhavepotentiallydamagedplantstructurescontainingfunctionsorsystemsrequiredforsafeshutdownoftheplant.Ifsuchdamageiscon6rmedvisuallyorbyotherin-plantindications,theeventmaybeescalatedtoAlert.PEG
 
HU1.1 8-18
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. SC-5 Earthquake Emergency Plan
: 2. EPRI document, "Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989 8-19
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                        8.4    Natural Events 8.4.2 Unusual Event Report by plant personnel of tornado within plant Protected Area boundary M;5hVKC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL is based on the assumption that a tornado striking (touching down) within the Protected Area boundary may have potentially damaged plant structures containing functions or systems required for safe shutdown of the plant. Ifsuch damage is con6rmed visually or by other in-plant indications, the event may be escalated to Alert.
PEG  


==Reference:==
==Reference:==
HU1.2BasisReference(s):None8-20 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.3UnusualEvent8.4NaturalEventsDeerCreekfloodingoverentranceroadbridge(handrail)ORLakelevel>252ftORScreenHouseSuctionBaywaterlevel<15ft(low-lowlevelalarm)MMARCIC:Naturalanddestructivephenomenaaffectingtheprotectedarea.FPBloss/potentialloss:N/AModeApplicability:Basis:Thiscovershighandlowlakewaterlevelconditionsthatcouldbeprecursorsofmoreseriousevents.Deercreekfloodingoverentranceroadbridgemayprecludeemergencyresponsepersonnelaccessandegress.Lakewaterlevel>252ft.correspondstoplantdesignlevels.ScreenHouseSuctionBaylevel<15R.correspondstothelow-lowlevelalarmpointandwhichrequiresloadreductionbelow50%.PEG
 
HU1.2 Basis Reference(s):
None 8-20
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.4   Natural Events 8.4.3 Unusual Event Deer Creek flooding over entrance road bridge (hand rail)
OR Lake level > 252 ft OR Screen House Suction Bay water level < 15 ft (low-low level alarm)
MMARC IC:
Natural and destructive phenomena affecting the protected area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This covers high and low lake water level conditions that could be precursors of more serious events. Deer creek flooding over entrance road bridge may preclude emergency response personnel access and egress. Lake water level
> 252 ft. corresponds to plant design levels. Screen House Suction Bay level <
15 R. corresponds to the low-low level alarm point and which requires load reduction below 50%.
PEG  


==Reference:==
==Reference:==
HU1.7BasisReference(s):1.2.3.SC-4HighWater(Flood)EmergencyPlanSC-4.1LowScreenhouseWaterLevelInterofficeMemo"ScreenhousePumpBayWaterLevel"datedV24/94toTerryWhitefromWilliamRapinandJeffreyWayland8-21 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.4Alert8.4NaturalEventsEarthquakefeltinplantbyanyplantoperationspersonnelAND~Confirmationofearthquakeofanintensity)0.08gperSC-5"EarthquakeEmergencyPlan"NUIYGMCIC:NaturalanddestructivephenomenaafFectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddresseseventsthatmayhaveresultedinaplantvitalareabeingsubjectedtoforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpretedasmandatingalengthydamageassessmentpriortoclassification.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.ThisEALisbasedontheFSARdesignbasisoperatingearthquakeof0.08g.Seismiceventsofthismagnitudecancausedamagetoplantsafetyfunctions.PEG
 
HU1.7 Basis Reference(s):
: 1. SC-4 High Water (Flood) Emergency Plan
: 2. SC-4.1 Low Screenhouse Water Level
: 3. Interoffice Memo" Screenhouse Pump Bay Water Level" dated V24/94 to Terry White from William Rapin and Jeffrey Wayland 8-21
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                        8.4     Natural Events 8.4.4 Alert Earthquake felt inplant by any plant operations personnel AND
~
Confirmation of earthquake of an intensity ) 0.08 g per SC-5 "Earthquake Emergency Plan" NUIYGMC IC:
Natural and destructive phenomena afFecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.
This EAL is based on the FSAR design basis operating earthquake of 0.08 g.
Seismic events of this magnitude can cause damage to plant safety functions.
PEG  


==Reference:==
==Reference:==
HAl.lBasisReference(s):1.SC-5"EarthquakeEmergencyPlan"8-22


OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.5Alert8.4NaturalEv'entsSustainedwinds>75mphOR,Tornadostrikesaplantvitalarea,Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseMMARCIC:Naturalanddestructivephenomenaaffectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddresseseventsthatmayhaveresultedinaplantvitalareabeingsubjectedtoforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpretedasmandatingalengthydamageassessmentpriortoclassification.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.ThisEALisbasedontheFSARassumed"severeenvironmentalloading"conditionof75mph.Windloadsofthismagnitudecancausedamagetosafetyfunctions.
HAl.l Basis Reference(s):
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1PEG
: 1.      SC-5 "Earthquake Emergency Plan" 8-22
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.4   Natural Ev'ents 8.4.5 Alert Sustained winds > 75 mph OR
, Tornado strikes a plant vital area, Table 8.3 Table 8.3      Plant Vital Areas
                  ~ Control Building
                  ~ Reactor Containment Building
                  ~ Auxiliary Building
                  ~ Intermediate Building
                  ~ Emergency Diesel Building
                  ~ Standby Auxiliary Feedwater Building
                  ~ Screen House MMARC IC:
Natural and destructive phenomena affecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.
This EAL is based on the FSAR assumed "severe environmental loading" condition of 75 mph. Wind loads of this magnitude can cause damage to safety functions.
 
OSSI-92-402A-4-REG                    Ginna EAL Technical Bases Document, Rev 1 PEG


==Reference:==
==Reference:==
HA1.2BasisReference(s):1.RGEFSARSection3.3.2.1.48-24 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.6Alert8.4NaturalEventsAnynaturaleventwhichresultsinareportofvisiblestructuraldamageorassessmentbyControlRoompersonnelofactualdamagetoequipmentneededforsafeplantoperation,Table8.3Table8.3PlantVitalAreas~ControlBuilding~ReactorContainmentBuilding~AuxiliaryBuilding~IntermediateBuilding~EmergencyDieselBuilding~StandbyAuxiliaryFeedwaterBuilding~ScreenHouseMMARCIC:Naturalanddestructivephenomenaaffectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddresseseventsthatmayhaveresultedinaplantvitalareabeingsubjectedtoforcesbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpretedasmandatingalengthydamageassessmentpriortoclassification.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.ThisEALspecifiesareasinwhichstructurescontainingsystemsandfunctionsrequiredforsafeshutdownoftheplantarelocated.8-25 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1'PEG
 
HA1.2 Basis Reference(s):
: 1. RGE FSAR Section 3.3.2.1.4 8-24
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                          8.4     Natural Events 8.4.6 Alert Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 Table 8.3      Plant Vital Areas
                ~ Control Building
                ~ Reactor Containment Building
                ~ Auxiliary Building
                ~ Intermediate Building
                ~ Emergency Diesel Building
                ~ Standby Auxiliary Feedwater Building
                ~ Screen House MMARC IC:
Natural and destructive phenomena affecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.
This EAL specifies areas in which structures containing systems and functions required for safe shutdown of the plant are located.
8-25
 
OSSI-92-402A-4-REG      Ginna EAL Technical Bases Document, Rev 1
'PEG  


==Reference:==
==Reference:==
HA1.3BasisReference(s):None8-26 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Hazards8.4.VAlert8.4NaturalEventsFloodwateraccumulatingonscreenhouseoperatingfloorOR'akelevel>253ftORScreenHouseSuctionBaywaterlevel<13ftNUMARCIC:Naturalanddestructivephenomenaaffectingtheplantvitalarea.FPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddresseseventsthatmayhaveresultedinaplantvitalareabeingsubjectedtolevelsbeyonddesignlimits,andthusdamagemaybeassumedtohaveoccurredtoplantsafetysystems.Theinitialreportshouldnotbeinterpretedasmandatingalengthydamageassessmentpriortoclassification.NoattemptismadeinthisEALtoassesstheactualmagnitudeofthedamage.This.EALcovershighandlowlakewaterlevelconditionsthatexceedlevelswhichthreatenvitalequipment.Floodwateraccumulatingonthescreenhouseoperatingfloororlakelevels>253ft.correspondstolevelsthreateningvitalequipment.ScreenHouseSuctionBaylevel<13ft.correspondstothelevelbelowwhichthemotordrivenfirewaterpumpsuctionbowlsareuncovered.PEG
 
HA1.3 Basis Reference(s):
None 8-26
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 8.0    Hazards                        8.4     Natural Events 8.4.V  Alert Flood water accumulating on screen house operating floor OR
'ake level > 253 ft OR Screen House Suction Bay water level < 13 ft NUMARC IC:
Natural and destructive phenomena affecting the plant vital area.
FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses events that may have resulted in a plant vital area being subjected to levels beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.
This.EAL covers high and low lake water level conditions that exceed levels which threaten vital equipment. Flood water accumulating on the screen house operating floor or lake levels > 253 ft. corresponds to levels threatening vital equipment. Screen House Suction Bay level < 13 ft. corresponds to the level below which the motor driven firewater pump suction bowls are uncovered.
PEG  


==Reference:==
==Reference:==
HA1.78-27 OSSI-92-402A-4-REG'innaEALTechnicalBasesDocument,Rev1BasisReference(s):1.SC-4HighWater(Flood)EmergencyPlan2.SC-4.1LowScreenhouseWaterLevel3.Interof6ceMemo"ScreenhousePumpBayWaterLevel"dated1/24/94toTerryWhitefromWilliamRapinandJeffreyWayland8-28 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1TheEALsdefinedincategories1.0through8.0specifythepredeterminedsymptomsoreventswhichareindicativeofemergencyorpotentialemergencyconditions,andwhichwarrantclassification.WhiletheseEALshavebeendevelopedtoaddressthefullspectrumofpossibleemergencyconditionswhichmaywarrantclassificationandsubsequentimplementationoftheEmergencyPlan,aprovisionforclassificationofemergenciesbasedonoperator/managementexperienceandjudgmentisstillnecessary.TheEALsofthiscategoryprovidetheShiftSupervisororEmergencyCoordinatorthelatitudetoclassifyemergencyconditionsconsistentwiththeestablishedclassificationcriteria,basedupontheirjudgment.9-1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0Other9.1.1UnusualEventAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadtoorhasledtoapotentialdegradationofthelevelofsafetyoftheplant.NUINARCIC:EmergencyDirectorJudgmentFPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddressesunanticipatedconditionsnotaddressedexplicitlyelsewherebutthatwarrantdeclarationofanemergencybecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheUnusualEventemergencyclass.Fromabroadperspective,oneareathatmaywarrantEmergencyCoordinatorjudgmentisrelatedtolikelyoractualbreakdownofsitespecificeventmitigatingactions.Examplestoconsiderincludeinadequateemergencyresponseprocedures,transientresponseeitherunexpectedornotunderstood,failureorunavailabilityofemergencysystemsduringanaccidentinexcessofthatassumedinaccidentanalysis,orinsufhcientavailabilityofequipmentand/orsupportpersonnel.PEG
 
HA1.7 8-27
 
OSSI-92-402A-4-REG'inna                    EAL Technical Bases Document, Rev 1 Basis Reference(s):
: 1. SC-4 High Water (Flood) Emergency Plan
: 2. SC-4.1 Low Screenhouse Water Level
: 3. Interof6ce Memo " Screenhouse Pump Bay Water Level" dated 1/24/94 to Terry White from William Rapin and Jeffrey Wayland 8-28
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 The EALs defined in categories 1.0 through 8.0 specify the predetermined symptoms or events which are indicative of emergency or potential emergency conditions, and which warrant classification. While these EALs have been developed to address the full spectrum of possible emergency conditions which may warrant classification and subsequent implementation of the Emergency Plan, a provision for classification of emergencies based on operator/management experience and judgment is still necessary. The EALs of this category provide the Shift Supervisor or Emergency Coordinator the latitude to classify emergency conditions consistent with the established classification criteria, based upon their judgment.
9-1
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 9.0    Other 9.1.1 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.
NUINARC IC:
Emergency Director Judgment FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Unusual Event emergency class.
From a broad perspective, one area that may warrant Emergency Coordinator judgment is related to likely or actual breakdown of site specific event mitigating actions. Examples to consider include inadequate emergency response procedures, transient response either unexpected or not understood, failure or unavailability of emergency systems during an accident in excess of that assumed in accident analysis, or insufhcient availability of equipment and/or support personnel.
PEG  


==Reference:==
==Reference:==
HU1.3HU5.1 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1'BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0Other9.1.2UnusualEventAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadtoorhasledtoalossorpotentiallossofcontainment,.AttachmentA.NUbXARCIC:N/AFPBloss/potentialloss:Containmentloss/potentiallossModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesanyotherfactorsthataretobeusedbytheEmergencyCoordinatorindeterminingwhetherthecontainmentbarrierislostorpotentiallylost.Inaddition,theinabilitytomonitor,thebarriershouldalsobeincorporatedinthisEALasafactorinEmergencyCoordinatorjudgmentthatthebarriermaybeconsideredlostorpotentiallylost.PEG
 
HU1.3 HU5.1
 
OSSI-92-402A-4-REG  Ginna EAL Technical Bases Document, Rev 1
'Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 9.0    Other 9.1.2 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment,
. Attachment A.
NUbXARC IC:
N/A FPB loss/potential loss:
Containment loss/potential loss Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the containment barrier is lost or potentially lost. In addition, the inability to monitor, the barrier should also be incorporated in this EAL as a factor in Emergency Coordinator judgment that the barrier may be considered lost or potentially lost.
PEG  


==Reference:==
==Reference:==
PCS.XBasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0Other9.1.3AlertAnyevent,asdeterminedbytheShikSupervisororEmergencyCoordinator,thatcouldcauseorhascausedactualsubstantialdegradationofthelevelofsafetyoftheplant.NMGLRCIC:EmergencyDirectorJudgmentFPBloss/potentialloss:N/AModeApplicability:BasisThisEALaddressesunanticipatedconditionsnotaddressedexplicitlyelsewherebutthatwarrantdeclarationofanemergencybecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheAlertemergencyclass.PEG
 
PCS.X Basis Reference(s):
None
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 9.0    Other 9.1.3 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.
NMGLRC IC:
Emergency Director Judgment FPB loss/potential loss:
N/A Mode Applicability:
Basis This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Alert emergency class.
PEG  


==Reference:==
==Reference:==
HA6.1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0Other9.1.4AlertAnyevent,asdeterminedbytheShikSupervisororEmergencyCoordinator,thatcouldleadorhasledtoalossorpotentiallossofeitherfuelcladorRCSbarrier,AttachmentA.NM4A'RCIC:N/AFPBloss/potentialloss:LossorpotentiallossofeitherfuelcladorRCSbarrierModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesanyotherfactorsthataretobeusedbytheEmergencyCoordinatorindeterminingwhetherthefuelcladorRCSbarriersarelostorpotentiallylost.Inaddition,theinabilitytomonitorthebarriersshouldalsobeconsideredinthisEALasafactorinEmergencyCoordinatorjudgmentthatthebarriersmaybeconsideredlostorpotentiallylost.PEG
 
HA6.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 9.0    Other 9.1.4 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to a loss or potential loss of either fuel clad or RCS barrier, Attachment A.
NM4A'RC IC:
N/A FPB loss/potential loss:
Loss or potential loss of either fuel clad or RCS barrier Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the fuel clad or RCS barriers are lost or potentially lost. In addition, the inability to monitor the barriers should also be considered in this EAL as a factor in Emergency Coordinator judgment that the barriers may be considered lost or potentially lost.
PEG  


==Reference:==
==Reference:==
FC7.1RCS6.1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0OCher9.1.5SiteAreaEmergencyAsdeterminedbytheShiftSupervisororEmergencyCoordinator,eventsareinprogresswhichindicateactualorlikelyfailuresofplantsystemsneededtoprotectthepublic.AnyreleasesarenotexpectedtoresultinexposureswhichexceedEPAPAGs.NUMARCIC:EmergencyDirectorJudgmentFPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddressesunanticipatedconditionsnotaddressedexplicitlyelsewherebutthatwarrantdeclarationofanemergencybecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheemergencyclassdescriptionforSiteAreaEmergency.PEG
 
FC7.1 RCS6.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 9.0    OCher 9.1.5 Site Area Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public. Any releases are not expected to result in exposures which exceed EPA PAGs.
NUMARC IC:
Emergency Director Judgment FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.
PEG  


==Reference:==
==Reference:==
HS3.1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev18.0Other9.1.6SiteAreaEmergencyAnyevent,asdeterminedbytheShikSupervisororEmergencyCoordinator,thatcouldleadorhasledtoeither:LossorpotentiallossofbothfuelcladandRCSbarrier,AttachmentAORLossorpotentiallossofeitherfuelcladorRCSbarrierinconjunctionwithalossofcontainment,AttachmentANUIKARCIC:N/AFPBloss/potentialloss:LossorpotentiallossofbothfuelcladandRCSbarrierORLossorpotentiallossofeitherfuelcladorRCSbarrierinconjunctionwithalossofcontainmentModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesunanticipatedconditionsaffectingfissionproductbarrierswhicharenotaddressedexplicitlyelsewhere.DeclarationofanemergencyiswarrantedbecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheemergencyclassdescriptionforSiteAreaEmergency.PEG
 
HS3.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 8.0    Other 9.1.6 Site Area Emergency Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to either:
Loss or potential loss of both fuel clad and RCS barrier, Attachment A OR Loss or potential loss of either fuel clad or RCS barrier  in conjunction with a loss of containment, Attachment A NUIKARC IC:
N/A FPB loss/potential loss:
Loss or potential loss of both fuel clad and RCS barrier OR Loss or potential loss of either fuel clad or RCS barrier  in conjunction with a loss of containment Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere. Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.
PEG  


==Reference:==
==Reference:==
FC7.1RCS6.1PC8.1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0>>Other9.1.7GeneralEmergencyAsdeterminedbytheShiftSupervisororEmergencyCoordinator,eventsareinprogresswhichindicateactualorimminentcoredamageandthepotential.foralargereleaseofradioactivematerialinexcessofEPAPAGsoutsidethesiteboundary.NUINARCIC:EmergencyDirectorJudgmentFPBloss/potentialloss:N/AModeApplicability:Basis:ThisEALaddressesunanticipatedconditionsnotaddressedexplicitlyelsewherebutthatwarrantdeclarationofanemergencybecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheGeneralEmergencyclass.ReleasescanreasonablybeexpectedtoexceedEPAPAGplumeexposurelevelsoutsidethesiteboundary..PEG
 
FC7.1 RCS6.1 PC8.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 9.0>>   Other 9.1.7 General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential
. for a large release of radioactive material in excess of EPA PAGs outside the site boundary.
NUINARC IC:
Emergency Director Judgment FPB loss/potential loss:
N/A Mode Applicability:
Basis:
This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the General Emergency class.
Releases can reasonably be expected to exceed EPA PAG plume exposure levels outside the site boundary.
. PEG  


==Reference:==
==Reference:==
HG2.1BasisReference(s):None OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev19.0Other9.1.8GeneralEmergencyAnyevent,asdeterminedbytheShiftSupervisororEmergencyCoordinator,thatcouldleadorhasledtoalossofanytwofissionproductbarriersandlossorpotentiallossofthethird,AttachmentA.NUIKARCIC:N/AFPBloss/potentialloss:LossofanytwofissionproductbarriersandlossorpotentiallossofthethirdModeApplicability:Poweroperation,hotshutdownBasis:ThisEALaddressesunanticipatedconditionsaffectingfissionproductbarrierswhicharenotaddressedexplicitlyelsewhere.DeclarationofanemergencyiswarrantedbecauseconditionsexistwhicharebelievedbytheEmergencyCoordinatortofallundertheemergencyclassdescriptionfortheGeneralEmergencyclass.PEG
 
HG2.1 Basis Reference(s):
None
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 9.0    Other 9.1.8  General Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attachment A.
NUIKARC IC:
N/A FPB loss/potential loss:
Loss of any two fission product barriers and loss or potential loss of the  third Mode Applicability:
Power operation, hot shutdown Basis:
This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere. Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for the General Emergency class.
PEG  


==Reference:==
==Reference:==
FC7.1HCS6.1PC8.1BasisReference(s):None9-10 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1ATTACHMENTAFISSIONPRODUCTBARRIERLOSS4POTENTIALLOSSINDICATORS FissionProductBarrierLoss/PotentialLossMatrix(Rosethresholdsforwhichlossorpotentialisdeterminedtobeimminent,classifyasthoughthethreshold(s)hasbeenexceeded)PotentialLoss,ORANGEpathinF-0.2,CORECOOLINGREDpathinF-0.3,HEATSINKCoreExitThermocoupleReadings>/00'FRVLIS543%w/noRCPsrunningEmergencyCoordinatorJudgmentREDpathinF-0.2,CORECOOLINGCoolantactivity>300IiCi/ccof1-131CoreExitThermocoupleReadings>1200'FContainmentradmonitorreading>100R/hrLetdownMonitor(R-9)reading>10R/hrEmergencyCoordinatorJudgmentPotentialLossREDpathonF-0.4,INTEGRITYREDpathonF-0.3,HEATSINKPrimaiysystemleakage>46gpmEmergencyCoordinatorJudgmentRCSsubcooling<EOPFig.MINSUBCOOLINGduetoRCSleakageUnisolablesecondarysidelinebreakwithSGtuberuptureasidentifiedinE-3"SteamGeneratorTubeRupture"Containmentradiationmonitorreading>10R/hrEmergencyCoordinatorJudgmentA-2 FissionProductBarrierLoss/PotentialLossMatrix+hosethresholdsforwhichlossorpotentialisdeterminedtobeimminent,classifyasthoughthethreshold(s)hasbeenexceeded)PotentialLoseREDpathF-0.5,CONTAINMENTRapiduncontrolleddecreaseinContainmentPressurefollowinginitialincreaseEither:Coreexitthermocouples>1200'FORCoreexitthermocouples>700'FwithRVLIS<43%(noRCPs)ANDRestorationproceduresnoteffectivewithin15minutesLossofprimarycoolantinsidecontainmentwithcontainmentpressureorsumplevelresponsenotconsistentwithLOCAconditions,i.e.unexpectedchangesoccurintheseparametersthatarenotexplainableduetooperatoractionsorautomaticsystemactions.SafetyinjectionsignalduetoLOCAwith<theminimumcontainmentcoolingsafeguardsequipmentoperating:CNMTpressure<28psig:2CNMTRecircFansCNMTpressure228psig:2CNMTSprayPumpsOR2CNMTRecircFansand1CNMTSprayPumpEither.CIorCVIisolationrequiredandCIorCVIvalve(s)notclosedwhenrequiredORInabilitytoisolateanyprimarysystemdischargingoutsidecontainmentANDRadiologicalreleasepathwaytotheenvironmentexistsContainmentpressure60psigandincreasingReleaseofsecondarysidetoatmospherewithprimarytosecondaryleakagegreaterthantechspecallowableof0.1CPMpersteamgeneratorh4%hydrogenconcentrationincontainmentBothdoorsopenoncontainmentairlockORInabilitytoclosecontainmentpressurerelieforpurgevalveswhichresultsinaradiologicalreleasepathwaytotheenvironmentORClorCVIvalve(s)notclosedwhenrequiredwhichresultsinaradiologicalreleasepathwaytotheenvironmentContainmentradiationmonitorreading>1000R/hrEmergencyCoordinatorJudgmentEmergencyCoordinatorJudgmentA-3 ATTACHIVlENTBWORDLIST/DEFINITIONS OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1ActuateToputintooperation;tomovetoaction;commonlyusedtorefertoautomated,multi-facetedoperations."ActuateECCS".AdversaryAsappliedtosecurityEALs,anindividualwhoseintentistocommitsabotage,disruptStationoperationsorotherwisecommitacrimeonstationproperty.Eventsareinprocessorhaveoccurredwhichinvolveanactualorpotentialsubstantialdegradationofthelevelofsafetyoftheplant.AnyreleasesareexpectedtobelimitedtosmallfractionsoftheEPAProtectiveActionGuidelineexposurelevels.AvailableThestateorconditionofbeingreadyandabletobeused(placedintooperation)toaccomplishthestated(orimplied)actionorfunction.Asappliedtoasystem,thisrequirestheoperabilityofnecessarysupportsystems(electricalpowersupplies,coolingwater,lubrication,etc.).Can/Cannotbedetermined(</>)Thecurrentvalueorstatusofanidentifiedparameterrelativetothatspecifiedcan/cannotbeascertainedusingallavailableindications(directandindirect,singlyorincombination).Can/Cannotbemaintainedabove/below(c/>)Thevalueoftheidentifiedparameter(s)is/isnotabletobekeptabove/belowspecifiedlimits.Thisdeterminationincludesmakinganevaluationthatconsidersbothcurrentandfuturesystemperformanceinrelationtothecurrentvalueandtrendoftheparameter(s).Neitherimpliesthattheparametermustactuallyexceedthelimitbeforetheactionistakennorthattheactionmustbetakenbeforethelimitisreached.B-2 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Can/Cannotberestoredabove/below(c/>)Thevalueoftheidentifiedparameter(s)is/isnotabletobereturnedtoabove/belowspeci6edlimitsafterhavingpassedthoselimits.Thisdeterminationincludesmakinganevaluationthatconsidersbothcurrentandfuturesystemsperformancesinrelationtothecurrentvalueandtrendoftheparameter(s).Doesnotimplyanyspecifictimeintervalbutdoesnotpermitprolongedoperationbeyondalimitwithouttakingthespecifiedaction.Asappliedtolossofelectricalpowersources(ex.:Powercannotberestoredtoanyvitalbusin<4hrs)thespecifiedpowersourcecannotbereturnedtoservicewithinthespecifiedtime.Thisdeterminationincludesmakinganevaluationthatconsidersbothcurrentandfuturerestorationcapabilities.Impliesthatthedeclarationshouldbemadeassoonasthedeterminationismadethatthepowersourcecannotberestoredwithinthespecifiedtime.CloseTopositionavalveordampersoastopreventflowoftheprocessfluid.Tomakeanelectricalconnectiontosupplypower.Con6rm/Con6rmationTovalidate,throughvisualobservationorphysicalinspection,thatanassumedconditionisasexpectedorrequired,withouttakingactiontoalterthe"asfound"configuration.ControlTakeaction,asnecessary,tomaintainthevalueofaspecifiedparameterwithinapplicablelimits;tofixoradjustthetime,amount,orrateof;toregulateorrestrict.DecreaseTobecomeprogressivelylessinsize,amount,number,orintensity.DischargeRemovalofafluid/gas&omavolumeorsystem.
 
OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1EnterTogointo.EstablishToperformactionsnecessarytomeetastatedcondition."EstablishcommunicationwiththeControlRoom."EvacuateToremovethecontentsof;toremovepersonnelfromanarea.ExceedsTogoorbebeyondastatedorimpliedlimit,measure,ordegree.ExistTohavebeingwithrespecttounderstoodlimitationsorconditions.FailureAstateofinabilitytoperformanormalfunction.GeneralEmergencyEventsareinprocessorhaveoccurredwhichinvolveactualorimminentsubstantialcoredegradationormeltingwithpotentialforlossofcontainmentintegrity.ReleasescanbereasonablyexpectedtoexceedEPAProtectiveActionGuidelineexposurelevelsoFsiteformorethantheimmediatesitearea.Logictermwhichindicatesthattakingtheactionprescribediscontingentuponthecurrentexistenceofthestatedcondition(s).Iftheidenti6edconditionsdonotexist,theprescribedactionisnottobetakenandexecutionofoperatora'ctionsmustproceedpromptlyinaccordancewithsubsequentinstructions.B-4 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1'ncreaseTobecomeprogressivelygreaterinsize,amount,numberorintensity.IndicateTopointoutorpointto;todisplaythevalueofaprocessvariable;tobeasignorsymbol.InitiateTheactofplacingequipmentorasystemintoservice,eithermanuallyorautomatically.Activationofafunctionorprotectivefeature(i.e.initiateamanualtrip).IajectionTheactofforcingafluidintoavolumeorvessel.InoperableNotabletoperformit'sintendedfunctionIntrusionTheactofenteringwithoutauthorizationFailureofoperabilityorlackofaccessto.MaintainTakeaction,asnecessary,tokeepthevalueofthespecifiedparameterwithintheapplicablelimits.MonitorObserveandevaluateatafrequencysufBcienttoremainapprisedofthevalue,trend,andrateofchangeofthespecifiedparameter.B-5 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1NotifyTogivenoticeoforreporttheoccurrenceof;tomakeknownto;toinformspecifiedpersonnel;toadvise;tocommunicate;tocontact;torelay.OpenTopositionavalveordampersoastoallowflowoftheprocessfluid.Tobreakanelectricalconnectionwhichremovesapowersupplyfromanelectricaldevice.Tomakeavailableforentryorpassagebyturningback,removing,orclearingaway.OperableAbletoperformit'sintendedfunctionPerformTocarryoutanaction;toaccomplish;toaFect;toreachanobjective.PrimarySystemThepipes,valves,andotherequipmentwhichconnectdirectlytothereactorvesselorreactorcoolantsystemsuchthatareductioninreactorcoolantsystempressurewilleffectadecreaseinthesteamorwaterbeingdischargedthroughanunisolatedbreakinthesystem.RemoveTochangethelocationorpositionof.ReportTodescribeasbeinginaspecificstate.RequireTodemandasnecessaryoressential.8-6 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1Taketheappropriateactionrequirestoreturnthevalueofanidentifiedparametertowithinapplicablelimits.RiseDescribesanincreaseinaparameterastheresultofanoperatororautomaticaction.SampleToperformananalysisonaspecifiedmediatodetermineitsproperties.ShutdownToperformoperationsnecessarytocauseequipmenttoceaseorsuspendoperation;tostop."Shutdownunnecessaryequipment."SiteAreaEmergencyEventsareinprocessorhaveoccurredwhichinvolveactualorlikelymajorfailuresofplantfunctionsneededforprotectionofthepublic.AnyreleasesarenotexpectedtoresultinexposurelevelswhichexceedEPAProtectiveActionGuidelineexposurelevelsexceptnearthesiteboundary.SustainedProlonged.NotintermittentoroftransitorynatureTFlpTode-energizeapumporfanmotor;topositionabreakersoastointerruptorpreventtheflowofcurrentintheassociatedcircuit;tomanuallyactivateasemi-automaticfeature.ITotakeactiontocauseshutdownofthereactorbyrapidlyinsertingacontrolrodorcontrolrods(PWR).8-7 OSSI-92-402A-4-REGGinnaEALTechnicalBasesDocument,Rev1UncontrolledAnevolutionlackingcontrolbutisnottheresultofoperatoraction.UnplannedNotasanexpectedresultofdeliberateaction.UntilIndicatesthattheassociatedprescribedactionistoproceedonlysolongastheidentifiedconditiondoesnotexist.UnusualEventEventsareinprocessorhaveoccurredwhichindicateapotentialdegradationofthelevelofsafetyoftheplant.Noreleasesofradioactivematerialrequiringoffsiteresponseormonitoringareexpectedunlessfurtherdegradationofsafetysystemsoccurs.ValidSupportedorcorroboratedonasoundbasis.VentToopenaneffluent(exhaust)flowpathfromanenclosedvolume;toreducepressureinanenclosedvolume.VerifyToconGrmaconditionandtakeactiontoestablishthatconditionifrequired."Verifyreactortrip,verifySIpumpsrunning."B-8 f4)pi(i'IIl~'I<<->~a)A  
FC7.1 HCS6.1 PC8.1 Basis Reference(s):
}}
None 9-10
 
OS SI-92-402A-4-REG          Ginna EAL Technical Bases Document, Rev 1 ATTACHMENTA FISSION PRODUCT BARRIER LOSS 4 POTENTIAL LOSS INDICATORS
 
Fission Product Barrier Loss              / Potential    Loss    Matrix (Rose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)
Potential Loss
,ORANGE path in F-0.2, CORE COOLING                                                RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK                                                      Coolant activity > 300 IiCi/cc of 1-131 Core Exit Thermocouple Readings > /00  'F                                          Core Exit Thermocouple Readings > 1200       'F RVLIS 5 43% w/ no RCPs running                                                    Containment rad monitor reading >100 R/hr Emergency Coordinator Judgment                                                    Letdown Monitor (R-9) reading > 10 R/hr Emergency Coordinator Judgment Potential Loss RED path on F-0.4, INTEGRITY                                                      RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage RED path on F-0.3, HEAT SINK                                                      Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" Primaiy system leakage > 46 gpm                                                    Containment radiation monitor reading > 10 R/hr Emergency Coordinator Judgment                                                    Emergency Coordinator Judgment A-2
 
Fission Product Barrier Loss                / Potential    Loss  Matrix
                              +hose thresholds for which loss or potential is determined to be imminent, classify  as though the threshold(s) has been exceeded)
Potential Lose RED path F-0.5, CONTAINMENT                                                            Rapid uncontrolled decrease in Containment Pressure following initial increase Either:                                                                               Loss of primary coolant inside containment with containment pressure Core exit thermocouples >1200 'F                                                or sump level response not consistent with LOCA conditions, i.e.
OR                                                                              unexpected changes occur in these parameters that are not explainable Core exit thermocouples >700 'F with RVLIS <43% (no RCPs)                       due to operator actions or automatic system actions.
AND Restoration procedures not effective within 15 minutes Safety injection signal due to LOCA with < the minimum containment                    Either.
cooling safeguards equipment operating:                                                 CI or CVI isolation required and CI or CVI valve(s) not closed when CNMT pressure <28 psig: 2 CNMT Recirc Fans                                          required OR CNMT pressure 228 psig:     2 CNMT Spray Pumps                                      Inability to isolate any primary system discharging outside OR                                            containment 2 CNMT Recirc Fans                                  AND and  1 CNMT Spray Pump                              Radiological release pathway to the environment exists Containment pressure 60 psig and increasing                                          Release of secondary side to atmosphere    with primary to secondary leakage greater than tech spec allowable    of 0.1 CPM per steam generator h4% hydrogen concentration in containment                                            Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR Cl or CVI valve(s) not closed when required which results in a radiological release pathway to the environment Containment radiation monitor reading >1000 R/hr                                      Emergency Coordinator Judgment Emergency Coordinator Judgment A-3
 
ATTACHIVlENTB WORD LIST/DEFINITIONS
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Actuate To put into operation; to move to action; commonly used to refer to automated, multi-faceted operations. "Actuate ECCS".
Adversary As applied to security EALs, an individual whose intent is to commit sabotage, disrupt Station operations or otherwise commit a crime on station property.
Events are in process or have occurred which involve an actual or potential substantial degradation of the level of safety of the plant. Any releases are expected to be limited to small fractions of the EPA Protective Action Guideline exposure levels.
Available The state or condition of being ready and able to be used (placed into operation) to accomplish the stated (or implied) action or function. As applied to a system, this requires the operability of necessary support systems (electrical power supplies, cooling water, lubrication, etc.).
Can/Cannot be determined (</>)
The current value or status of an identified parameter relative to that specified can/cannot be ascertained using all available indications (direct and indirect, singly or in combination).
Can/Cannot be maintained above/below (c/>)
The value of the identified parameter(s) is/is not able to be kept above /below specified limits. This determination includes making an evaluation that considers both current and future system performance in relation to the current value and trend of the parameter(s). Neither implies that the parameter must actually exceed the limit before the action is taken nor that the action must be taken before the limit is reached.
B-2
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Can/Cannot be restored above/below (c/>)
The value of the identified parameter(s) is/is not able to be returned to above/below speci6ed limits after having passed those limits. This determination includes making an evaluation that considers both current and future systems performances in relation to the current value and trend of the parameter(s). Does not imply any specific time interval but does not permit prolonged operation beyond a limit without taking the specified action.
As applied to loss of electrical power sources (ex.: Power cannot be restored to any vital bus in < 4 hrs) the specified power source cannot be returned to service within the specified time. This determination includes making an evaluation that considers both current and future restoration capabilities.
Implies that the declaration should be made as soon as the determination is made that the power source cannot be restored within the specified time.
Close To position a valve or damper so as to prevent flow of the process fluid.
To make an electrical connection to supply power.
Con6rm / Con6rmation To validate, through visual observation or physical inspection, that an assumed condition is as expected or required, without taking action to alter the "as found" configuration.
Control Take action, as necessary, to maintain the value of a specified parameter within applicable limits; to fix or adjust the time, amount, or rate of; to regulate or restrict.
Decrease To become progressively less    in size, amount, number, or intensity.
Discharge Removal of a fluid/gas &om a volume or system.
 
OSSI-92-402A-4-REG                      Ginna EAL Technical Bases Document, Rev 1 Enter To go into.
Establish To perform actions necessary to meet a stated condition. "Establish communication with the Control Room."
Evacuate To remove the contents of; to remove personnel from an area.
Exceeds To go or be beyond a stated or implied limit, measure, or degree.
Exist To have being with respect to understood limitations or conditions.
Failure A state of inability to perform a normal function.
General Emergency Events are in process or have occurred which involve actual or imminent substantial core degradation or melting with potential for loss of containment integrity. Releases can be reasonably expected to exceed EPA Protective Action Guideline exposure levels oFsite for more than the immediate site area.
Logic term which indicates that taking the action prescribed is contingent upon the current existence of the stated condition(s). Ifthe identi6ed conditions do not exist, the prescribed action is not to be taken and execution of operator a'ctions must proceed promptly in accordance with subsequent instructions.
B-4
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1
'ncrease To become progressively greater    in size, amount, number or intensity.
Indicate To point out or point to; to display the value of a process variable; to be a sign or symbol.
Initiate The act of placing equipment or a system into service, either manually or automatically. Activation of a function or protective feature (i.e. initiate a manual trip).
Iajection The act of forcing a fluid into a volume or vessel.
Inoperable Not able to perform it's intended function Intrusion The act of entering without authorization Failure of operability or lack of access to.
Maintain Take action, as necessary, to keep the value of the specified parameter within the applicable limits.
Monitor Observe and evaluate at a frequency sufBcient to remain apprised of the value, trend, and rate of change of the specified parameter.
B-5
 
OSSI-92-402A-4-REG                          Ginna EAL Technical Bases Document, Rev 1 Notify To give notice of or report the occurrence of; to make known to; to inform specified personnel; to advise; to communicate; to contact; to relay.
Open To position a valve or damper so as to allow flow of the process fluid.
To break an electrical connection which removes a power supply from an electrical device.
To make available for entry or passage by turning back, removing, or clearing away.
Operable Able to perform it's intended function Perform To carry out an action; to accomplish; to aFect; to reach an objective.
Primary System The pipes, valves, and other equipment which connect directly to the reactor vessel or reactor coolant system such that a reduction in reactor coolant system pressure will effect a decrease in the steam or water being discharged through an unisolated break in the system.
Remove To change the location or position of.
Report To describe as being  in a specific state.
Require To demand as necessary or essential.
8-6
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Take the appropriate action requires to return the value of an identified parameter to within applicable limits.
Rise Describes an increase  in a parameter  as the result of an operator or automatic action.
Sample To perform an analysis on a specified media to determine    its properties.
Shut down To perform operations necessary to cause equipment to cease or suspend operation; to stop. "Shut down unnecessary equipment."
Site Area Emergency Events are in process or have occurred which involve actual or likely major failures of plant functions needed for protection of the public. Any releases are not expected to result in exposure levels which exceed EPA Protective Action Guideline exposure levels except near the site boundary.
Sustained Prolonged. Not intermittent or of transitory nature TFlp To de-energize a pump or fan motor; to position a breaker so as to interrupt or prevent the flow of current in the associated circuit; to manually activate a semi-automatic feature.
I To take action to cause shutdown of the reactor by rapidly inserting a control rod or control rods (PWR).
8-7
 
OSSI-92-402A-4-REG                        Ginna EAL Technical Bases Document, Rev 1 Uncontrolled An evolution lacking control but is not the result of operator action.
Unplanned Not as an expected result of deliberate action.
Until Indicates that the associated prescribed action is to proceed only so long as the identified condition does not exist.
Unusual Event Events are in process or have occurred which indicate a potential degradation of the level of safety of the plant. No releases of radioactive material requiring offsite response or monitoring are expected unless further degradation of safety systems occurs.
Valid Supported or corroborated on a sound basis.
Vent To open an effluent (exhaust) flowpath from an enclosed volume; to reduce pressure in an enclosed volume.
Verify To conGrm a condition and take action to establish that condition "Verifyreactor trip, verify SI pumps running."
ifrequired.
B-8
 
f4) pi(
i'I I
l~     'I
              <<->~a)
A}}

Latest revision as of 10:31, 4 February 2020

Rev 1 to Re Ginna EALs Technical Bases.
ML17263A833
Person / Time
Site: Ginna Constellation icon.png
Issue date: 10/11/1994
From:
ROCHESTER GAS & ELECTRIC CORP.
To:
Shared Package
ML17263A834 List:
References
OSSI-92-402A-4, OSSI-92-402A-4-REG-1, NUDOCS 9411090266
Download: ML17263A833 (209)


Text

Attachm B ll DN aw

ÃI R.E. Ginna Emergency Action Levels 0'o OM Cl 0'o'4 Annotated Classification Criteria Based on Response to NRC RAls Ul4 Category 1.0 CSFST Status Qw O~

DOO UMV Category 2.0 Reactor Fuel Category 3.0 Reactor Coolant System Category 4.0 Containment Category 5.0 Radioactivity Release Category 6.0 Electrical Failures Category 7.0 Equipment Failures Category 8.0 Hazards Category 9.0 Other

R. E. Ginna Emergency Action Levels Proposed Revision 19 Based on Response to NRC RAIs Category 1.0 CSFST Status Category 2.0 Reactor Fuel 0

Category 3.0 Reactor Coolant System Category 4.0 Containment Category 5.0 Radioactivity Release Category 6.0 Elecrtical Failures Category 7.0 Equipment Failures Category 8.0 Hazards Category 9.0 Other 10/11/94

Cate go .0 CSFST Status 1.0 CSFST Status 1.0 CSFST Status 1.1 Subcriticality 12 Core Cooling 1.1.1 Alert [SA2] 1.2.1 Site Area Emergency [fpl/fl,rl] [SS4]

ORANGE or RED path F-0.1 SUBCRITICALITY ORANGE or RED path in F-0.2, CORE COOLING AND Emergency boration is required Power Operations, Hot Shutdown Power Operations, Hot Shutdown 1.2.2 General Emergency [fl, rl, cpl]

1.1.2 Site Area Emergency [SS2] RED path in F~-0.2, CORE COOLING AND RED path in F-0.1 SUBCRITICALITY Functional restoration procedures not effective within AND either: 15 min.

Emergency boration is inoperable OR Power Operations, Hot Shutdown Power range not < 6% within 15 min. of initiation of emergency boration Power Operations, Hot Shutdown 1.1.3 General Emergency [SG2]

RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either:

RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK Power Operations, Hot Shutdown 1-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 CSFST Status 1.0 CSFST Status 1.0 CSFST Status 13 Heat Sink 1.4 Integrity 1.3.1 Site Area Emergency [fpl, rpl] [SS4] 1.4.1 Alert [rpl]

RED path in F-0.3, HEAT SINK RED path on F-0.4, INTEGRITY Power Operations, Hot Shutdown Power Operations, Hot Shutdown 1-3 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 CSFST Status 1.0 CSFST Status 1.5 Containment 1.5.1 General Emergency [6, rl, cpl]

RED path F-0.5, CONTAINMENTresulting from loss of reactor coolant Power Operations, Hot Shutdown 1-4 fpl fuel clad pot. loss 6

- - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 Reactor Fuel 2.0 Reactor Fuel 2.0 Reactor Fuel 2.1 Coolant Activity 2.2 Failed Fuel Detectors 2.1.1 Unusual Event [SU4] 2.2.1 Unusual Event [SU4]

Coolant sample activity: Letdown Line Monitor R-9 > 2 R/hr

>100%%uo of 84/E bar pCi/cc total specific activity OR All

> 0.2 pCi/cc I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded 2.2.2 Alert All Letdown Line Monitor R-9 > 10 R/hr 2.1.2 Alert [0] Power operation, hot shutdown Coolant activity > 300 pCi/cc I-131 equivalent 2.2.3 Site Area Emergency [fl, rpl]

Power operation, hot shutdown Letdown Line Monitor R-9 > 10 R/hr and any of the following:

2.1.3 Site Area Emergency [fi. rpl/rl] ~ RED path on F-0.4, INTEGRITY

~ Primary system leakage > 46 gpm Coolant activity > 300 pCi/cc I-131 equivalent and ~ RCS subcooling < EOP Fig. MIN SUBCOOLING any of the following: due to RCS leakage

~ RED path on F-0.4, INTEGRITY ~ Containment*radiation monitor R-29/R-30

~ Primary system leakage > 46 gpm reading > 10 R/hr

~ RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage Power operation, hot shutdown

~ Containment radiation monitor R-29/R-30 reading > 10 R/hr Power operation, hot shutdown 2-1 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Cate go .0 Reactor Fuel 2.0 Reactor Fuel 2.0 Reactor Fuel 2.3 Containment Radiation 2.4 Refueling Accidents or Other Radiation Monitors 2.3.1 Alert 2.4.1 Unusual Event [AU2]

Containment radiation monitor R-29/R-30 reading > 10 R/hr Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the Power operation, hot shutdown spent fuel pool low water level alarm setpoint All 2.3.2 Site Area Emergency [fl, rl]

Containment radiation monitor R-29/R-30 reading > 2.4.2 Alert [AA2]

100 R/hr Con6rmed sustained alarm on any of the following Power operation, hot shutdown radiation monitors resulting from an uncontrolled fuel handling process:

~ R-2 Containment Area Monitor 2.8.3 General Emergency [fl, rl, cpl] ~ R-5 Spent Fuel Pit

~ R-12 Containment Noble Gas Containment radiation monitor R-29/R-30 reading >

1000 R/hr Power operation, hot shutdown 2.4.8 Alert [AA2]

Report of visual observation of irradiated fuel uncovered All 2-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot, loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category .0 Reactor Coolant System 3.0 Reactor Coolant System 3.0 Reactor Coolant System 3.1 RCS Leakage 3.2 Primary to Secondary Leakage 3.1.1 Unusual Event [SU5] 3.2.1 Unusual Event [cl]

Unidentified or pressure boundary leakage > 10 gpm Release of secondary side to atmosphere with primary OR to secondary leakage > 0.1 gpm per steam generator Identified leakage > 25 gpm Power operation, hot shutdown Power operation, hot shutdown 1 3.2.2 Site Area Emergency [rpl, cl]

3.1.2 Alert [rpl]

Unisolable release of secondary side to atmosphere Primary system leakage > 46 gpm with primary to secondary leakage > 46 gpm Power operation, hot shutdown Power operation, hot shutdown 3.1.3 Site Area Emergency [fpl, rl] [SS5] 3.2.3 Site Area Emergency [fl,cl]

RVLIS cannot be maintained > 43% with no RCPs Release of secondary side to atmosphere with primary running to secondary leakage > 0.1 gpm per steam generator OR AND Either:

With the reactor vessel head removed, it is reported Coolant activity > 300 pCi/cc of I-131 that water level in the reactor vessel is dropping in an OR

. uncontrolled manner and core uncovery is likely . Letdown Line Monitor R-9 > 10 8/hr All Power operation, hot shutdown 3-1 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category .0 Reactor Coolant System 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert [rl]

RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage Power operation, hot shutdown 3-2 fpl - fuel clad pot. loss 6-fuel clad loss rpl -RCS pot. loss rl -RCS loss cpl -contain. pot. loss cl - contain. loss

Category 4.0 Containment 4.0 Containment 4.0 Containment 4.1 Containment Integrity Status 4.1 Containment Integrity Status 4.1.1 Unusual Event [cl] 4.1.3 Site Area Emergency [rl, cl]

Both doors open on containment airlock Either:

OR CI or CVI valve(s) not closed when required Inability to close containment pressure relief or purge following confirmed LOCA valves which results in a radiological release pathway OR to the environment Inability to isolate any primary system discharging OR outside containment CI or CVI valve(s) not closed when required which AND results in a radiological release pathway to the Radiological release pathway to the environment environment exists Power operation, hot shutdown Power operation, hot shutdown 4.1.2 Site Area Emergency [rl, cl] 4.1.4 General Emergency [fl, rl, cpl]

Rapid uncontrolled decrease in containment pressure Safety injection signal due to LOCA with less than following initial increase minimum operable containment heat removal OR equipment, Table 4.3 Loss of primary coolant inside containment with AND containment pressure or sump level response not Any indicators of fuel clad loss, Table 4.1 consistent with LOCA conditions Power operation, hot shutdown Power operation, hot shutdown 4-1 fpl fuel clad pot. loss 6 fuel clad loss rpl

- - - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

0 Category 4.0 Containment 4.0 Containment 4.0 Containment 4.1 Containment Integrity Status 4.2 SG Tube Rupture w/ Secondary Release 4.1.5 General Emergency [fpVfl,rl,cl] 4.2.1 Site Area Emergency [rl, cl]

Either: Unisolable secondary side line break with SG tube Rapid uncontrolled decrease in containment rupture as identified in E-3 "Steam Generator Tube pressure following initial increase Rupture" OR Loss of primary coolant inside containment with Power operation, hot shutdown containment pressure or sump level response not consistent with LOCA conditions AND 4.2.2 General Emergency [fpVfl,rl, cl]

Any indicators of fuel clad damage, Table 4.2 Unisolable secondary side line break with SG tube Power operation, hot'hutdown rupture as identified in E-3 "Steam Generator Tube Rupture" AND 4.1.6 General Emergency [fpVfl,rl,cl] Any indicators of fuel clad damage, Table 4.2 Either: Power operation, hot shutdown CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Power operation, hot shutdown 4-2 fpl - fuel clad pot. loss 6 fuel clad loss rpl

- - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 Containment 4.0 Containment 4.3 Combustible Gas Concentrations 4.3.1 General Emergency I fl,rl,cpl]

2 4% hydrogen concentration in containment Power operation, hot shutdown Table 4.1 Fuel Clad Loss Indicators

1. Coolant activity > 300 pCi/cc of I-131
2. Containment rad monitor R-29/R-30 reading

>100 R/hr

3. Letdown Monitor R-9 reading > 10 R/hr
4. RED path in F-0.2, CORE COOLING Table 4.3 Minimum Operable Containment Heat Table 4.2 Fuel Clad Dama e Indicators Removal E ui ment CNMT Pressure Recirc Fans Operable Spray Pumps

~ ORANGE or RED path in F-0.2, CORE Re uired COOLING

~ RED path in F-0.3, HEAT SINK <28 psig N/A

~ Coolant activity > 300 pCi/cc of I-131

~ Containment rad monitor R-29/R-30 reading

>100 H/hr >28 psig

~ Letdown Monitor R-9 reading > 10 R/hr 4-3 fpl - fuel clad pot. loss 6- fuel clad loss rpl - RCS pot. loss rl -RCS loss cpl - contain. pot. loss cl - contain. loss

Category 6.0 Radioactivity Release 6.0 Radioactivity Release /Area Radiation 6.0 Radioactivity Release / Area Radiation 6.1 EQluent Monitors 6.1 EQluent Monitors 6.1.1 Unusual Event [AU1] 6.1.4 General Emergency [AG1]

A valid reading on any monitors Table 5.1 column A valid reading on any monitors Table 5.1 column "NUE" for > 60 min. unless sample analysis can "GE" for > 15 min. unless dose assessment can confirm confirm release rates < 2 x technical specifications releases are below Table 5.2 column "GE" within this within this time period. time period.

All All 6.1.2 Alert [AA1]

A valid reading on any monitors Table 5.1 column "Alert" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "Alert" within this time period.

All 6.1.3 Site Area Emergency [AS1]

A valid reading on any monitors Table 5.1 column "SAE" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "SAE" within this time period.

All 5-1 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category o.0 Radioactivity Release 6.0 Radioactivity Release /Area Radiation 6.0 Radioactivity Release / Area Radiation 6.2 Dose Projections/ Environmental 5.2 Dose Projections/ Environmental Measurements/ Release Rates Measurements/ Release Rates 6.2.1 Unusual Event [AU1] 6.2.4 Site Area Emergency [AS1]

Confirmed sample analyses for gaseous or liquid Dose projections or field surveys resulting from actual release rates > 2 x technical specifications limits for > or imminent release which indicate doses / dose rates >

60 min. Table 5.2 column "SAE" at the site boundary or beyond.

All All 6.2.2 Alert [AA1]

6.2.5 General Emergency [AG1]

Confirmed sample analyses for gaseous or liquid release rates > 200 x technical specifications limits for Dose projections or field surveys resulting from actual

> 15 min. or imminent release which indicate doses / dose rates >

Table 5.2 column "GE" at the site boundary or beyond.

All 5.2.8 Alert [AA1] Table 5.3. Plant Areas Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates >

~ Reactor Containment Table 5.2 column "Alert" at the site boundary or Building beyond.

~ Auxiliary Building

~ Turbine Building All .

~ Emergency Diesel Building

~ Screen House

~ Standby Auxiliary Feedwater Building 5-2 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego o.0 Radioactivity Release 5.0 Radioactivity Release /Area Radiation 5.3 Area Radiation Levels 5.3.1 'Unusual Event [AU2]

Any sustained direct ARM readings > 100 x alarm or oAscale hi resulting from an uncontrolled process 5.3.2 Alert [AA3]

Sustained area radiation levels > 15 mR/hr in either:

Control Room OR Central Alarm Station and Secondary Alarm Station 5.3.3 Alert [AA3]

Sustained abnormal area radiation levels > 8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.

All 5-3 fpl - fuel clad pot. loss 6 fuel clad loss rpl

- - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category o.0 Radioactivity Release Table 5.1 EfHuent Monitor Classification Thresholds Monitor Alert GE R-ll 1.62E6 cpm N/A N/A N/A R-12 7.80E6 cpm 1.07E7 cpm N/A N/A R-13 2.20E4 cpm N/A N/A N/A R-14 6.40E5 cpm 1.61E6 cpm N/A N/A R-15 4.00E5 cpm 2.31E7 cpm N/A N/A R-18 3.60E5 cpm offscale hi N/A N/A R-12 A(7/9) N/A N/A 6.00 pCi/cc 60.00 pCi/cc R-14A(7/9) N/A N/A 0.533 pCi/cc 5.33 pCi/cc R-15A(7/9) N/A N/A 11.50 pCi/cc 115.00 pCi/cc R-31/32 1ARV N/A 1.900 mR/hr 19.0 mR/hr 190 mR/hr 1 Safety N/A 0.951 mR/hr 9.51 mR/hr 95.1 mRhr 2 Safety N/A 0.476 mR/hr 4.76 mR/hr 47.6 m R/hr 3 Safety N/A 0.317 mR/hr 3.17 mR/hr 31.7 mR/hr 4 Safety N/A 0.238 mR/hr 2.38 mR/hr .23.8 mR/hr Table 5.2 Dose Pro ection / Env. Measurement Classification Thresholds Alert GE TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mR/hr 100 mR/hr 1000 mR/hr CDE Thyroid rate 500 mR/hr 5000 mR/hr 5-4 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 Electrical Failures 6.0 Electrical Failures 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1 Loss of AC Power Sources 6.1.1 Unusual Event [SUl] 6.1.4 Site Area Emergency [SS1]

Loss of ability to supply power to the safeguard buses Loss of all safeguards bus AC power for > 15 min.

from offsite circuits 751 and 767 for > 15 min.

Power operation, hot shutdown All 6.1.6 General Emergency [SGl]

6.1.2 Alert [SA1]

Loss of all safeguards bus AC power Loss of all safeguards bus AC power for > 15 min. AND either:

Power restoration to any safeguards bus is not Cold Shutdown, Refueling, Defueled likely in < 4 hrs OR Actual or imminent entry into ORANGE or RED 6.1.3 Alert [SA5] path on F-0.2, "CORE COOLING" Available safeguard train AC power reduced to only Power operation, hot shutdown one of the following for > 15 min.:

~ EDG 1A (14/18)

~ EDG 1B (16/17)

~ Station AuxiliaryTransformer 12A

~ Station Auxiliary Transformer 12B Power operation, hot shutdown 6-1 fpl fuel clad pot. loss

- 6- fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category 6.0 Electrical Failures 6.0 Electrical Failures 6.2 Loss of DC Power Sources 6.2.1 Unusual Event [SU7]

< 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.

Cold Shutdown, Refueling 6.2.2 Site Area Emergency [SS3]

> 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.

Power operation, hot shutdown 6-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category .0 Equipment Failures 7.0 Equipment Failures V.O Equipment Failures V.1 Technical Specification%Requirements V.2 System Failures or Control Room Evacuation 7.1.1 Unusual Event [SU2]

7.2.1 Unusual Event [HU1]

Plant is not brought to required operating mode within Technical Specifications LCO Action-Statement Time. Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator Power operation, hot shutdown seals.

Power Operations V.2.2 Alert [HA1]

Turbine failure generated missiles result in any visible structural damage to plant vital equipment Power Operations, Hot Shutdown 7.2.8 Alert [HA5]

Entry into AP-CR.1 "Control Room Inaccessability" All 7.2.4 Alert [SA3]

Reactor coolant temperature cannot be maintained <

200 'F Cold Shutdown, Refueling 7-1 fyl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Cate go .0 Equipment Failures V.O Equipment Failures 7.0 Equipment Failures V.2 System Failures or Control Room 7.3 Loss of Indications /Alarms /

Evacuation Communication Capability V.2.5 Site Area Emergency [HS2] V.3.1 Unusual Event [SU3]

Control Room evacuation Unplanned loss of annunciators or indications on any AND Control Room Panels, Table 7.3 for > 15 min.

Core cooling cannot be established per AP-CR.1 AND "Control Room Inaccessibility" in < 20 min. Increased surveillance is required for safe plant operation All Power operation, hot shutdown 7.3.2 Unusual Event [SU6]

Loss of all communications capability affecting the ability to either:

Perform routine operations OR Notify offsite agencies or personnel 7-2 fpl - fuel clad pot. loss 6 fuel clad loss rpl

- - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0

. Equipment Failures V.O Equipment Failures V.3 Loss of Indications /Alarms /

Communication Capability Table 7.3 Vital Control Room Panels V.3.3 Alert [SA4] B C D E F G Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for > 15 min.

AND Increased surveillance is required for safe plant operation AND either:

A plant transient in progress OR PPCS and SAS are unavailable Power operation, hot shutdown V.3.4 Site Area Emergency [SS6]

Loss of annunciators or'indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Power operation, hot shutdown 7-3 fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Catego .0 Hazards 8.0 Hazards 8.0 Hazards 8.1 Security Threats 8.1 Security Threats 8.1.1 Unusual Event [HU4] 8.1.4 General Emergency [HG1]

Bomb device or other indication of attempted sabotage Security event which results in:

discovered within plant Protected Area. Loss of plant control from the Control Room OR OR Any security event which represents a potential Loss of remote shutdown capability degradation in the level of safety of the plant.

All 8.1.2 Alert [HA4]

Intrusion into plant Protected Area by an adversary.

OR Any security event which represents an actual substantial degradation of the level of safety of the plant.

All 8.1.3 Site Area Emergency [HS1]

Intrusion into a plant security vital area by an adversary.

OR Any security event which represents actual or likely failures of plant systems needed to protect the public.

All 8-1 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Hazards 8.0 Hazards 8.0 Hazards 8.2 Fire or Explosion 8.3 Man-Made Events 8.2.1 Unusual Event DiU2] 8.3.1 Unusual Event DiU1]

Confirmed fire in any plant area, Table 8.2 or Table Vehicle crash into or projectile which impacts plant 8.3 not extinguished in 5 15 min. of Control Room structures or systems within Protected Area boundary notification:

All All 8.3.2 Unusual Event [HU1]

8.2.2 Alert [HA2]

Report by plant personnel of an explosion within Fire or explosion in any plant area, Table 8.2 or Table Protected Area boundary resulting in visible damage 8.3 which results in EITHER: to permanent structures or equipment

~ visible damage to plant equipment or structures needed for safe plant operation All OR

~ which affects safety system operability as indicated by degraded system performance 8.3.3 Unusual Event [HU3]

Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could affect the health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event All 8-2 fpl - fuel clad pot. loss fl - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category 8.0 Hazards 8.0 Hazards 8.0 Hazards 8.3 Man-Made Events 8.4 Natural Events 8.3.4 Alert [HA1] 8.4.1 Unusual Event [HU1]

'ehicle crash or projectile impact which precludes Earthquake felt inplant by any operator personnel access to or damages equipment in plant AND I vital areas, Table 8.3 Confirmation of earthquake of an intensity > 0.01 g per SC-5 "Earthquake Emergency Plan".

All All 8.3.5 Alert [HA3]

8.4.2 Unusual Event [HU1]

Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be Report by plant personnel of tornado within plant life threatening to plant personnel or preclude access Protected Area boundary to equipment needed for safe plant operation All 8.4.3 Unusual Event [HUl]

Deer Creek flooding over entrance road bridge (hand rail)

OR Lake level > 252 ft OR Screen House Suction Bay water level < 15 ft (low-low level alarm)

All 8-3 ~

fpl - fuel clad pot. loss 6 - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category .0 Hazards 8.0 Hazards 8.0 Hazards 8.4 Natural Events 8.4 Natural Events 8.4.4 Alert [HA1] 8.4.7 Alert [HA1]

Earthquake felt inplant by any plant operations Flood water accumulating on screen house operating personnel floor AND OR Confirmation of earthquake of an intensity ) 0.08 g Lake level > 253 ft I'R per SC-5 "Earthquake Emergency Plan" Screen House Suction Bay water level < 13 ft All All 8.4.5 Alert [HA1]

Table 8.2 Plant Areas Sustained winds > 75 mph OR Tornado strikes a plant vital area, Table 8.3

~ Turbine Building

~ TSC All

~ Service Building

~ Contaminated Storage Building 8.4.6 Alert [HAl]

Any natural event which results in a report of visible Table 8.3 Plant Vital Areas structural damage or assessment by Control Room personnel of actual damage to equipment needed for ~ Control Building safe plant operation, Table 8.3 ~ Reactor Containment Building AuxiliaryBuilding All ~ Intermediate Building

~ Emergency Diesel Building

~ Standby AuxiliaryFeedwater Building

~ Screen House 8-4 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category 9.0 Other 9.0 Other 9.0 Other 9.1.1 Unusual Event 9.1.3 Alert Any event, as determined by the Shift Supervisor or Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led Emergency Coordinator, that could cause or has to a potential degradation of the level of safety of the caused actual substantial degradation of the level of plant. safety of the plant.

AIl 9.1.2 Unusual Event 9.1.4 Alert Any event, as determined by the Shift Supervisor or Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led Emergency Coordinator, that could lead or has led to a, to a loss or potential loss of containment, Attach. A. loss or potential loss of either fuel clad or RCS barrier, Attach. A.

Power operation, hot shutdown Power operation, hot shutdown 9-1 fpl - fuel clad pot. loss Q - fuel clad loss rpl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

Category 9.0 Other 9.0 Other 9.0 Other 9.1.5 Site Area Emergency 9.1.V General Emergency As determined by the Shift Supervisor or Emergency As determined by the Shik Supervisor or Emergency Coordinator, events are in progress which indicate Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to actual or imminent core damage and the potential for protect the public. Any releases are not expected to a large release of radioactive material in excess of EPA result in exposures which exceed EPA PAGs, Attach. PAGs outside the site boundary.

A.

All All 9.1.8 General Emergency 9.1.6 Site Area Emergency Any event, as determined by the ShiA. Supervisor or Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a Emergency Coordinator, that could lead or has led to loss of any two fission product barriers and loss or either: potential loss of the third, Attach. A.

Loss or potential loss of both fuel clad and RCS barrier, Attach. A. Power operation, hot shutdown OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attach. A.

Power operation, hot shutdown 9-2 fpl - fuel clad pot. loss 6 - fuel clad loss ryl - RCS pot. loss rl - RCS loss cpl - contain. pot. loss cl - contain. loss

OSSI-92-402A-4-REG 'gf I'innd EAL Technical Bases Document, Rev 1

}

fgi.J 2 Attachment C New York EAL Upgrade Project R.E. Ginna Emergency Action Levels Technical Bases Revision 1 Based on Proposed Responses to NRC RAIs 10/11/94

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document. Rev 1 PURPOSE The purpose of this document is to provide an explanation and rationale for each of the emergency action levels (EALs) included in the EAL Upgrade Program for R.E. Ginna Nuclear Power Station (REGNPS). It is also intended to facilitate the review process of the REGNPS EALs and provide historical documentation for future reference. This document is also intended to be utilized by, those individuals responsible for implementation of EPIP-1-0 "Ginna Station Event Evaluation and Classification" as a technical reference and aid in EAL interpretation.

DISCUSSION EALs are the plant-specific indications, conditions or instrument readings which are utilized to classify emergency conditions defined in the REGNPS Emergency Plan.

Subsequent to the acceptance by the NRC of NUMARC/NESP-007 "Methodology for Development of Emergency Action Levels" as an acceptable alternative to the NUREG 0654 EAL guidance, the four nuclear utilities in the State of New York decided to perform a joint implementation of the new methodology. This upgrade project involved the following plants:

~ Nine Mile Point Unit 1 (NMPC)

~ Nine Mile Point Unit 2 (NMPC)

James A. FitzPatrick Nuclear Power Plant (NYPA)

~ Indian Point Station 2 (ConEd)

~ Indian Point 3 Nuclear Po'wer Station (NYPA)

~ R.E. Ginna Nuclear Power Station (RG&E)

While the upgraded EALs are site specific, an objective of the upgrade project was to ensure conformity and consistency between the sites to the extent possible.

The revised EALs were derived from the Initiating Conditions and example EALs given in the REGNPS Plant-Specific EAL Guideline (PEG). The PEG is the REGNPS interpretation of the NUMARC methodology for developing EALs. The PEG identifies deletions from the NUMARC methodology by striking out words and phrases that are not applicable to REGNPS; additions are identified by underlining new words and phrases. The source of documents for PEG changes from NUNC methodology are listed in the references section of the PEG.

Many of the EALs derived from the NV)~C methodology are fission product barrier based. That is, the conditions which define the EALs are

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev l based upon loss or potential loss of one or more of the three fission product barriers.

The primary fission product barriers are:

A. rF 1 1 in The fuel cladding is comprised of the zirconium tubes which house the ceramic uranium oxide pellets along with the end plugs which are welded into each end of the fuel rods.

B. r I n m The RCS is comprised of the reactor vessel shell, vessel head, vessel nozzles and penetrations and all primary systems directly connected t'o the reactor vessel up to the first containment isolation valve.

C~i ~ Yh i i p' fh containment structure and all isolation valves required to p

maintain containment integrity under accident conditions.

The following criteria serves as the bases for event classification related to fission product barrier loss:

n 1Ev n Any loss or potential loss of containment hhzf'ny loss or any potential loss of either fuel clad or RCS r n Any loss of both fuel clad and RCS or Any potential loss of both fuel clad and RCS or Any potential loss of either fuel clad or RCS with a loss of any additional barrier Loss of any two barriers with loss or potential loss of a third Those EALs-which'reference one or more of the fission product barrier IC designators (FC, RCS and PC) in the PEG Reference section of the technical bases are derived from the Fission Product Barrier Analysis. The analysis entailed an evaluation of every combination of the plant specific barrier loss/potential loss indicators applied to the above criteria.

OSSI-92-402A-4-REG Ginna EAI. Technical Bases Document, Rev I Where possible, the EALs have been made consistent with'nd utilize the conditions defined in the REGNPS Critical Safety Function Status Trees (CSFSTs). While the symptoms that drive operator actions specified in the CSFSTs are not indicative of gll possible conditions which warrant emergency classification, they do define the symptoms, independent of initiating events, for which reactor plant safety and/or fission product barrier integrity are threatened. Where these symptoms are clearly representative of one of the PEG Initiating Conditions, they have been utilized as an EAL. This allows for rapid classification of emergency situations based on plant conditions without the need for additional evaluation or event diagnosis. Although some of the EALs presented here are based on conditions defined in the CSFSTs, classification of emergencies using these EALs is not dependent upon Emergency Operating Procedures (EOPs) entry or execution. The EALs can be utilized independently or in conjunction with the EOPs.

To the extent possible, the EALs are symptom based. That is, the action level is defined by values of key plant operating parameters which identify emergency or potential emergency conditions. This approach is appropriate because it allows the full scope of variations in the types of events to be classified as emergencies. But, a purely symptom based approach is not sufBcient to address all events for which emergency classification is appropriate. Particular events to which no predetermined symptoms can be ascribed have also been utilized as EALs since they may be indicative of potentially more serious conditions not yet fully realized.

The EALs are grouped into nine categories to simplify their presentation and to promote a rapid understanding by their users. These categories are:

1. CSFST Status
2. Reactor Fuel
3. Reactor Coolant System 4 Containment
5. Radioactivity Release / Area Radiation
6. Electrical Failures
7. Equipment Failures
8. Hazards
9. Other Categories 1 through 5 are primarily symptom based. The symptoms are indicative of actual or potential degradation of either fission product barriers or personnel safety.

Categories 6, 7 and 8 are event based. Electrical Failures are those events associated with losses of either AC or vital DC electrical power. Equipment Failures are abnormal and emergency events associated with vital plant system failures, while Hazards are those non-plant system related events which have affected or may affect plant safety.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document. Rev I Category 9 provides the Emergency Coordinator (ShiR Supervisor) the latitude to classify and declare emergencies based on plant symptoms or events which in his judgment warrant classification. This judgment includes evaluation of loss or potential loss of one or more fission product barriers warranting emergency classification consistent with the NUMlARC barrier loss criteria. The fission product barrier loss and potential loss indicators are provided in Attachment A.

Categories are further divided into one or more subcategories depending on the types and number of plant conditions that dictate emergency classifications. For example, the Electrical Failures category has two subcategories whose values can be indicative of losses of electrical power sources: loss of AC power sources and loss of DC power sources. An EAL may or may not exist for each sub category at all four classification levels.

Similarly, more than one EAL may exist for a sub category in a given emergency classification when appropriate (i.e. no EAL at the General Emergency level but three EALs at the Unusual Event level).

For each EAL, the, following information is provided:

Classification: Unusual Event, Alert, Site Area Emergency, or General Emergency NUMARC Initiating Condition &om which the EAL was derived, if applicable.

~ Fission product barrier loss/potential loss condition which the EAL represents, ifapplicable.

~ Operating Mode Applicability: One or more of the following plant operating conditions are listed: Power Operation, Hot Shutdown, Cold Shutdown, Refuel and Defueled EAL: Description of the condition or set of conditions which comprise the EAL

~ Basis: Description of the rationale for the EAL

~ PEG

Reference:

PEG IC(s) and example EAL(s) from which the EAL is derived

~ Basis Reference(s): Source documentation from which the EAL is derived

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The identified operating modes are defined as follows Reactor shutdown margin is less than Technical Specification minimum required with coolant temperature (Tavg) at or above normal operating temperature.

Reactor shutdown margin greater than or equal to Technical Specification minimum required with coolant temperature (Tavg) less than normal operating temperature.

~Ih shutdown margin greater than or equal Reactor to Technical Specification minimum required with coolant temperature (Tavg) less than or equal to 200 'F.

E~f~g Reactor shutdown margin greater than or equal to Technical Specification minimum required for refueling operations and coolant temperature (Tavg) less than or equal to 140 'F.

Lh~lui Reactor vessel contains no irradiated fuel.

These operating modes correlate to the NUMARC-007 and PEG identified operating modes as follows:

hni 1B Power Operations Power Operations Startup/Hot standby Power Operation Hot Shutdown Hot Shutdown Cold Shutdown Cold Shutdown Refuel Refuel Defueled Defueled All All

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Plant Emergency Operating Procedures (EOPs) are designed to maintain and/or restore a set of critical safety functions which are prioritized for restoration efforts during accident conditions. By monitoring the critical safety functions status, the impact of multiple events can be inherently addressed.

The critical safety functions are monitored through the use of Critical Safety Function Status Trees (CSFSTs). When certain plant parameters exceed threshold values specified by the CSFST, the plant operator is directed to one or more functional restoration and/or EOPs in an attempt to restore those parameters to within acceptable limits. The following CSFSTs are utilized to be indicative of failures or potential failures of one or more fission product barriers:

'0 g Rdptt l tl'SFSTldl t l f reactivity control which may pose a threat to fuel clad and RCS

'ntegrity.

C g Rdp tl core subcooling and thus pose a direct I'SFSTldl l threat to the integrity of the f

reactor fuel clad and RCS.

~H~ink'he Red path of this CSFST is indicative of a loss of ability to remove decay heat from the core and thus poses a direct threat to fuel clad and RCS integrity.

The Red path of this CSFST is indicative of a direct threat to RCS barrier integrity.

R dp t ftg CSFSTl l dl tl t l ff clad and RCS barrier and direct threat to the containment barrier integrity.

1-1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.1 Alert ORANGE or RED path F-0.1 SUBCRITICALITY AND Emergency boration is required NUIVIARCIC:

Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and immediate manual trips were not successful while in power operations or hot standby FPB loss/potential loss:

N/A Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Subcriticality - ORANGE path is entered based on failure of the intermediate range startup rate monitors to indicate negative or zero following reactor trip. This EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent requiring emergency boration. A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes control rods to be rapidly inserted into the core and brings the reactor subcritical (e.

g., reactor trip button).

This condition indicates failure of the automatic and manual protection systems to trip the reactor to the extent which precludes the reactor being made sub-critical. Although a front line automatic protection system did not function in response to a plant transient, it is the continued criticality under "conditions requiring a reactor trip which poses the potential threat to fuel clad integrity and thus warranting declaration of an Alert.

PEG

Reference:

SA2.1 1-2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. CSFST F-0.1, Subcriticality
2. "Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2 - Questions and Answers, June 1993 1-3

OSSA-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.2 Site Area Emergency RED path in F-0.1 SUBCRITICALITY AND either:

Emergency boration is inoperable OR Power range not < 5% within 15 min. of initiation of emergency boration NUINARC IC:

Failure of Reactor Protection system instrumentation to complete or initiate an automatic reactor trip once a Reactor Protection system setpoint has been exceeded and manual scram trip was not successful and there is continued power generation.

FPB loss/potential loss:

N/A Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Subcriticality - RED path is entered based on failure of power range indication to decrease below 5% following a reactor trip. This portion of the EAL addresses any manual trip or automatic trip signal followed by a manual trip which fails to shut down the reactor to an extent that the reactor is producing more heat load for which the safety systems were designed. A manual trip is any set of actions by the reactor operator(s) at the reactor control console which causes "control rods to be rapidly inserted into the core and brings power below that percent power associated with the ability of the safety systems to remove heat and continue to decrease."

This condition indicates failure of both the automatic and manual protection systems to trip the reactor in conjunction with a failure of alternate boration systems to reduce reactor power below decay heat levels. The combination of failure ofboth front line and backup protection systems to function in response to a plant transient, along with the continued production of heat poses a direct threat to fuel clad and RCS integrity and thus warrants declaration of a Site Area Emergency.

1-4

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 15 minutes is specified to allow time for emergency boration to be effective and provides a discriminator between SA2.1 and SS2.1. The classification should be made as soon as it is apparent that emergency boration is not or will not be effective in reducing reactor power below 5%.

PEG

Reference:

SS2.1 SS4.1 Basis Reference(s):

l. CSFST F-0.1, Subcriticality
2. FR-S.1, Response to Reactor Restart/ATWS
3. FR-S.2, Response to Loss of Core Shutdown 4 "Methodology for Development of Emergency Action Levels NUMARC/NESP-007 Revision 2 - Questions and Answers, June 1993 1-5

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.1 Subcriticality 1.1.3 General Emergency RED path in F-0.1, SUBCRITICALITY AND Actual or imminent entry into either RED path in F-0.2, CORE COOLING OR RED path in F-0.3, HEAT SINK MBRLRC IC:

Failure of the Reactor Protection System to complete an automatic trip and manual trip was not successful and there is indication of an extreme challenge to the ability to cool the core.

FPB loss/potential loss:

N/A Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Subcriticality - RED path is entered based on > 5% reactor power following a reactor trip.

CSFST Heat Sink - RED path is entered based on both:

~ both S/G's narrow range level < 5%

AND

~ Total feedwater flow to S/Gs < 200 gpm CSFST Core Cooling - RED path is entered based on either:

~ Core exit thermocouples >1200 'F OR

~ Core exit thermocouples > 700 'F AND

~ RVLIS level < 43% w/ no RCPs (TAF) .

1-6

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The combination of these conditions (reactor power > 5% and Heat Sink-RED or Core Cooling RED path ) indicates the ultimate heat sink function is under extreme challenge. Additionally, the efforts to bring the reactor subcritical have been unsuccessful and, as a result, the reactor is producing more heat load for which the safety systems were designed. This situation could be the precursor for a core melt sequence.

A major consideration is the inability to initiallyremove heat during the early stages of this sequence. Ifemergency feedwater flow is insufficient to remove the amount of heat required by design from at least one steam generator, an extreme challenge should be considered to exist. This equates to a HEAT Sink RED condition. IfCETs indicate > 1200 'F or are > 700 'F with RVLIS < top of active fuel a condition indicative of severe challenge to heat removal also exists.

In the event this challenge exists at a time when the reactor has not been brought below the power associated with safety system design power (5%) a core melt sequence is considered to exist. In this situation, core degradation can occur rapidly. For this reason, the General Emergency declaration is intended to be anticipatory of the fission product barrier matrix declaration to permit maximum offsite intervention time.

PEG

Reference:

SG2.1 Basis Reference(s):

l. CSFST F-0.3, Heat Sink
2. CSFST F-0.1, Subcriticality
3. CSFST F-0.2, Core Cooling
3. FR-S.1, Response to Reactor Restart/ATWS 4 FR-S.2, Response to Loss of Core Shutdown 1-7

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.1 Site Area Emergency ORANGE or RED path in F-0.2, CORE COOLING 1%JMARC IC:

Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant ) 200 'F.

FPB loss/potential loss:

Fuel clad potential loss, RCS loss Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Core Cooling - ORANGE path is entered based on either:

~ Core exit thermocouples ) 700 'F OR

~ RVLIS level ( 43% w/ no RCPs (TAF)

Either condition indicates subcooling has been lost and that some clad damage may occur. It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier. Therefore a Site Area Emergency is warranted based upon the potential loss of fuel clad with loss of RCS barriers.

PEG

Reference:

FC1.2 FC3-.2 FC4.1 SS4.1 Basis Reference(s):

1. CSFST F-0.2, Core Cooling 1-8

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.2 Core Cooling 1.2.2 General Emergency RED path in F-0.2, CORE COOLING AND Functional restoration procedures not effective within 15 min.

NUINARC IC:

N/A FPB loss/potential loss:

Fuel clad los, S loss, Containment potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Core Cooling - RED path is entered based on either:

~ Core exit thermocouples > 1200 'F OR

~ Core exit thermocouples > 700 'F AND

~ RVLIS level < 43% (TAF)

Either condition indicates significant core exit superheating and core uncovery and is considered a loss of the Fuel Clad Barrier. It must also be assumed that the loss of RCS inventory is a result of a loss of RCS barrier.

These conditions, ifnot mitigated, will likely lead to core melt which will in turn result in a potential loss of containment. Therefore, declaration of a General Emergency is warranted.

Severe accident analyses (e. g., NUREG-1150) have concluded that function restoration procedures can arrest core degradation within the reactor vessel in a significant fraction of the core damage scenarios, and that the likelihood of containment failure is very small in these events. Given this, it is appropriate to provide a reasonable period to allow function restoration to arrest the core melt sequence. Whether or not procedures will 'rocedures be effective should be apparent within 15 minutes. The Emergency 1-9

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Coordinator should make the declaration as soon as it is determined that the procedures have not been, or will not be effective.

For the purpose of this EAL the term 'effective'ith regards to functional restoration procedures means that the CSFST Core Cooling - RED path entry criterion no longer exists.

PEG

Reference:

FC1.1 PC6.1 PC6.2 Basis Reference(s):

1. CSFST F-0.2, Core Cooling 1-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.3 Heat Sink 1.3.1 Site Area Emergency RED path in F-0.3, HEAT SINK NUINARC IC:

Complete loss of function needed to achieve or maintain hot shutdown with reactor coolant > 200 'F.

FPB loss/potential loss:

Fuel clad potential loss, RCS potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Heat Sink - RED path is entered based on both:

~ both S/0's narrow range level < 5%

AND

~ Total feedwater flow to S/Gs < 200 gpm The combination of these two conditions indicates the ultimate heat sink function is under extreme challenge. This EAL addresses loss of functions required for hot shutdown with the reactor at pressure and temperature.

Under these conditions, there is an actual major failure of a system intended for protection of the public with potential for multiple fission product barrier loss. Therefore, declaration of a Site Area Emergency is warranted.

PEG

Reference:

FC1.3 RCS1.2 SS4.1 Basis Reference(s):

1. 'SFST F-0.3, Heat Sink 1-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.4 Integrity 1.4.1 Alert RED path on F-0.4, INTEGRITY NU1VCARC IC:

N/A FPB loss/potential loss:

RCS potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Integrity - RED path is entered based on both:

~ exceeding RCS cooldown rate of 100 'F/hr AND

~ all RCS cold leg temperatures to the leR of the RCS Pressure/RCS Cold Leg Temperature Curve The combination of these'wo conditions indicates the RCS barrier is under significant challenge and should be considered a potential loss of RCS barrier.

Any loss or potential loss of RCS barrier warrants declaration of an Alert.

PEG

Reference:

RCS1.1 Basis Reference(s):

  • 1. CSFST F-0.4, Integrity 1-12

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 1.0 CSFST Status 1.5 Contaixunent 1.5.1 General Emergency RED path F-0.5, CONTAINMENT NUINARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power Operations, Hot Shutdown Basis:

CSFST Containment - RED path is entered based on exceeding containment design pressure of 60 psig. This pressure is well in excess of that expected from the design basis loss of coolant accident. This is indicative of a loss of both RCS and fuel clad boundaries in that it is not possible to reach this condition without severe core degradation (metal-water reaction) or failure to scram in combination with RCS breach. Since containment pressures at or approaching design levels is also a potential loss of containment,'this combination of conditions requires the declaration of a General Emergency.

PEG

Reference:

PC1.1 Basis Reference(s):

1. CSFST F-0.5, Containment 1-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor fuel cladding serves as the primary fission product barrier. Over the useful life of a fuel bundle, the integrity of this barrier should remain intact as long as fuel cladding integrity limits are not exceeded.

Should'fuel damage occur (breach of the fuel cladding integrity) radioactive fission products are released to the reactor coolant. The magnitude of such a release is dependent upon the extent of the damage as well as the mechanism by which the damage occurred. Once released into the reactor coolant, the highly, radioactive fission products can pose significant radiological hazards inplant from reactor coolant process streams. Ifother fission product barriers were to fail, these radioactive fission products can pose significant offsite radiological consequences.

The following parameters/indicators are indicative of possible fuel failures:

A g a i, t 1 fi product activity is very low. Small concentrations of fission products coolant are primarily from the fission of tramp uranium in the fuel in'he cladding or minor perforations in the cladding itself. Any significant increase from these base-line levels is indicative of fuel failures.

~ F il F l 0' As with coolant activity, any fuel failures will release fission products to the reactor coolant. These fission products will be circulated with the reactor coolant and be detected by the failed fuel radiation detector in the RCS letdown line.

i n Although not a direct indication or measurement of fuel damage, exceeding predetermined limits on containment high range radiation monitors under LOCA conditions is indicative possible fuel failures.

~ f lin A r i i nM ni r 'othareaand process radiation monitoring systems designed to detect fission products during refueling conditions as well as visual observation can be utilized to indicate loss or potential loss of spent fuel cladding integrity.

2-1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.1 Unusual Event Coolant sample activity:

)100% of 84/E bar p,Ci/cc total specific activity OR

> 0.2 p,Ci/gm I-131 equivalent and the conditions of Technical Specifications 3.1.4.3.b are exceeded NUINARC IC:

Fuel clad degradation FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.

This EAL addresses reactor coolant samples exceeding coolant technical specifications.

PEG

Reference:

SU4.2 Basis Reference(s):

1. Technical Specifications section 3.1.4 2-2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.2 Alert Coolant activity > 300 p.Ci/cc I-131 equivalent IMUIKARCIC:

N/A FPB loss/potential loss:

Fuel clad loss Mode Applicability:

Power operation, hot shutdown Basis:

Elevated reactor coolant activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.

This amount of coolant activity corresponds to about 2% to 5% fuel clad damage. When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.

Therefore, declaration of an Alert is warranted.

PEG

Reference:

FC2.1 Basis Reference(s):

None 2-3

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.1 Coolant Activity 2.1.3 Site Area Emergency Coolant activity > 300 pCi/cc I-131 equivalent and any of the following:

~ RED path on F-0.4, INTEGRITY

~ Primary system leakage > 46 gpm

~ RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage MMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS potential loss/loss Node Applicability:

Power operation, hot shutdown Basis:

This EAL addresses combinations of fuel clad loss with RCS loss and potential loss indicators.

300 pCi/cc I-131 equivalent coolant activity corresponds to about 2% to 5%

fuel clad damage. When reactor coolant activity reaches this level, significant clad heating has occurred and thus the fuel clad barrier is considered lost.

This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:

RED path on F-0.4, INTEGRITY: RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.

RCS subcooling < EOP Fig. MIN SUBCOOLING: This indicator addresses

'conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the .

fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage > 46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.

PEG

Reference:

FC2.1+ RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):

1. EPIP 16 "Core Damage Estimation"
2. CSFST F-0.4 Integrity
3. E-O, Reactor Trip or Safety Injection 4 Technical Specifications Section 3.1.5.2
5. FSAR Table 9.3.6 2-5

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.1 Unusual Event Letdown Line Monitor R-9 > 2 R/hr NUMARC IC:

Fuel clad degradation FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Elevated letdown line activity represents a potential degradation in the level of safety of the plant and a potential precursor of more serious problems.

This radiation level (2 H/hr) corresponds to 1% fuel failure (bases for the Technical Specifications coolant activity limits). Therefore, declaration of an Unusual Event is warranted.

PEG

Reference:

SU4.1 Basis Reference(s):

1. Technical Specifications section 3.1.4
2. P-9 "Radiation Monitoring System"
3. EPIP 2-16 section 6.2.l.b 2-6

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.2 Alert Letdown Line Monitor R-9 > 10 R/hr MMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss Mode Applicability:

Power operation, hot shutdown Basis:

This condition indicates the loss of the fuel clad barrier. Failed Fuel Monitor readings of 2 R/hr corresponds to 1% fuel failures. Failed Fuel Monitor readings of 10 R/hr corresponds to 5% fuel failures and is considered an actual loss of fuel clad.

Note: Monitor R-9 automatically shifts scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr.

PEG

Reference:

FC6.1 Basis Reference(s):

l. EPIP 16 "Core Damage Estimation"
2. P-9 "Radiation Monitoring System"
3. EPIP 2-16 section 6.2.1.b 2-7

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.2 Failed Fuel Detectors 2.2.3 Site Area Emergency Letdown Line Monitor R-9 > 10 8/hr and any of the following:

~ RED path on F-0.4, INTEGRITY

~ Primary system leakage > 46 gpm

~ RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage NUIKARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS potential loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses combinations of fuel clad. loss with RCS loss and potential loss indicators.

Failed Fuel Monitor readings of 10 R/hr corresponds to 5% fuel failures. This condition indicates the loss of the fuel clad barrier. Note: Monitor R-9 automatically shiRs scale from mR/hr to R/hr when indicated values exceed 1000 mR/hr. This condition in combination with any of the following RCS loss/potential loss indicators warrants declaration of a Site Area Emergency:

RED path on F-0.4, INTEGRITY: RED path indicates an extreme challenge to the safety function derived from appropriate instrument readings, and indicates a potential loss of RCS barrier.

RCS subcooling < EOP Fig. MIN SUBCOOLING: This indicator addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling as determined from E-O, Reactor Trip or Safety Injection is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Primary system leakage > 46 gpm: This potential loss of RCS is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.

PEG

Reference:

FC6.1+ RCS1.1, RCS2.1 and RCS2.2 Basis Reference(s):

1. EPIP 16 "Core Damage Estimation"
2. CSFST F-0.4 Integrity
3. E-O, Reactor Trip or Safety Injection 4 F-0.5, Containment
5. FR-Z.1, Response to High Containment Radiation Level
6. Technical Specifications Section 3.1.5.2
7. FSAR Table 9.3.6 2-9

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.1 Alert Containment radiation monitor R-29/R-30 reading ) 10 R/hr MB4ARC IC:

N/A FPB loss/potential loss:

RCS loss Mode Applicability:

Power operation, hot shutdown Basis:

Thel0 R/hr reading is a value which indicates the release of reactor coolant to the containment. The reading was derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with normal operating concentrations (i. e., within T/S) into the containment atmosphere. This EAL is indicative of a RCS leak only. Ifthe radiation monitor reading increased to that specified by Reactor Fuel EAL 2.3.2, significant fuel damage would also be indicated.

PEG

Reference:

RCS4.1 Basis Reference(s):

1. F-0.5, Containment
2. FR-Z.1, Response to High Containment Radiation Level
3. EPIP 2-16, Core Damage Estimation 2-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.2 Site Area Emergency Containment radiation monitor R-29/R-30 reading > 100 R/hr NUMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS loss Mode Applicability:

Power operation, hot shutdown Basis:

The 100 R/hr reading is a value which indicates the release of reactor coolant, with elevated activity indicative of fuel damage, into the containment. The reading is derived assuming the instantaneous release and dispersal of the reactor coolant noble gas and iodine inventory associated with a concentration of 300 p.Ci/gm dose equivalent I-131 into the containment atmosphere. Reactor coolant concentrations of this magnitude are several times larger than the maximum concentrations (including iodine spiking) allowed within technical specifications and are therefore indicative of fuel damage (approximately 2-5 % clad failure depending on core inventory and RCS volume). This value is higher than that specified in EAL 2.3.1 which would be indicative of only the RCS barrier. Thus, this EAL indicates a loss of both the fuel clad barrier and a loss of RCS barrier warranting declaration of a Site Area Emergency.

PEG

Reference:

FC5.1 Basis Reference(s):

1. P-9, Radiation Monitoring System, Section 2.2.2.6, pg. P-9:2
2. EPIP 2-16, Core Damage Estimation 2-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Containment Radiation 2.3.3 General Emergency Containment radiation monitor R-29/R-30 reading > 1000 R/hr NUINARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis:

The 1000 H/hr reading is a value which indicates significant fuel damage

(>20% clad failure) well in excess of the EALs associated with both loss of fuel clad and loss of RCS barriers. A major release of radioactivity requiring offsite protective actions from core damage is not possible unless a major failure of fuel cladding allows radioactive material to be released from the core into the reactor coolant. Regardless of whether containment is challenged, this amount of activity in containment, ifreleased, could have such severe consequences that it is prudent to treat this as a potential loss of containment, such that a General Emergency declaration is warranted.

NUREG-1228 "Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents," indicates that such conditions do not exist when the amount of clad damage is less than 20%.

PEG

Reference:

PC5.1 2-12

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. EPIP 1-0, Ginna Station Event Evaluation and Classification
2. EPIP 2-16, Core Damage Estimation
3. NUREG-1228 "Source Estimations During Incident Response to Severe Nuclear Power Plant Accidents" Technology for Energy Report No. R-81-012 2-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.1 Unusual Event Spent fuel pool (reactor cavity during refueling) water level cannot be restored and maintained above the spent fuel pool low water level alarm setpoint Nl3EIARC IC:

Unexpected increase in plant radiation or airborne concentration.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

In light of Reactor Cavity Seal failure, incidents at two different PWRs and loss of water in the Spent Fuel Pit/Fuel Transfer Canal at a BWR all occurring since 1984, explicit coverage of these types of events via EALs ¹1 and ¹2 is appropriate given their potential for increased doses to plant staK Classification as an Unusual Event is warranted as a precursor to a more serious event.

The spent fuel pool low water level alarm setpoint of 20 in. below top of pool is actuated by LC-661. The definition of "... cannot be restored and maintained above ..." allows the operator to visually observe the low water level condition, ifpossible, and to attempt water level restoration instructions as long as water level remains above the top of irradiated fuel. Water level restoration instructions for loss of refueling cavity water level during refueling are performed in accordance with the RF-65 series of procedures.

When the fuel transfer canal is directly connected to the spent fuel pool and reactor cavity, there could exist the possibility of uncovering irradiated fuel in the fuel transfer canal. Therefore, this EAL is applicable for conditions i' which irradiated fuel is being transferred to and from the RPV and spent fuel pool.

2-14 T

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

AU2.1 Basis Reference(s):

1. ER-SFP.1 "Loss of Spent Fuel Pit Cooling"
2. AR-K-29
3. RF-65 series 2-15

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel 2.3 Refueling Accidents or Other Radiation Monitors 2.4.2 Alert Confirmed sustained alarm on any of the following radiation monitors resulting from an uncontrolled fuel handling process:

~ R-2 Containment Area Monitor

~ R-5 Spent Fuel Pit

~ R-12 Containment Noble Gas NUMARC IC:

Major damage to irradiated fuel or loss of water level that has or willresult in the uncovering of irradiated fuel outside the reactor vessel.

FPB loss/potential loss:

N/A Mode Applicability:

All Basis:

NUREG-0818, "Emergency Action Levels for Light Water Reactors," forms the basis for this EAL. This EAL is defined by the specific area where irradiated fuel is located such as reactor cavity, reactor vessel, or spent fuel pool.

NUREG/CR-4982, "Severe Accident in Spent Fuel Pools in Support, of Generic Safety Issue 82," July 1987, indicates that even ifcorrective actions are not taken, no prompt fatalities are predicted, and that risk of injury is low. In addition, NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" presents the following in its discussion:

"In the event of a serious accident involving decayed spent fuel, protective actions would be needed for personnel on site, while offsite doses (assuming an exclusion area radius of one mile from the plant site) would be well below the Environmental Protecti'on Agency's Protective Action Guides. Accordingly, it is important to be able to properly survey and monitor for Kr-85 in the event of an accident with

'decayed spent fuel."

2-16

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 W

An "uncontrolled fuel handling process" is defined as any event or activity related to the movement of irradiated fuel which results in unexpected or uncontrolled conditions. This terminology has been specifically added to exclude anticipated increases in area radiation levels as a result of actions performed in accordance with approved procedures during refueling operations.

Thus, an Alert Classification for this event is appropriate. Escalation, if appropriate, would occur via Emergency Coordinator judgment in EAL Category 9.0.

The basis for the Containment Area Monitor setpoint (50 mR/hr) and Spent Fuel Pit monitor setpoint (25 mH/hr) are a spent fuel handling accident and is, therefore, appropriate for this EAL.

PEG

Reference:

AA2.1 Basis Reference(s):

1. P-9 Radiation Monitoring System
2. NUREG-0818, "Emergency Action Levels for Light Water Reactors,"
3. NUREG/CR-4982, "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" 2-17

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 2.0 Reactor Fuel '.3 Refueling Accidents or Other Radiation Monitors 2.4.3 Alert Report of visual observation of irradiated fuel uncovered MBCARC IC:

Major damage to irradiated fuel or loss of water level that has or will result in the uncovering of irradiated fuel outside the reactor vessel.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL is defined by the specific areas where irradiated fuel is located such as reactor cavity, or spent fuel pool.

There is no indication that water level in the spent fuel pool or refueling cavity has dropped to the level of the fuel other than by visual observation.

Since there is no level indicating system in the fuel transfer canal, visual observation of loss of water level would also be required.

SuQicient time exists to take corrective actions for these conditions and there is little potential for substantial fuel damage. NUREG/CR-4982 "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82" indicates that even ifcorrective actions are not taken, no prompt fatalities are predicted and the risk of injury is low. In addition, NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" presents the following it its discussion:

"In the event of a serious accident involving decayed spent fuel, protective actions would be n'ceded for personnel on site, while oQ'site doses (assuming an exclusion area radius of one mile from the plant site) would be well below the Environmental Protection Agency's Protective Action Guides. Accordingly, it is important to be able to properly survey 2-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 and monitor for Kr-85 in the event of an accident with decayed spent fuel.

Thus, an Alert Classification for this event is appropriate. Escalation, if appropriate, would occur via radioactivity release category 5.0 or Emergency Coordinator judgment in EAL Category 9.0.

This EAL applies to spent fuel requiring water coverage and is not intended to address spent fuel which is licensed for dry storage.

PEG

Reference:

AA2.2 Basis Reference(s):

1. P-9 Radiation Monitoring System
2. NUREG/CR-4982 "Severe Accident in Spent Fuel Pools in Support of Generic Safety Issue 82".

NRC Information Notice No. 90-08, "KR-85 Hazards from Decayed Fuel" 2-19

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The reactor vessel provides a volume for the coolant which covers the reactor core. The reactor vessel and associated pressure piping (reactor coolant system) together provide a barrier to limit the release of radioactive material should the reactor fuel cladding integrity fail.

There are three RCS parameters which are indicative of conditions which may pose a threat to RCS or fuel cladding integrity:

SCfLtlRR* (>>T l l 1ST 'fi tl )RCSl tg indications are utilized to indicate potential pipe cracks which may propagate to an extent threatening fuel clad, RCS and containment integrity. RCS leakage of a degree requiring ECCS to maintain RCS inventory poses a direct threat to fuel clad integrity. Reactor vessel water level is also directly related to the status of adequate core cooling, and therefore fuel cladding integrity.

n A subset of RCS leakage, excessive primary to secondary leakage in conjunction with unisolable secondary releases to environment may result in losses of containment integrity as well as threaten fuel clad integrity for more severe SG tube ruptures.

Al fRCS A ll gl f d t ll dl that the inventory control systems are inadequate in maintaining RCS pressure and inventory against mass loss through a leak.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.1 Unusual Event Unidentified or pressure boundary leakage > 10 gpm OR Identified leakage > 25 gpm NUMARC IC:

RCS leakage when greater than 200 'F FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

The conditions of this EAL may be a precursor of more serious conditions and, as a result, is considered to be a potential degradation of the level of safety of the plant. The 10 gpm value for the. unidentified leakage and pressure boundary leakage was selected because it is observable with normal Control Room indications. Smaller values must be determined through time-consuming surveillance tests (e. g., mass balances). The 25 gpm value for identified leakage is set at a higher value because of the significance of identified leakage in comparison to unidentified or pressure boundary leakage.

Only operating modes in which there is fuel in the reactor coolant system and the system is pressurized are specified.

PEG

Reference:

SU5.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.2 Alert Primary system leakage > 46 gpm MMARC IC:

N/A FPB loss/potential loss:

RCS potential loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header.

PEG

Reference:

RCS2.2 Basis Reference(s):

1. FSAR Table 9.3.6 3-3

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.1 RCS Leakage 3.1.3 Site Area Emergency RVLIS cannot be maintained > 43% with no RCPs running OR With the reactor vessel head removed, it is reported that water level in the reactor vessel is dropping in an uncontrolled manner and core uncovery is likely NUINARC IC:

Loss of reactor vessel water level has or will uncover fuel in the reactor vessel.

FPB loss/potential loss:

Fuel clad potential loss, RCS loss Mode Applicability:

Basis:

The reactor vessel water level used in this EAL is the top of active fuel (TAF).

This value corresponds to the level which is used in CSFSTs to indicate challenge to core cooling and loss of the fuel clad barrier. This is the minimum water level to assure core cooling without further degradation of the clad. Severe core damage can occur and reactor coolant system pressure boundary integrity may not be assured ifreactor vessel water level is not maintained above that corresponding to RVLIS at 43%. RVLIS dynamic range indications are not utilized in this EAL since the RCPs would not be running under conditions where vessel level is approaching TAF.

Thus, declaration of a Site Area Emergency is warranted under the conditions specified by this EAL. Escalation to a General Emergency would be via radioactivity release category 5.0.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

SS5.1 FC4.1 Basis Reference(s):

1. FR-C.1 "Response to Inadequate Core Cooling"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Reactor Coolant System 8.2 Primary to Secondary Leakage 8.2.1 Unusual Event Release of secondary side to atmosphere with primary to secondary leakage >

0.1 gpm per steam generator NUlVIARCIC:

N/A FPB loss/potential loss:

Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses SG tube leaks indicative of a loss of containment.

Secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed. by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL. For small leaks, not exceeding the normal charging capacity threshold in RCS leakage EAL 3.1.2, this EAL results in an Unusual Event. For larger leaks, RCS leakage EAL 3.2.2 would result in a Site Area Emergency. For SG tube ruptures which may involve multiple steam generators or unisolable secondary line breaks, SG tube rupture EAL 4.2.1 would also result in a Site Area Emergency.

PEG

Reference:

PC4.1 Basis Reference(s):

1. Technical Specifications Section 3.1.5.2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.2 Site Area Emergency Unisolable release of secondary side to atmosphere with primary to secondary leakage ) 46 gpm MMARC IC N/A FPB loss/potential loss:

RCS potential loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses SG tube leaks indicative of a loss of both RCS and containment barriers. Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL. Primary to secondary leakage ) 46 gpm is based on the inability to maintain normal liquid inventory within the Reactor Coolant System (RCS) by normal operation of the Chemical and Volume Control System which is considered as two positive displacement charging pumps discharging to the charging header. For primary to secondary leakage ) 46 gpm in the absence of any secondary to atmosphere release, an Alert would be declared based on EAL 3.1.2, This EAL represents the loss of both RCS and containment barriers and therefore warrants declaration of a Site Area Emergency.

PEG

Reference:

PC4.1+ RCS2.2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. Technical Specifications Section 3.1.5.2
2. E-3 "Steam Generator Tube Rupture"
3. FSAR Table 9.3.6

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.2 Primary to Secondary Leakage 3.2.3 Site Area Emergency Release of secondary side to atmosphere with primary to secondary leakage >

0.1 gpm per steam generator AND Coolant activity ) 300 pCi/cc of I-131 MMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses SG tube leaks indicative of a loss of containment in conjunction with a loss of fuel cladding. Unisolable secondary side releases to atmosphere include those from feed line or steam line breaks as well as stuck open safety or atmospheric relief valves that cannot be isolated once isolation has been directed by the EOPs. A steam generator which is required to be used for plant cooldown would also be covered under this EAL.

A coolant activity ) 300 pCi/cc of I-131 indicates a loss of fuel cladding. Refer to EAL N2.1.2 basis This condition represents a loss of both primary containment with the loss of fuel cladding and thus warrants declaration of a Site Area Emergency.

PEG

Reference:

PC4.1+ FC2.1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. Technical Specifications Section 3.1.4 3-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 3.0 Reactor Coolant System 3.3 RCS Subcooling 3.3.1 Alert RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage NUINARC IC:

N/A FPB loss/potential loss:

RCS loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses conditions where leakage from the RCS is greater than available inventory control capacity such that a loss of subcooling has occurred. The loss of subcooling is the fundamental indication that the inventory control systems are inadequate in maintaining RCS pressure and inventory against the mass loss through the leak.

Loss of the RCS barrier warrants declaration of an Alert.

PEG

Reference:

RCS2.1 Basis Reference(s):

1. E-O, Reactor Trip Or Safety Injection 3-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The containment structure is an atmospheric vapor containment system. It forms a Gssion product barrier designed to contain the radioactive fission products generated from any postulated accident so as to preclude exceeding offsite exposure limits.

The containment structure is a low leakage system housing the reactor vessel, the reactor coolant piping, steam generators and other branch connections of the reactor primary system. The containment is equipped with isolation valves for systems which penetrate the containment boundary.

These valves automatically actuate to isolate systems under emergency conditions.

There are three containment parameters which are indicative of conditions which may pose a threat to containment integrity or indicate degradation of RCS or reactor fuel clad integrity.

~ i n I Abnormally high containment pressure or failure of containment cooling systems following a LOCA are indicative of potential losses of the containment barrier integrity.

The existence of an unisolable CI or CVI line break outside containment constitutes a loss of containment integrity as well as a loss of RCS boundary. Inconsistent containment response to a known LOCA is also indicative of containment loss in conjunction with RCS barrier breach. Should a loss of fuel cladding integrity occur under either of these conditions, the potential for release of large amounts of radioactive materials to the environment exists.

m r wi h n 1 SGtube ruptures in conjunction with a secondary system line break resulting in release to the environment constitutes losses of both RCS and containment integrity.

Primary to secondary leakage in excess of Technical Specifications in conjunction with fuel clad damage and secondary system leakage to the environment constitutes losses of fuel clad, RCS and containment integrity. This condition provides the potential for release of large amounts of radioactive materials to the environment.

~ m i 1 n r The existence of combustible'gas concentrations in containment pose a severe threat to containment integrity and are indicative of severely degraded reactor core and RCS conditions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.1 Containment Integrity Status 4.1.1 Unusual Event Both doors open on containment airlock

. OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment NUMARC IC:

N/A FPB loss/potential loss:

Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses an indication that unambiguously indicates loss of the containment barrier under conditions when containment integrity is required.

It is important to note however, that loss of containment due to both airlock doors being open is event dependent. Upon recognition, shift personnel would rapidly respond in an attempt to reestablish containment integrity. Ifthe doors cannot be reclosed, any loss of the RCS barrier that occurs with the doors open would appear as an inconsistent LOCA response. Therefore, this event is not used as a definitive indicator of loss of the primary containment barrier for purposes of defining higher classification EALs. Rather it is left to the Emergency Coordinator's judgment whether such a loss has occurred.

'EG

Reference:

PC7.1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.1 Containment Integrity Status

/

4.1.2 Site Area Emergency 4

Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions MBMRC IC:

N/A FPB loss/potential loss:

RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

Rapid unexplained loss of pressure (i. e., not attributable to containment spray or Fan Cooling Units or condensation effects) following an initial pressure increase indicates a loss of both RCS and containment integrity.

Containment pressure and sump levels should increase as a result of th' mass and energy release into containment from a LOCA. Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.

This EAL indicates loss of both RCS and containment and therefore warrants declaration of a Site Area Emergency.

PEG

Reference:

PC2.1 PC2.2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. Alarm response procedure, AR-C-18, Revision 6
2. Alarm response procedure, AR-C-19, Revision 4
3. R. E. Ginna Updated FSAR, Figure 6.2-3 through 6.2-5

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.1 Containment Integrity Status 4.1.3 Site Area Emergency Either:

CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists MMARC IC:

N/A FPB loss/potential loss:

RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier and therefore warrants declaration of a Site Area Emergency.

Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier. Confirmation of a I OCA should be based on diagnostic activities consistent with E-0 "Reactor Trip or Safety Injection."

"Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment.

PEG

Reference:

PC3.1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. FR-2.1 "Response to High Containment Pressure"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment '4.l Containment Integrity Status 4.1.4 General Emergency Safety injection signal due to LOCA with less than minimum operable containment heat removal equipment, Table 4.3 AND Any indicators of fuel clad loss, Table 4.1 Table 4.3 Minimum 0 erable Containment Heat Removal E ui ment CNMT Pressure Recirc Fans 0 erable S ra Pum sRe uired

<28 psig N/A

>28 psig Table 4.1 Fuel Clad Loss Indicators

1. Coolant activity > 300 p.Ci/cc of I-131
2. Containment rad monitor R-29/R-30 reading >100 H/hr
3. Letdown Monitor R-9 reading > 10 H/hr
4. RED path in F-0.2, CORE COOLING MMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL represents a potential loss of containment in conjunction with losses of both RCS and fuel clad.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 A potential loss of containment is considered to exist in that the containment heat removaVdepressurization systems (e. g., containment sprays, Recirc.

Fans, but not including containment venting strategies) are either lost or performing in a degraded manner, as indicated by plant parameters such as containment pressure, pressurizer level and steam line pressure in excess of the setpoints at which the equipment was supposed to have actuated.

RCS is also assumed to be lost in this condition due to exceeding safety injection initiation setpoints: containment pressure ()4 psig) or low pressurizer (< 1723 psig).

Table 4.1 presents fuel clad loss indicators which represent 2 - 5% clad failures. Refer to EAL 0's 2.1.2, 2.2.2, and 2.3.2 for bases of these indicators.

PEG

Reference:

PC2.5+ FC2.1, FC5.1 and FC6.1 Basis Reference(s):

l. Technical Specifications, Table 3.5-4, pg. 3.5-17
2. R. E. Ginna UFSAR, Section 6.2.2.1.2.4, pg. 6.2-28
3. Technical Specifications, Article 5.2.1, pg. 5.2-1
4. FR-Z.1, Response to High Containment Pressure, Revision 3
5. R. E. Ginna UFSAR, Section 6.2.2.1, pg. 6.2-24b
6. R. E. Ginna UFSAR, Section 6.2.2.2, pg. 6.2-32 and Figure 6.2-11
7. EPIP 2-16, Core Damage Estimation
8. P-9, Radiation Monitoring System, Revision 67, Section 2.2.2.6, pg. P-9:2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.1 Containment Integrity Status 4.1.5 General Emergency Either:

Rapid uncontrolled decrease in containment pressure following initial increase OR Loss of primary coolant inside containment with containment pressure or sump level response not consistent with LOCA conditions AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Damage Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 pCi/cc of I-131 Containment rad monitor R-29/R-30 reading >100 Ehr Letdown Monitor R-9 reading > 10 R/hr MMARC IC:

N/A FPB loss/potential loss:

Fuel clad potential loss/loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.,

4-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Rapid unexplained loss of pressure (i. e., not attributable to containment spray or Fan Cooling Units or condensation effects) following an initial pressure increase indicates a loss of both RCS and containment integrity.

Containment pressure and sump levels should increase as a result of the mass and energy release into containment from a LOCA. Thus, sump level or pressure not increasing indicates containment bypass (V-sequence) and a loss of containment integrity.

Table 4.2 presents fuel clad loss and potential loss indicators:

~ ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL ¹1.1.1 basis

~ RED path in F-0.3, Heat Sink: Refer to EAL ¹1.2.1 basis Coolant activity > 300 p,Ci/cc of I-131: Refer to EAL ¹2.1.2 basis

~ Containment rad monitor reading >100 R/hr: Refer to EAL ¹2.3.2 basis

~ Letdown Monitor R-9 reading > 10 H/hr: Refer to EAL ¹2.2.2 basis PEG

Reference:

PC2.1/PC2.2+ FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

l. Alarm response procedure, AR-C-18, Revision 6
2. Alarm response procedure, AR-C-19, Revision 4
3. R. E. Ginna Updated FSAR, Figure 6.2-3 through 6.2-5 4 EPIP 2-16, Core Damage Estimation
5. CSFST F-0.2, Core Cooling, Revision 3
6. CSFST F-0.3, Heat Sink, Revision 3
7. FR-C.1, Response to Inadequate Core Cooling, Revision 7
8. FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a
9. FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3
10. P-9 "Radiation Monitoring System" 4-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.1 Containment Integrity Status 4.1.6 General Emergency Either:

CI or CVI valve(s) not closed when required following confirmed LOCA OR Inability to isolate any primary system discharging outside containment AND Radiological release pathway to the environment exists AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 p,Ci/cc of I-131 Containment rad monitor R-29/R-30 reading >100 R/hr Letdown Monitor R-9 reading > 10 R/hr MMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL indicates loss of both RCS and containment with loss or potential loss of the fuel cladding and therefore warrants declaration of a General Emergency.

Failure of CI or CVI valves to isolate is intended to address incomplete containment isolation that allows direct release to the environment. It represents a loss of both the RCS and containment barrier.

4-12

OSSI-92-402A-4-REG Ginna EAI Technical Bases Document, Rev 1 "Inability to isolate any primary system discharging outside containment" is intended to address other primary systems, either direct or indirect, which the inability to isolate indicate loss of both RCS and containment Table 4.2 presents fuel clad loss and potential loss indicators:

~ ORANGE path in F-0.2, Core Cooling: Refer to EAL ¹1.1.1 basis

~ RED path in F-0.3, Heat Sink: Refer to EAL ¹1.2.1 basis

~ Coolant activity > 300 pCi/cc of I-131: Refer to EAL ¹2.1.2 basis Containment rad monitor reading >100 R/hr: Refer to EAL ¹2.3.2 basis

~ Letdown Monitor R-9 reading > 10 H/hr: Refer to EAL ¹2.2.2 basis PEG

Reference:

PC3.1+ FC1.2, FC1.3, FC2.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

1. FR-2.1 "Response to High Containment Pressure"
2. CSFST F-0.2, "Core Cooling"
3. FR-C.l, "Response to Inadequate Core Cooling" 4 EPIP 2-16, Core Damage Estimation
5. CSFST F-0.2, Core Cooling, Revision 3
6. CSFST F-0.3, Heat Sink, Revision 3
7. FR-C.1, Response to Inadequate Core Cooling, Revision 7
8. FR;C.2, Response to Degraded Core Cooling, Revision 6, step 9.a
9. FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3
10. P-9 "Radiatio'n Monitoring System" 4-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Contaixunent 4.2 SG Tube Rupture w/ Secondary Release 4.2.1 Site Area Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" NMGQtC IC:

N/A FPB loss/potential loss:

RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL is intended to address the full spectrum of Steam Generator (SG) tube rupture events in conjunction with a loss of containment due to a significant secondary line break. This EAL addresses ruptured SG(s) with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier). This allows the direct release of radioactive fission and activation products to the environment. Resultant offsite dose rates are a function of many variables.

Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.

The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), ifavailable. This should include indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG. Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam, and/or SG sampling system. Determination of the "uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action. This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the affected SG 4-14

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 to the environment. This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.

PEG

Reference:

RCS3.1 Basis Reference(s):

1. E-3 "Steam Generator Tube Rupture" 4-15

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.2 SG Tube Rupture w/ Secondary Release 4.2.2 General Emergency Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" AND Any indicators of fuel clad damage, Table 4.2 Table 4.2 Fuel Clad Dama e Indicators ORANGE or RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 p.Ci/cc of I-131 Containment rad monitor R-29/R-30 reading >100 R/hr Letdown Monitor R-9 reading > 10 R/hr NUMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss/potential loss, RCS loss, Containment loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL is intended to address the full spectrum of Steam Generator (SG) tube rupture events in conjunction with a loss of containment due to a significant secondary line break with actual or potential loss of the fuel clad integrity. This EAL addresses ruptured SG(s) with an unisolable secondary line break corresponding to the loss of 2 of 3 fission product barriers (RCS barrier and containment barrier) with the actual or potential loss of the third (fuel cladding). This allows the direct release of radioactive fission and activation products to the environment. Resultant offsite dose rates are a function of many variables. Examples include: coolant activity, actual leak rate, SG carry over, iodine partitioning, and meteorology.

4-16

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The indications utilized should be consistent with the diagnostic activities of the emergency operating procedures (EOPs), ifavailable. This should include .

indication of reduction in primary coolant inventory, increased secondary radiation levels, and an uncontrolled or complete depressurization of the ruptured SG. Secondary radiation increases should be observed via radiation monitoring of condenser air ejector discharge, SG blowdown, main steam,

.and/or SG sampling system. Determination of the "uncontrolled" depressurization of the ruptured SG should be based on indication that the pressure decrease in the ruptured steam generator is not a function of operator action. This should prevent declaration based on a depressurization that results from an EOP induced cooldown of the RCS that does not involve the prolonged release of contaminated secondary coolant from the afFected SG to the environment. This EAL encompasses steam breaks, feed breaks, and stuck open safety or relief valves.

Table 4.2 presents fuel clad loss and p'otential loss indicators:

~ ORANGE or RED path in F-0.2, Core Cooling: Refer to EAL ¹1.1.1 basis

~ RED path in F-0.3, Heat Sink: Refer to EAL ¹1.2.1 basis

~ Coolant activity > 300 pCi/cc of I-131: Refer to EAL ¹2.1.2 basis

~ Containment rad monitor reading >100 R/hr: Refer to EAL ¹2.3.2 basis

~ Letdown Monitor R-9 reading > 10 R/hr: Refer to EAL ¹2.2.2 basis This condition represents a loss of both RCS and primary containment with the loss or potential loss of fuel cladding and thus warrants declaration of a General Emergency.

PEG

Reference:

RCS 3.1+ FC1.2, FC1.3, FC2.1, FC3.1, FC3.2, FC4.1, FC5.1 and FC6.1 Basis Reference(s):

1. Technical Specifications Section 3.1.5.2
2. EPIP 2-16, Core Damage Estimation
3. CSFST F-0.2, Core Cooling, Revision 3 4 CSFST F-0.3, Heat Sink, Revision 3
5. FR-C.1, Response to Inadequate Core Cooling, Revision 7
6. FR-C.2, Response to Degraded Core Cooling, Revision 6, step 9.a

'7. FR-C.2, Response to Degraded Core Cooling, Revision 6, Note, pg. 3

8. P-9 "Radiation Monitoring System" 4-17

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 4.0 Containment 4.3 Combustible Gas Concentrations 4.3.1 General Emergency

> 4% hydrogen concentration in containment MJMARC IC:

N/A FPB loss/potential loss:

Fuel clad loss, RCS loss, Containment potential loss Mode Applicability:

Power operation, hot shutdown Basis:

Existence of an explosive mixture (4 % hydrogen) means a hydrogen and oxygen concentration of at least the lower deflagration limit curve exists.

When hydrogen and oxygen concentrations reach or exceed the deflagration limits, imminent loss of the containment barrier exists. To generate such levels of combustible gas, loss of the fuel clad and RCS barriers must have occurred.

This EAL represents loss of both fuel clad and,RCS with the potential loss of containment and therefore warrants declaration of a General Emergency.

PEG

Reference:

PC2.4 Basis Reference(s):

1. FR-Z.1 "Response to High Containment Pressure" 4-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Many EALs are'ased on actual or potential degradation of fission product barriers because of the increased potential for oÃsite radioactivity release.

Degradation of fission product barriers though, is not always apparent via non-radiological symptoms. Therefore, direct indication of increased radiological effluents or area radiation levels are appropriate symptoms for emergency classification.

At lower levels, abnormal radioactivity releases may be indicative of a failure of containment systems or precursors to more significant releases. At higher release rates, offsite radiological conditions may result which require offsite protective actions. Increased area radiation levels in plant may also be

'i indicative of the failure of containment systems or preclude access to plant vital equipment necessary to ensure plant safety.

There are two basic indications of radioactivity release rates and one for area radiation levels which warrant emergency classifications.

Di iii ii f Bl i ii systems provides a rapid assessment mechanism to determine releases

'g in excess of classifiable limits.

P Projected offsite doses (based on effluent monitor readings) or actual offsite field measurements indicating doses or dose rates above classifiable limits.

Sustained general area radiation levels in excess of those indicating loss of control of radioactive materials or those levels which may preclude access to vital plant areas also warrant emergency classification.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.1 Effluent Monitors 5.1.1 Unusual Event

)

A valid reading on any monitors Table 5.1 column "NUE" for 60 min. unless sample analysis can confirm release rates < 2 x technical specifications within this time period.

Table 5.1 Effluent Monitor Classification Thresholds Monitor NUE Alert R-11 1.62E6 cpm N/A N/A N/A R-12 7.80E6 cpm 1.07E7 cpm N/A N/A R-13 2.20E4 cpm N/A N/A N/A R-14 6.40E5 cpm 1.61E6 cpm N/A N/A R-15 4.00E5 cpm 2.31E7 cpm N/A N/A R-18 3.60E5 cpm offscale hi N/A N/A R-12A(7/9) N/A N/A 6.00 p,Ci/cc 60.00 pCi/cc R-14A(7/9) N/A N/A 0.533 p,Ci/cc 5.33 p,Ci/cc R-15 A(7/9) N/A N/A 11.50 pCi/cc 115.00 p,Ci/cc R-31/32 1 ARV N/A 1.900 mR/hr 19.0 mR/hr 190 mR/hr 1 Safety N/A 0.951 mR/hr 9.51 mR/hr 95.1 mRhr 2 Safety N/A 0.476 mR/hr 4.76 mR/hr 47.6 m R/hr 3 Safety N/A 0.317 mR/hr 3.17 mR/hr 31.7 mR/hr 4 Safety N/A 0.238 mR/hr 2.38 mR/hr 23.8 mR/hr NU1KARC IC:

Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.

FPB loss/potential loss:

N/A Mode Applicability:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis:

The "value shown" for each monitor is two times the calculated Technical Specification release rates as specified in P-9 section 2.4.

Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. The final integrated dose (which is very low in the Unusual Event emergency class) is not the primary concern here; it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes. Therefore, it is not intended that the release be averaged over 60 minutes. For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.

Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes.

Monitor indications are calculated on the basis of the methodology of the site Offsite Dose Calculation Manual (ODCM). Annual average meteorology is used.

Valid means that a radiation monitor reading has been confirmed by the operators to be correct.

PEG

Reference:

AU1.1 Basis Reference(s):

1. EPIP 2-3 Emergency Release Rate Determination
2. P-9 Radiation Monitoring System
3. EPIP 2-18 Control Room Dose Assessment
4. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
5. "Calculations for NU)~C EALs" by P.S. Polfleit File EAL.XLS
6. RD-15.0 ODCM 5.3

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.1 Effluent Monitors 5.1.2 Alert

.A valid reading on any monitors Table 5.1 column "Alert" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "Alert" within this time period.

Table 5.1 EfQuent Monitor Classification Thresholds Monitor NUE QE, R-11 1.62E6 cpm N/A N/A N/A R-12 7.80E6 cpm 1.07E7 cpm N/A N/A R-13 2.20E4 cpm N/A N/A N/A R-14 6.40E5 cpm 1.61E6 cpm N/A N/A R-15 4.00E5 cpm 2.31E7 cpm N/A N/A R-18 3.60E5 cpm offscale hi N/A N/A R-12 A(7/9) N/A N/A 6.00 pCi/cc 60.00 pCi/cc R-14A(7/9) N/A N/A 0.533 pCi/cc 5.33 pCi/cc R-15 A(7/9) N/A N/A 11.50 pCi/cc 115.00 pCi/cc R-31/32 1 ARV N/A 1.900 mR/hr 19.0 mEVhr 190 mR/hr 1 Safety N/A 0.951 mR/hr 9.51 mR/hr 95.1 mRhr 2 Safety N/A 0.476 mR/hr 4.76 mR/hr 47.6 m R/hr 3 Safety N/A 0.317 mR/hr 3.17 mR/hr 31.7 mR/hr 4 Safety N/A 0.238 mR/hr 2.38 mR/hr 23.8 mR/hr Table 5.2 Dose Projection/ Env. Measurement Classification Thresholds TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mR/hr 100 mR/hr 1000 mR/hr CDE Thyroid rate N/A 500 mR/hr 5000 mR/hr

0 OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUINARC IC:

Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This event escalates from the Unusual Event by escalating the magnitude of the release by a factor of 100. Prorating the 500 mR/yr criterion for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr. The required release duration was reduced to 15 minutes in recognition of the increased severity.

Monitor indications are calculated on the basis of the methodology of the EPIP 2-18 Control Room Dose Assessment. Annual average meteorology is used.

As previously stated; the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits, rounded down to 10 mR/hr. The values for the gaseous effluent radiation monitors are based upon not exceeding 10 mR/hr at the site boundary as a result of the release.

The conversion factors are based upon the mixture of noble gas present in reactor coolant during the V25/82 tube rupture - normal operations.

Since there is no high range monitor associated with liquid e6luent monitor R-18 and the 200x Technical Specification value is beyond it's upper scale, an indication of "offscale hi" is conservatively used.

Valid means that a radiation monitor reading has been confirmed by the operators to be correct.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AA1.1 Basis Reference(s):

1. EPIP 2-3 Emergency Release Rate Determination
2. P-9 Radiation Monitoring System
3. EPIP 2-18 Control Room Dose Assessment 4 Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3
5. "Calculations for NUMARC EALs" by P.S. Polfleit File EAL.XLS

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.1 Effluent Monitors 5.1.3 Site Area Emergency A valid reading on any monitors Table 5.1 column "SAE" for ) 15 min. unless dose assessment can confirm releases are below Table 5.2 column "SAE" within this time period.

Table 5.1 EfHuent Monitor Classification Thresholds Monitor Alert R-11 1.62E6 cpm N/A N/A N/A R-12 7.80E6 cpm 1.07E7 cpm N/A N/A R-13 2.20E4 cpm N/A N/A N/A R-14 6.40E5 cpm 1.61E6 cpm N/A N/A R-15 4.00E5 cpm 2.31E7 cpm N/A N/A R-18 3.60E5 cpm offscale hi N/A N/A R-12A(7/9) N/A N/A 6.00 pCi/cc 60.00 pCi/cc R-14A(7/9) N/A N/A 0.533 pCi/cc 5.33 pCi/cc R-15 A(7/9) N/A N/A 11.50 p,Ci/cc 115.00 pCi/cc R-31/32 1 ARV N/A 1.900 mR/hr 19.0 mR/hr 190 mR/hr 1 Safety N/A 0.951 mR/hr 9.51 mR/hr 95.1 mRhr 2 Safety N/A 0.476 mR/hr 4.76 mR/hr 47.6 m R/hr 3 Safety N/A 0.317 mR/hr 3.17 mR/hr 31.7 mEUhr 4 Safety N/A 0.238 mR/hr 2.38 mR/hr 23.8 mR/hr Table 5.2 Dose Projection/ Env. Measurement Classification Thresholds Alert TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mR/hr 100 mR/hr 1000 mR/hr CDE Thyroid rate N/A 500 mR/hr 5000 mR/hr

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 MBCARC IC:

Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

The values shown were determined utilizing EPIP 2-18 "Control Room Dose Assessment" based upon a 100 mR whole body exposure. The calculations made the assumption of neutral stability and an 8 mph wind speed. These conditions represent annual average meteorology. The most restrictive x/Q values at the 0 - 0.5 mile distance were used. EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of 1E-4.

The 100 mR integrated dose is based on the proposed 10CFR20 annual average population exposure. This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes. It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class description. The 500 mR integrated child thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid.

Integrated doses are generally not monitored in real-time. In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 100 mR/hour whole body or 500 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).

Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.

Valid means that a radiation monitor reading has been con6rmed by the operators to be correct.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AS1.1 Basis Reference(s):

1. P-9 Radiation Monitoring System
2. EPIP 2-18 Control Room Dose Assessment
3. FSAR Table 2.3 4 "Calculations for MJMARC EALs" by P.S. Polfleit File EAL.XLS
5. RD-15.0 ODCM Tables 3, 5 and 7

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.1 EQ1uent Monitors 5.1.4 General Emergency A valid reading on any monitors Table 5.1 column "GE" for > 15 min. unless dose assessment can confirm releases are below Table 5.2 column "GE" within this time period.

Table 5.1 EfQuent Monitor Classification Thresholds Monitor NUE Alert R-11 1.62E6 cpm N/A N/A N/A R-12 7.80E6 cpm 1.07E7 cpm N/A N/A R-13 2.20E4 cpm N/A N/A N/A R-14 6.40E5 cpm 1.61E6 cpm N/A N/A R-15 4.00E5 cpm 2.31E7 cpm N/A N/A R-18 3.60E5 cpm offscale hi N/A N/A R-12A(7/9) N/A N/A 6.00 pCi/cc 60.00 pCi/cc R-14A(7/9) N/A N/A 0.533 p,Ci/cc 5.33 pCi/cc R-15 A(7/9) N/A N/A 11.50 pCi/cc 115.00 pCi/cc R-31/32 1 ARV N/A 1.900 mR/hr 19.0 mR/hr 190 mEUhr 1 Safety N/A 0.951 mR/hr 9.51 mR/hr 95.1 mRhr 2 Safety N/A 0.476 mR/hr 4.76 mR/hr 47.6 m R/hr 3 Safety N/A 0.317 mR/hr 3.17 mR/hr 31.7 mR/hr 4 Safety N/A 0.238 mR/hr 2.38 mR/hr 23.8 mR/hr Table 5.2 Dose Projection / Env. Measurement Classification Thresholds TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mR/hr 100 mR/hr 1000 mR/hr CDE Thyroid rate N/A 500 mR/hr 5000 mR/hr 5-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NUIVCARC IC:

Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

The values shown were determined utilizing EPIP 2-18 "Control Room Dose Assessment" based upon a 1000 mR whole body exposure. The calculations made the assumption of neutral stability and an 8 mph wind speed. These conditions represent annual average meteorology. EPIP 2-18 specifies that whole body dose is limiting with respect to emergency classification and protective action recommendations based upon the assumption of a noble gas to iodine ratio of lE-4.

The 1000 mR whole body and the 5000 mR child thyroid integrated dose are based on the EPA protective action guidance which indicates that public protective actions are indicated ifthe dose exceeds 1 rem whole body or 5 rem child thyroid. This is consistent with the emergency class description for a General Emergency. This level constitutes the upper level of the desirable gradient for the Site Area Emergency.

Integrated doses are generally not monitored in real-time. In establishing the emergency action levels, a duration of one hour is assumed, based on a site boundary dose of 1000 mR/hour whole body or 5000 mR/hour child thyroid, whichever is more limiting (depends on source term assumptions).

Although EPIP 2-18 provides for R-3V32 release determinations, the variability of results based upon the number of ARV's and/or SV's precludes the use of any single monitor default value for these monitors.

Valid means that a radiation monitor reading has been, con6rmed by the operators to be correct.

5-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AG1.1 Basis Reference(s):

l. P-9'Radiation Monitoring System
2. EPIP 2-18 Control Room Dose Assessment
3. FSAR Table 2.3 4 "Calculations for MV~C EALs" by P.S. PolQeit File EAL.XLS 5-12

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.2 Dose Projections/ Environmental Measurements/Release Rates 5.2.1 Unusual Event Confirmed sample analyses for gaseous or liquid release rates > 2 x technical specifications limits for > 60 min.

NUINARC IC:

Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds two times the radiological Technical Specifications for 60 minutes or longer.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Unplanned releases in excess of two times the site technical specifications that continue for 60 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. The final integrated dose (which is very low in the Unusual Event emergency class) is not the primary concern here; it is the degradation in plant control implied by the fact that the release was not isolated within 60 minutes. Therefore, it is not intended that the release be averaged over 60 minutes. For example, a release of 4 times T/S for 30 minutes does not exceed this initiating condition.

Further, the Emergency Coordinator should not wait until 60 minutes has elapsed, but should declare the event as soon as it is determined that the release duration has or will likely exceed 60 minutes PEG

Reference:

AU1.2 5- 13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):,

1. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3 5-14

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.2 Dose Projections/ Environmental Measurements/ Release Rates 5.2.2 Alert Confirmed sample analyses for gaseous or liquid release rates ) 200 x technical specifications limits for > 15 min.

NUINARC IC:

Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Confirmed sample analyses in excess of two hundred times the site technical specifications that continue for 15 minutes or longer represent an uncontrolled situation and hence, a potential degradation in the level of safety. This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i. e.,

200 times Technical Specifications). Prorating the 500 mR/yr basis of the 10CFR20 non-occupational MPC limits for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr. The required release duration was reduced to 15 minutes in recognition of the increased severity.

PEG

Reference:

AA1.2 5-15

OSSI-92-402A-4-RE G Ginna EAL Technical Bases Document, Rev 0 Basis Reference(s):

1. Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3 5-16

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.2 Dose Projections/ Environmental Measurements/ Release Rates 5.2.3 Alert Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates > Table 5.2 column "Alert" at the site boundary or beyond.

Table 5.2 Dose Projection / Env. Measurement Classification Thresholds Alert TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mB/hr 100 mR/hr 1000 mH/hr CDE Thyroid rate N/A 500 mR/hr 5000 mR/hr NUMARC IC:

Any unplanned release of gaseous or liquid radioactivity to the environment that exceeds 200 times radiological Technical Specifications for 15 minutes or longer FPB loss/potential loss:

N/A Mode Applicability:

Basis.

Offsite integrated doses in excess of 10 mR TEDE or dose rates in excess of 10 mR/hr TEDE represent an uncontrolled situation and hence, a potential degradation in the level of safety. This event escalates from the Unusual Event by increasing the magnitude of the release by a factor of 100 over the Unusual Event level (i. e., 200 times Technical Specifications). Prorating the 5-17

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 500 mR/yr basis of 10CFR20 for both time (8766 hr/yr) and the 200 multiplier, the associated site boundary dose rate would be 10 mR/hr.

As previously stated, the 10 mR/hr value is based on a proration of 200 times the 500 mR/yr basis of 10CFR20, rounded down to 10 mR/hr.

PEG

Reference:

AA1.2 Basis Reference(s):

Technical Specifications, Amendment No. 24, Article's 3.9.1.1 thru 3.9.2.3

2. EPIP 2-3 Emergency Release Rate Determination
3. P-9 Radiation Monitoring System 4 EPIP 2-18 Control Room Dose Assessment 5-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.2 Dose Projections/ Environmental Measurements/ Release Rates 5.2.4 Site Area Emergency Dose projections or field surveys resulting from actual or imminent release which indicate doses / dose rates > Table 5.2 column "SAE" at the site boundary or beyond.

Table 5.2 Dose Projection / Env. Measurement Classification Thresholds TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mR/hr 100 mH/hr 1000 mH/hr CDE Thyroid rate N/A 500 mH/hr 5000 mH/hr NUINARC IC:

Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 100 mRem TEDE or 500 mR CDE Thyroid for the actual or projected duration of the release.

FPB loss/potential loss:

N/A Mode Applicability:

'Basis:

The 100 mR integrated TEDE dose in this EAL is based on the proposed 10CFR20 annual average population exposure. This value also provides a desirable gradient (one order of magnitude) between the Alert, Site Area Emergency, and General Emergency classes. It is deemed that exposures less than this limit are not consistent with the Site Area Emergency class 5-19

OSSI-92-402A-4-BEG Ginna EAL Technical Bases Document, Rev 0 description. The 500 mR integrated CDE thyroid dose was established in consideration of the 1:5 ratio of the EPA Protective Action Guidelines for whole body thyroid. In establishing the dose rate emergency action levels, a duration of one hour is assumed. Therefore, the dose rate EALs are based on a site boundary dose rate of 100 mR/hr TEDE or 500 mRlhr CDE thyroid, whichever is more limiting.

PEG

Reference:

AS1.3 AS1.4 Basis Reference(s):

Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3

2. EPIP 2-3 Emergency Release Rate Determination
3. P-9 Radiation Monitoring System EPIP 2-18 Control Room Dose Assessment t

5-20

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.2 Dose Projections/ Environmental Measurements/ Release Rates 5.2.5 General Emergency Dose projections or field surveys resulting Rom actual or imminent release which indicate doses / dose rates > Table 5.2 column "GE" at the site boundary or beyond.

Table 5.2 Dose Pro ection / Env. Measurement Classification Thresholds Alert TEDE 10 mR 100 mR 1000 mR CDE Thyroid N/A 500 mR 5000 mR TEDE rate 10 mH/hr 100 mH/hr 1000 mH/hr CDE Thyroid rate N/A 500 mR/hr 5000 mH/hr NUIHARC IC Boundary dose resulting from an actual or imminent release of gaseous radioactivity exceeds 1000 mRem TEDE or 5000 mR CDE Thyroid for the actual or projected duration of the release using actual meteorology.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

The General Emergency values of Table 5.2 are based on the boundary dose resulting from an actual or imminent release of gaseous radioactivity that exceeds 1000 mR TEDE or 5000 mR CDE thyroid for the actual or projected duration of the release. The 1000 mR TEDE and the 5000 mR CDE thyroid integrated dose are based on the EPA protective action guidance which 5-21

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 indicates that public protective actions are indicated ifthe dose exceeds 1 rem TEDE or 5 rem CDE thyroid. This is consistent with the emergency class description for a General Emergency. This level constitutes the upper level of the desirable gradient for the Site Area Emergency. Actual meteorology is specifically identified since it gives the most accurate dose assessment.

Actual meteorology (including forecasts) should be used whenever possible.

In establishing the dose rate emergency action levels, a duration of one hour is assumed. Therefore, the dose rate EALs are based on a site boundary dose rate of 1000 mR/hr TEDE or 5000 mR/hr CDE thyroid, whichever is more limiting.

PEG

Reference:

AG1.3 AG1.4

~

Basis Reference(s):

Technical Specifications, Amendment No. 24, Articles 3.9.1.1 thru 3.9.2.3

2. EPIP 2-3 Emergency Release Rate Determination
3. P-9 Radiation Monitoring System 4 EPIP 2-18 Control Room Dose Assessment 5-22

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.3 Area Radiation Levels 5.3.1 Unusual Event Any sustained direct ARM readings > 100 x alarm or offscale hi resulting from an uncontrolled process MMARC IC:

Unexpected increase in plant radiation or airborne concentration.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Valid elevated area radiation levels usually have long lead times relative to the potential for radiological release beyond the site boundary, thus impact to public health and safety is very low. It should be noted that the CAS and SAS do not have installed radiation monitors. Therefore, evaluation of this EAL would require survey of these areas.

This EAL addresses unplanned increases in radiation levels inside the plant.

These radiation levels represent a degradation in the control of radioactive material and a potential degradation in the level of safety of the plant. Area radiation levels above 100 times the alarm setpoint have been selected because they are readily identifiable on ARM instrumentation. Since ARM setpoints are nominally set one decade over normal levels, 100 times the alarm setpoint provides an appropriate threshold for emergency classification. For those ARMs whose upper range limit are less than 100 times the alarm setpoint, a value of offscale high is used. This EAL escalates if to an Alert, the increases impair the level of safe plant operation.

0 0

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 PEG

Reference:

AU2.4

. Basis Reference(s):

None 5-24

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.3 Area Radiation Levels 5.3.2 Alert Sustained area radiation levels ) 15 ma/hr in either:

Control Room OR Central Alarm Station and Secondary Alarm Station IVUMARCIC:

Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses increased radiation levels that impede necessary access to operating stations requiring continuous occupancy to maintain safe plant operation or perform a safe plant shutdown. Areas requiring continuous occupancy include the Control Room, the central alarm station (CAS) and the secondary security alarm station (SAS). The security alarm stations are included in this EAL because of their importance to permitting access to areas required to assure safe plant operations.

The value of 15 mR/hr is derived from the GDC 19 value of 5 rem in 30 days with adjustment for expected occupancy times. Although Section III.D.3 of NUREG-0737, "Clarification of TMI Action Plan Requirements", provides that the 15 mR/hr value can be averaged over the 30 days, the value is used here without averaging. A 30 day duration implies an event potentially more significant than an Alert.

5-25

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant. The cause or magnitude of the increase in radiation levels is not a concern of this EAL.

The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine ifany other EALs may be involved.

For example, a dose rate of 15 mR/hr in the Control Room may be a problem in itself. However, the increase may also be indicative of high dose rates in the containment due to a LOCA. In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.

This EAL is not intended to apply to anticipated temporary radiation increases due to planned events (e. g., radwaste container movement, depleted resin transfers, etc.).

PEG

Reference:

AA3.1 Basis Reference(s):

1. GDC 19
2. NUREG-0737, "Clari6cation of TMI Action Plan Requirements",

Section III.D.3

3. P-9 Radiation Monitoring System Rev. 67 5-26

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 5.0 Radioactivity Release / Area Radiation 5.3 Area Radiation Levels 5.3.3 Alert Sustained abnor mal area radiation levels > 8 R/hr within any areas, Table 5.3 AND Access is required to establish or maintain cold shutdown.

Table 5.3 Plant Areas

~ Reactor Containment Building

~ Auxiliary Building

~ Turbine Building

~ Emergency Diesel Building

~ Screen House

~ Standby Auxiliary Feedwater Building NUMARC IC:

Release of radioactive material or increases in radiation levels within the facility that impedes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses increased radiation levels in areas requiring infrequent access in order to maintain safe plant operation or perform a safe plant shutdown. Area radiation levels at or above 8 H/hr are indicative of radiation fields which may limit personnel access or adversely affect equipment whose operation may be needed to assure adequate core cooling or shutdown the reactor. The basis of the value is described in NMPC memo File Code 5-27

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 0 NMP31027 "Exposure Guidelines For Unusual/Accident Conditions". The areas selected are consistent with those listed in other EALs and represent those structures which house systems and equipment necessary for the safe operation and shutdown of the plant.

It is the impaired ability to operate the plant that results in the actual or potential degradation of the level of safety of the plant. The cause or magnitude of the increase in radiation levels is not a concern of this EAL.

The Emergency Coordinator must consider the source or cause of the increased radiation levels and determine ifany other EAL may be involved.

For example, a dose rate of 8 R/hr may be a problem in itself. However, the increase may also be indicative of high dose rates in the containment due to a LOCA. In this latter case, a Site Area Emergency or a General Emergency may be indicated by other EAL categories.

This EAL is not meant to apply to increases in the containment radiation monitors as these are events which are addressed in other EALs. Nor is it intended to apply to anticipated temporary radiation increases due to planned events (e. g., radwaste container movement, deplete resin transfers, etc.).

PEG

Reference:

AA3.2 Basis Reference(s):

1. Niagara Mohawk Power Corporation memo File Code NMP31027 "Exposure Guidelines For UnusuaVAccident Conditions", Revision 1, 3/18/93 5-28

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Loss of vital plant electrical power can compromise plant safety system operability including decay heat removal and emergency core cooling systems which may be necessary to ensure fission product barrier integrity.

The events of this category have been grouped into the following two loss of electrical power types:

A P r 'his category includes losses of onsite and/or o6'site AC power sources including station blackout events.

fD P r 'his category involves total losses of vital plant 125 vdc power sources.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.1 Unusual Event Loss of ability to supply power to the safeguard buses from offsite circuits 751 and 767 for > 15 min.

NUINARC IC:

Loss of all offsite power to essential busses for greater than 15 minutes.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

Prolonged loss of all oFsite AC power reduces required redundancy and potentially degrades the level of safety of the plant by rendering the plant more vulnerable to a complete loss of AC power (station blackout). Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.

PEG

Reference:

SU1.1 Basis Reference(s):

1. RGE-6 "4160V Electrical Distribution System"
2. RGE-7 "480V Distribution "

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.2 Alert Loss of'all safeguards bus AC power for > 15 min.

NUlKARC IC:

Loss of all offsite power and loss of all onsite AC power to essential busses during cold shutdown, refueling or defueled mode.

FPB loss/potential loss:

N/A Mode Applicability:

Cold Shutdown, Refueling, Defueled Basis:

Loss of all AC power compromises all plant safety systems requiring electric power. This EAL is indicated by: loss of all o6'site AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes. When in cold shutdown, refueling, or defueled mode the event can be classified as an Alert, because of the signi6cantly reduced decay heat, lower temperature and pressure, increasing the time to restore one of the emergency busses, relative to that speci6ed for the Site Area Emergency EAL. Escalating to the Site Area Emergency, ifappropriate, is by Abnormal Rad Levels/Radiological EfHuent, or Emergency Coordinator Judgment ICs. Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.

PEG

Reference:

SA1.1 Basis Reference(s):

1. RGE-6 "4160V Electrical Distribution System"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.3 Alert Available safeguard train AC power reduced to only one of the following for >

15 min.:

~ EDG 1A (14/18)

~ EDG 1B (16/17)

~ Station Auxiliary Transformer 12A

~ Station Auxiliary Transformer 12B 1%JMARC IC:

AC power capability to essential busses reduced to a single power source for greater than 15 minutes such that any additional single failure would result in station blackout with reactor coolant > 200 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

The condition indicated by this EAL is the degradation of the offsite power with a concurrent failure of one emergency generator to supply power to its emergency busses. Another related condition could be the loss of all oFsite power and loss of onsite emergency diesels with only one train of emergency busses being fed from the unit main generator, or the loss of onsite emergency diesels with only one train of emergency busses being fed from offsite power. The subsequent loss of this single power source would escalate the event to a Site Area Emergency.

PEG

Reference:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. RGE-6 "4160V Electrical Distribution"
2. RGE-7 "480v Distribution"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.4 Site Area Emergency Loss of all safeguards bus AC power for > 15 min.

NUINARC IC:

Loss of all offsite power and loss of all onsite AC power to essential busses with reactor coolant > 200 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

Loss of all AC power compromises all plant safety systems requiring electric power. This EAL is indicated by: loss of all offsite AND onsite AC power to safeguards buses 14/18 AND 16/17 for greater than 15 minutes. Prolonged loss of all AC power will cause core uncovery and loss of containment integrity, thus this event can escalate to a General Emergency. The time duration should be selected to exclude transient or momentary power losses, but should not exceed 15 minutes.

PEG

Reference:

SS1.1 Basis Reference(s):

1. RGE-6 "4160V Electrical Distribution"
2. RGE-7 "480v Distribution"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.1 Loss of AC Power Sources 6.1.5 General Emergency Loss of all safeguards bus AC power AND either:

Power restoration to any safeguards bus is not likely in 5 4 hrs OR Actual or imminent entry into ORANGE or RED path on F-0.2, "CORE COOLING" NUMARC IC:

Prolonged loss of all offsite power and prolonged loss of all onsite AC power with reactor coolant > 200 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

Loss of all AC power compromises all plant safety systems requiring electric power. Prolonged loss of all AC power will lead to loss of fuel clad, RCS, and containment. Although this EAL may be viewed as redundant to the RPV Water Level EALs, its inclusion is necessary to better assure timely recognition and emergency response.

This EAL is specified to assure that in the unlikely event of prolonged station blackout, timely recognition of the seriousness of the event occurs and that declaration of a General Emergency occurs as early as is appropriate, based on a reasonable assessment of the event trajectory.

The likelihood of restoring at least one emergency bus should be based on a realistic appraisal of the situation since a delay in an upgrade decision based on only a chance of mitigating the event could result in a loss of valuable time in preparing and implementing public protective actions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 In addition, under these conditions, fission product barrier monitoring capability may be degraded. Although it may be difBcult to predict when power can be restored, the Emergency Coordinator should declare a General Emergency based on two major considerations:

1. Are there any present indications that core cooling is already degraded to the point that Loss or Potential Loss of fission product barriers is imminent?
2. Ifthere are no present indications of such core cooling degradation, how likely is it that power can be restored in time to assure that a loss of two barriers with a potential loss of the third barrier can be prevented?

Thus, indication of continuing core cooling degradation must be based on fission product barrier monitoring with particular emphasis on Emergency Coordinator judgment as it relates to imminent loss or potential loss of fission product barriers and degraded ability to monitor fission product barriers.

The time to restore AC power is based on site blackout coping analysis performed in conformance with 10CFR50.63 and Regulatory Guide 1.155, "Station Blackout", with appropriate allowance for offsite emergency response.

PEG

Reference:

SG1.1 Basis Reference(s):

1. F-0.2, "CORE COOLING,"
2. NRC letter to Dr. Mecredy dated V30/92 "RE Ginna Nuclear Power Plant Station Blackout Analysis (TAC M68548)
3. RGE-6 "4160v Electrical Distribution System" 4 RGE-7 "480v Distribution"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2 Loss of DC Power Sources 6.2.1 Unusual Event

< 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B for > 15 min.

MMARC IC:

Unplanned loss of required DC power during cold shutdown or refueling mode for greater than 15 minutes.

FPB loss/potential loss:

N/A Mode Applicability:

Cold Shutdown, Refueling Basis:

The purpose of this EAL is to recognize a loss of DC power compromising the ability to monitor and control the removal of decay heat during cold shutdown or refueling operations. This EAL is intended to be anticipatory in as much as the operating crew may not have necessary indication and control of equipment needed to respond to the loss.

The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment. This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.

PEG

Reference:

SU7.1 Basis Reference(s):

1. RGE-9 "Instrument Bus and DC Power System"

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 6.0 Electrical Failures 6.2 Loss of DC Power Sources 6.2.2 Site Area Emergency

> 105 vdc bus voltage indications on 125 vdc batteries 1A and 1B

. for > 15 min.

NUINARC IC:

Loss of all vital DC power with reactor coolant > 200 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

Loss of all DC power compromises ability to monitor and control plant safety functions. Prolonged loss of all DC power will cause core uncovering and loss of containment integrity when there is significant decay heat and sensible heat in the reactor system. Escalation to a General Emergency would occur by other EAL categories. Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.

The bus voltage is based on the minimum bus voltage necessary for the operation of safety related equipment. This voltage value incorporates a margin of at least 15 minutes of operation before the onset of inability to operate loads.

PEG

Reference:

SS3.1 Basis Reference(s):

1. RGE-9 "Instrument Bus and DC Power System" 6-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Numerous plant system related equipment failure events which warrant emergency classification, based upon their potential to pose actual or potential threats to plant safety, have been identified in this category.

The events of this category have been grouped into the following event types:

T Only one EAL falls under this event type related to the failure of the plant to be brought to the required plant operating condition required by technical specifications.

m il r r nr1 m v i n This category includes events which are indicative of losses of operability of safety systems such as ECCS, isolation functions, Control Room habitability or cold and hot shutdown capabilities.

fn'nA1 n' 'li Certain events which degrade the plant operators ability to effectively assess plant conditions or communicate with essential personnel within or external to the plant warrant emergency classification. Under this event type are losses of annunciators and/or communication equipment.

7-1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.1 Technical Speci6cation Requirements 7.1.1 Unusual'Event Plant is not brought to required operating mode within Technical Specifications LCO Action Statement Time.

1%UAIARC IC:

Inability to reach required shutdown within Technical Specification Limits.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

Limiting Conditions of Operation (LCOs) require the plant to be brought to a required shutdown mode when the Technical Specification required configuration cannot be restored. Depending on the circumstances, this may or may not be an emergency or precursor to a more severe condition. In any case, the initiation of plant shutdown required by the site Technical Specification requires a one hour report under 10CFR50.72 (b) non-emergency events. The plant is within its safety envelope when being shut down within the allowable action statement time in the Technical Specifications. An immediate Notification of an Unusual Event is required when the plant is not brought to the required operating mode within the allowable action statement time in the Technical Specifications. Declaration of an Unusual Event is based on the time at which the LCO-specified action statement time period elapses under the site Technical Specifications and is not related to how long a condition may have existed. Other required Technical Specification shutdowns that involve precursors to more serious events are addressed by other EALs.

7-2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

SU2.1 Basis Reference(s):

1. Technical Specifications Section 3.0 7-3

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.1 Unusual Event Report of main turbine failure resulting in casing penetration or damage to turbine seals or generator seals.

NUMARC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Power Operation, hot shutdown Basis:

This EAL is intended to address main turbine rotating component failures of suf6cient magnitude to cause observable damage to the turbine casing or to the seals of the turbine generator. Of major concern is the potential for leakage of combustible fluids (lubricating oils) and gases (hydrogen cooling) to the plant environs. Actual fires and flammable gas build up are appropriately classified through other EALs. This EAL is consistent with the definition of an Unusual Event while maintaining the anticipatory nature desired and recognizing the risk to non-safety related equipment.

PEG

Reference:

HU1.6 Basis Reference(s):

None 7-4

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.2 Alert Turbine failure generated missiles result in any visible structural damage to plant vital equipment NUINARC IC:

Natural and destructive phenomena affecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Power Operations, Hot Shutdown Basis:

This EAL addresses the threat to safety related equipment imposed by missiles generated by main turbine rotating component failures. The involved equipment includes safety-related equipment, their controls, and their power supplies. This EAL is consistent with the definition of an ALERT in that, ifmissiles have damaged or penetrated areas containing safety-related equipment, the potential exists for substantial degradation of the level of safety of the plant.

PEG

Reference:

HA1.6 Basis Reference(s):

None 7-5

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.3 Alert Entry into AP-CR.1 "Control Room Inaccessability" MMARC IC:

Control room evacuation has been initiated.

FPB loss/potential loss:

N/A Mode Applicability:

All Basis:

With the Control Room evacuated, additional support, monitoring and direction through the Technical Support Center and/or other emergency operations center is necessary. Inability to establish plant control from outside the Control Room will escalate this event to a Site Area Emergency.

PEG

Reference:

HA5.1 Basis Reference(s):

1. AP-CR.1 Control Room Inaccessibility 7-6

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.2 System Failures or Control Room 1 Evacuation 7.2.4 Alert Reactor coolant temperature cannot be maintained < 200 'F NUINARC IC:

Inability to maintain plant in cold shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

Cold Shutdown, Refueling Basis:

h This EAL addresses complete loss of functions required for core cooling during refueling and cold shutdown modes. Escalation to Site Area Emergency or General Emergency would be through other EALs.

A reactor coolant temperature increase that approaches or exceeds the cold shutdown technical specification limit warrants declaration of an Alert irrespective of the availability of technical specification required functions to maintain cold shutdown. The concern of this EAL is the loss of ability to maintain the plant in cold shutdown which is defined by reactor coolant temperature and not the operability of equipment which supports removal of heat from the reactor.

PEG

Reference:

SA3.1 7-7

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. AP-RHR.1 "Loss of RHR"
2. Technical Specifications Section 1.2 3, AP-RHR-2 "Loss of RHR While Operating at Reduced RCS Inventory Conditions" 7-8

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

'7.0 Equipment Failures 7.2 System Failures or Control Room Evacuation 7.2.5 Site Area Emergency Control Room evacuation AND Core cooling cannot be established per AP-CR.1 "Control Room Inaccessibility" in ~ 20 min.

MJMARC IC:

Control room evacuation has been initiated and control of core cooling cannot be established.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL indicates that expeditious transfer of safety systems has not occurred but fission product barrier damage may not yet be indicated. The time interval for transfer is based on analysis or assessments as to how quickly control must be reestablished without core uncovering and/or core damage.

The design criteria for the remote shutdown equipment specifies that control of safety systems must be able to be achieved without resulting in core uncovery or core damage. REGNPS Appendix R submittal indicates 20 minutes is the maximum time for which control of plant safety systems should occur under worst case conditions. Therefore, 20 minutes is within the design criteria of the remote shutdown equipment.

In cold shutdown and refueling modes, operator concern is directed toward maintaining core cooling such as is discussed in Generic Letter 88-17, "Loss of Decay Heat Removal." In power operation, and hot shutdown modes, operator concern is primarily directed toward maintaining critical safety functions and thereby assuring fission product barrie'r integrity.

7-9

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HS2.1 Basis Reference(s):

1. AP-CR.1 Control Room Inaccessibility
2. Appendix R Section 6.4.5 page 6-35
3. Generic Letter 88-17, "Loss of Decay Heat Removal."

7-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications /Alarms /

Communication Capability 7.3.1 Unusual Event Unplanned loss of annunciators or indications on any Control Room Panels, Table 7.3 for > 15 min.

AND Increased surveillance is required for safe plant operation Table 7.3 Vital Control Room Panels A AA B C D E F 0 NUINARC IC:

Unplanned loss of most or all safety system annunciation or indication in the control room for greater than 15 minutes with reactor coolant temperature >

2OO 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

This EAL recognizes the difhculty associated with monitoring changing plant conditions without the use of a major portion of the annunciation or indication equipment. Recognition of the availability of computer based indication equipment is considered (PPCS and SAS).

"Unplanned" loss of annunciators or indicators excludes scheduled maintenance and testing activities.

It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use ofjudgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions. This judgment 7-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 is supported by the specific opinion of the Shik Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to, safely operate the plant.

It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.

While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is included in this EAL due to difficultyassociated with assessment of plant conditions. The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status. This willbe addressed by their specific Technical Specification. The initiation of a Technical Specification imposed plant shutdown related to the instrument loss willbe reported via 10CFR50.72. Ifthe shutdown is not in compliance with the Technical Specification action, the Unusual Event is based on EAL 7.1.1, Inability to Reach Required Shutdown Within Technical Specification Limits.

Annunciators or indicators for this EAL must include those identified in the Abnormal Operating procedures, in the Emergency Operating Procedures, and in other EALs (e. g., area, process, and/or effluent rad monitors, etc.).

Fifteen minutes was selected as a threshold to exclude transient or momentary power losses.

Due to the limited number of safety systems in operation during cold shutdown, refueling, and defueled modes, this EAL is not applicable during these modes of operation.

This Unusual Event willbe escalated to an Alert ifa transient is in progress during the loss of annunciation or indication.

PEG

Reference:

SU3.1 Basis Reference(s):

None 7-12

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications /Alarms /

Communication Capability 7.3.2 Unusual Event Loss of all communications capability affecting the ability to either:

Perform routine operations OR Notify offsite agencies or personnel NUMARC IC:

Unplanned loss of all onsite or offsite communications capabilities.

FPB loss/potential loss:

~

N/A Mode Applicability:

Basis:

The purpose of this EAL is to recognize a loss of communications capability that either defeats the plant operations staff ability to perform routine tasks necessary for plant ope'rations or the ability to communicate problems with offsite authorities. The loss of offsite communications ability is expected to be significantly more comprehensive than the condition addressed by 10CFR50.72.

The onsite communications loss must encompass the loss of all means of routine communications (i. e., phones, sound powered phone systems, page party system, and'radios/walkie talkies).

The offsite communications loss must encompass the loss of all means of communications with offsite authorities. This should include ENS, Bell lines, FAX transmissions, and dedicated phone systems. This EAL is intended to be used only when extraordinary means are being utilized to make communications possible (relaying of information from radio transmissions, individuals being sent to offsite locations, etc.).

7-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

.PEG

Reference:

SU6.1 Basis Reference(s):

1. A-56, "Communication Systems at Ginna Station" 7-14

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications /Alarms /

Communication Capability 7.3.3 Alert Unplanned loss of annunciators or indications on any Control Room Panels,

. Table 7.3 for > 15 min.

AND Increased surveillance is required for safe plant operation AND either:

A plant transient in progress OR PPCS and SAS are unavailable Table 7.3 Vital Control Room Panels AA B C D E F G NUMARC IC:

Unplanned loss of most or all safety system annunciation or indication in control room with either (1) a significant transient in progress, or (2) compensatory non-alarming indicators are unavailable with reactor coolant >

200 'F.

FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

This EAL recognizes the difBculty associated with monitoring changing plant

'onditions without the use of a major portion of the annunciation or indication equipment during a transient. Recognition of the availability of computer based indication equipment is considered (PPCS, SAS, etc.).

"Unplanned" loss of annunciators or indicators does not include scheduled maintenance and testing activities.

7-15

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 It is not intended that plant personnel perform a detailed count of the instrumentation lost but the use ofjudgment by the Shift Supervisor as the threshold for determining the severity of the plant conditions. This judgment is supported by the specific opinion of the Shift Supervisor that additional operating personnel will be required to provide increased monitoring of system operation to safely operate the plant.

It is further recognized that most plant designs provide redundant safety system indication powered from separate uninterruptable power supplies.

While failure of a large portion of annunciators is more likely than a failure of a large portion of indications, the concern is Uicluded in this EAL due to difFiculty associated with assessment of plant conditions. The loss of specific, or several, safety system indicators should remain a function of that specific system or component operability status, This willbe addressed by the specific Technical Specification. The initiation of a Technical Specification imposed plant shutdown related to the instrument loss will be reported via 10CFR50.72.

Annunciators or indicators for this EAL includes those identified in the Abnormal Operating Procedures, in the Emergency Operating Procedures, and in other EALs (e. g., area, process, and/or effluent rad monitors, etc.).

"Significant transient" includes response to automatic or manually initiated functions such as trips, runbacks involving greater than 25% thermal power change, ECCS injections, or thermal power oscillations of 10% or greater.

Ifboth a major portion of the annunciation system and all computer monitoring are unavailable to the extent that the additional operating personnel are required to monitor indications, the Alert is required.

Due to the limited number of safety systems in operation during cold shutdown, refueling and defueled modes, no EAL is indicated during these modes of operation.

This Alert will be escalated to a Site Area Emergency ifthe operating crew cannot monitor the transient in progress, PEG

Reference:

SA4.1 Basis Reference(s):

None 7-16

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 7.0 Equipment Failures 7.3 Loss of Indications /Alarms /

Communication Capability 7.3.4 Site Area Emergency Loss of annunciators or indications on any Control Room Panels, Table 7.3 AND Complete loss of ability to monitor all critical safety function status AND A plant transient in progress Table 7.3 Vital Control Room Panels A AA B C D E' G NUIKARC IC:

Inability to monitor a significant transient in progress with reactor coolant >

200 DF FPB loss/potential loss:

N/A Mode Applicability:

Power operation, hot shutdown Basis:

This EAL recognizes the inability of the Control Room staff to monitor the plant response to a transient. A Site Area Emergency is considered to exist if the Control Room staff cannot monitor safety functions needed for protection of the public.

Annunciators for this EAL should be limited to include those identified in the Abnormal Operating Procedures, in the CSFST's and Emergency Operating Procedures, and in other EALs (e. g., rad "monitors, etc.).

"Significant transient" includes response to automatic or manually initiated functions such as scrams, runbacks involving greater than 25 lo thermal 7-17

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 power change, ECCS injections, or thermal power oscillations of 10% or greater.

Indications needed to monitor critical safety functions necessary for of the public must include Control Room indications, computer 'rotection generated indications and dedicated annunciation capability. The specific indications should be those used to determine such functions as the ability to shut down the reactor, maintain the core cooled and in a eoolable geometry, to remove heat from the core, to maintain the reactor coolant system intact, and to maintain containment intact.

"Planned" actions are excluded from the EAL since the loss of instrumentation of this magnitude is of such significance during a transient that the cause of the loss is not an ameliorating factor.

PEG

Reference:

SS6.1 Basis Reference(s):

None 7-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Hazards are those non-plant system related events which can directly or indirectly impact plant operation or reactor plant and personnel safety.

The events of this category have been grouped into the following types:

PM tgp ld t *d tp t p into the Protected Area as well as bomb threats and sabotage attempts.

Also addressed are actual security compromises threatening loss of physical control of the plant.

Pl p lg ll tt* d t p l reactor safety. Appropriate for classification are fires within the site d

Protected Area or which may affect operability of vital equipment.

E M - d t tg - t Ml occurring events which can cause damage to plant facilities such as explosions from whatever source.

E t t ',

aircraft crashes, missile impacts, toxic or flammable gas leaks or tqd which have potential to cause damage to plant structures or equipment significant enough to threaten personnel or plant safety.

d

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1 Security Threats 8.1.1 Unusual Event Bomb device or other indication of attempted sabotage discovered within plant Protected Area.

OR Any security event which represents a potential degradation in the level of safety of the plant.

MMARC IC:

Confirmed security event which indicates a potential degradation in the level of safety of the plant.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL is based on the REGNPS Security Contingency Plan. Security events which do not represent at least a potential degradation in the level of safety of the plant, are reported under 10CFR73.71 or in some cases under 10CFR50.72, The plant Protected Area boundary is within the security isolation zone and is defined in the security plan. Bomb devices discovered within the plant vital area would result in EAL escalation.

PEG

Reference:

HU4.1 HU4.2 Basis Reference(s):

1. REGNPS Security Contingency Plan

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1 Security Threats 8.1.2 Alert Intrusion into plant Protected Area by an adversary.

OR Any security event which represents an actual substantial degradation of the level of safety of the plant.

MMARC IC:

Security event in a plant protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This class of security events represents an escalated threat to plant safety above that contained in the Unusual Event, For the purposes of this EAL, the intrusion by unauth'orized personnel inside the Protected Area boundary can be considered a significant security threat. Intrusion into a vital area by unauthorized personnel will escalate this event to a Site Area Emergency.

PEG

Reference:

HA4.1 HA4.2 Basis Reference(s):

1. REGNPS Security Contingency Plan 8.3

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1 Security Threats.

8.1.3 Site Area Emergency Intrusion into a plant security vital area by an adversary.

OR Any security event which represents actual or likely failures of plant systems needed to protect the public.

MMARC IC:

Security event in a plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This class of security events represents an escalated threat to plant safety above that contained in the Alert in that unauthorized personnel have progressed from the Protected Area to the vital area.

PEG

Reference:

HS1.1 HS1.2 Basis Reference(s):

1. REGNPS Security Contingency Plan

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.1 Security Threats 8.1.4 General Emergency Security event which results in:

Loss of plant control from the Control Room OR Loss of remote shutdown capability NUMARC IC Security event resulting in loss of ability to reach and maintain cold shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL encompasses conditions under which unauthorized personnel have taken physical control of vital areas required to reach and maintain safe shutdown.

PEG

Reference:

HG1.1 HG1.2 Basis Reference(s):

1. REGNPS Security Contingency Plan

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

~

8.0 Hazards 8.2 Fire or Explosion 8.2.1 Unusual Event Confirmed fire in any plant area, Table 8.2 or 8.3 not extinguished in < 15 min. of Control Room notification:

Table 8.2 Plant Areas

~ Turbine Building

~ TSC Service Building

~ Contaminated Storage Building Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House NUIYIARCIC Fire within protected area boundary not extinguished within 15 minutes of detection.

FPB loss/potential loss:

N/A Mode Applicability:

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis:

The purpose of this EAL is to address the magnitude and extent of fires that may be potentially significant precursors to damage to safety systems. This excludes such items as fires within administration buildings, waste-basket fires, and other small fires of no safety consequence.

PEG

Reference:

HU2.1 Basis Reference(s):

1. Site Plot Plan

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.2 Fire or Explosion 8.2.2 Alert Fire or explosion in any plant area, Table 8.2 or Table 8.3 which results in EITHER:

~ visible damage to plant equipment or structures needed for safe plant operation OR

~ which affects safety system operability as indicated by degraded system performance Table 8.2 Plant Areas

~ Turbine Building

~ TSC

~ Service Building

~ Contaminated Storage Building Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House NUIKARC IC:

Fire or explosion affecting the operability of plant safety systems required to establish or maintain safe shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

All

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis:

The listed areas contain functions and systems required for the safe shutdown of the plant. The REGNPS safe shutdown analysis was consulted for equipment and plant areas required for the applicable mode.

With regard to explosions, only those explosions of suQicient force to damage permanent structures or equipment required for safe operation, or which results in degraded performance of safety systems within the identified plant areas should be considered. As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to nearby structures and materials. No attempt is made in this EAL to assess the actual magnitude of the damage. The wording of this EAL does not imply that an assessment of safety system performance is intended to be performed, rather that as a result of the event, safety system parameter symptoms are degraded as a result of the event. The declaration of an Alert and the activation of the TSC will provide the Emergency Coordinator with the resources needed to perform damage assessments. The Emergency Coordinator also needs to consider any security aspects of the explosions.

PEG

Reference:

HA2.1 Basis Reference(s):

1. Site Plot Plan

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3 Man-Made Events 8.3.1 Unusual Event Vehicle crash into or projectile which impacts plant structures or systems within Protected Area boundary NUIKARC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A

~

Mode Applicability:

Basis:

The Protected Area boundary is within the security isolation zone and is defined in the site security plan.

This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of other projectiles that may potentially damage plant structures containing functions and systems required for safe shutdown of the plant. Ifthe crash is confirmed to affect a plant vital area, the event may be escalated to Alert.

PEG

Reference:

HU1.4 Basis Reference(s):

1. Site Plot Plan 8-10

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3 Man-Made Events 8.3.2 Unusual Event Report by plant personnel of an explosion within Protected Area boundary resulting in visible damage to permanent structures or equipment NUINARC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

The Protected Area boundary is within the security isolation zone and is defined in the site security plan.

For this EAL, only those explosions of sufBcient force to damage permanent structures or equipment within the Protected Area should be considered. As used here, an explosion is a rapid, violent, unconfined combustion, or a catastrophic failure of pressurized equipment, that potentially imparts significant energy to near by structures and materials. No attempt is made in this EAL to assess the actual magnitude of the damage. The occurrence of the explosion with reports of evidence of damage (e. g., deformation, scorching) is sufficient for declaration. The Emergency Coordinator also needs to consider any security aspects of the explosion.

PEG

Reference:

HU1.5 Basis Reference(s):

1. Site Plot Plan 8-11

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3 Man-Made Events 8.3.3 Unusual Event Report or detection of toxic or flammable gases that could enter or have entered within the Protected Area boundary in amounts that could afFect the

~

health of plant personnel or safe plant operation OR Report by local, county or state officials for potential evacuation of site personnel based on offsite event NUMARC IC:

Release of toxic or flammable gases deemed detrimental to safe operation of the plant.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL is based on releases in concentrations within the site boundary that

=will afFect the health of plant personnel or afFecting the safe operation of the plant with the plant being within the evacuation area of an ofFsite event (i. e.,

tanker truck accident releasing toxic gases, etc.). The evacuation area is as determined from the DOT Evacuation Tables for Selected Hazardous Materials, in the DOT Emergency Response Guide for Hazardous Materials.

Should an explosion occur within a specified plant area, an Alert would be declared based on EAL 8.2.2.

, PEG

Reference:

HU3.1 HU3.2 8-12

OSSI-92-402A-4-REG Ginna EAL Technical Bases DocumentRev 1 Basis Reference(s):

None 8-13

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3 Man-Made Events 8.3.4 Alert Vehicle crash or projectile impact which precludes personnel access to or damages equipment in plant vital areas, Table 8.3 Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House NUINARC IC:

Natural and destructive phenomena afFecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.

This EAL addresses such items as plane, helicopter, train, barge, car or truck crash, or impact of projectiles into a plant vital area.

8- 14

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HA1.5 Basis Reference(s):

None 8-15

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.3 Man-Made Events 8.3.5 Alert Report or detection of toxic or flammable gases within a plant area, Table 8.3, in concentrations that will be life threatening to plant personnel or preclude access to equipment needed for safe plant operation Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House MMARC IC:

Release of toxic or flammable gases within a facility structure which jeopardizes operation of systems required to maintain safe operations or to establish or maintain cold shutdown.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL is based on gases that have entered a plant structure precluding access to equipment necessary for the safe operation of the plant. This EAL applies to buildings and areas contiguous to plant vital areas or other significant buildings or areas. The intent of this EAL is not to include buildings (i. e., warehouses) or other areas that are not contiguous or immediately adjacent to plant vital areas. It is appropriate that increased monitoring be done to ascertain whether consequential damage has occurred.

8-16

OSSI-92-402A-4-REG Ginna EAL Tech'nical Bases Document, Rev 1 PEG

Reference:

HA3.1 HA3.2 Basis Reference(s):

None 8-17

OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.1 Unusual Event Earthquake felt inplant by any operator AND Confirmation of earthquake of an intensity ) 0.01 g per SC-5 "Earthquake Emergency Plan".

MMARC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

REGNPS seismic instrumentation actuates at 0.01 g.

Damage to some portions of the site may occur but it should not affect ability of safety functions to operate. Methods of detection can be based on instrumentation validated by a reliable source, operator assessment, or indication received from outside agencies. As de6ned in the EPRI-sponsored "Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989, a "felt earthquake" is:

"An earthquake of suQicient intensity such that: (a) the inventory ground motion is felt at the nuclear plant site and recognized as an earthquake based on a consensus of Control Room operators on duty at the time, and (b) for plants with operable seismic instrumentation, the seismic switches of the plant are activated. For most plants with seismic instrumentation, the seismic switches are set at an acceleration of about 0.01 g."

PEG

Reference:

HU1.1 8-18

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. SC-5 Earthquake Emergency Plan
2. EPRI document, "Guidelines for Nuclear Plant Response to an Earthquake", dated October 1989 8-19

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.2 Unusual Event Report by plant personnel of tornado within plant Protected Area boundary M;5hVKC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL is based on the assumption that a tornado striking (touching down) within the Protected Area boundary may have potentially damaged plant structures containing functions or systems required for safe shutdown of the plant. Ifsuch damage is con6rmed visually or by other in-plant indications, the event may be escalated to Alert.

PEG

Reference:

HU1.2 Basis Reference(s):

None 8-20

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.3 Unusual Event Deer Creek flooding over entrance road bridge (hand rail)

OR Lake level > 252 ft OR Screen House Suction Bay water level < 15 ft (low-low level alarm)

MMARC IC:

Natural and destructive phenomena affecting the protected area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This covers high and low lake water level conditions that could be precursors of more serious events. Deer creek flooding over entrance road bridge may preclude emergency response personnel access and egress. Lake water level

> 252 ft. corresponds to plant design levels. Screen House Suction Bay level <

15 R. corresponds to the low-low level alarm point and which requires load reduction below 50%.

PEG

Reference:

HU1.7 Basis Reference(s):

1. SC-4 High Water (Flood) Emergency Plan
2. SC-4.1 Low Screenhouse Water Level
3. Interoffice Memo" Screenhouse Pump Bay Water Level" dated V24/94 to Terry White from William Rapin and Jeffrey Wayland 8-21

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.4 Alert Earthquake felt inplant by any plant operations personnel AND

~

Confirmation of earthquake of an intensity ) 0.08 g per SC-5 "Earthquake Emergency Plan" NUIYGMC IC:

Natural and destructive phenomena afFecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.

This EAL is based on the FSAR design basis operating earthquake of 0.08 g.

Seismic events of this magnitude can cause damage to plant safety functions.

PEG

Reference:

HAl.l Basis Reference(s):

1. SC-5 "Earthquake Emergency Plan" 8-22

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Ev'ents 8.4.5 Alert Sustained winds > 75 mph OR

, Tornado strikes a plant vital area, Table 8.3 Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House MMARC IC:

Natural and destructive phenomena affecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.

This EAL is based on the FSAR assumed "severe environmental loading" condition of 75 mph. Wind loads of this magnitude can cause damage to safety functions.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 PEG

Reference:

HA1.2 Basis Reference(s):

1. RGE FSAR Section 3.3.2.1.4 8-24

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.6 Alert Any natural event which results in a report of visible structural damage or assessment by Control Room personnel of actual damage to equipment needed for safe plant operation, Table 8.3 Table 8.3 Plant Vital Areas

~ Control Building

~ Reactor Containment Building

~ Auxiliary Building

~ Intermediate Building

~ Emergency Diesel Building

~ Standby Auxiliary Feedwater Building

~ Screen House MMARC IC:

Natural and destructive phenomena affecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses events that may have resulted in a plant vital area being subjected to forces beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.

This EAL specifies areas in which structures containing systems and functions required for safe shutdown of the plant are located.

8-25

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

'PEG

Reference:

HA1.3 Basis Reference(s):

None 8-26

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Hazards 8.4 Natural Events 8.4.V Alert Flood water accumulating on screen house operating floor OR

'ake level > 253 ft OR Screen House Suction Bay water level < 13 ft NUMARC IC:

Natural and destructive phenomena affecting the plant vital area.

FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses events that may have resulted in a plant vital area being subjected to levels beyond design limits, and thus damage may be assumed to have occurred to plant safety systems. The initial report should not be interpreted as mandating a lengthy damage assessment prior to classification. No attempt is made in this EAL to assess the actual magnitude of the damage.

This.EAL covers high and low lake water level conditions that exceed levels which threaten vital equipment. Flood water accumulating on the screen house operating floor or lake levels > 253 ft. corresponds to levels threatening vital equipment. Screen House Suction Bay level < 13 ft. corresponds to the level below which the motor driven firewater pump suction bowls are uncovered.

PEG

Reference:

HA1.7 8-27

OSSI-92-402A-4-REG'inna EAL Technical Bases Document, Rev 1 Basis Reference(s):

1. SC-4 High Water (Flood) Emergency Plan
2. SC-4.1 Low Screenhouse Water Level
3. Interof6ce Memo " Screenhouse Pump Bay Water Level" dated 1/24/94 to Terry White from William Rapin and Jeffrey Wayland 8-28

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 The EALs defined in categories 1.0 through 8.0 specify the predetermined symptoms or events which are indicative of emergency or potential emergency conditions, and which warrant classification. While these EALs have been developed to address the full spectrum of possible emergency conditions which may warrant classification and subsequent implementation of the Emergency Plan, a provision for classification of emergencies based on operator/management experience and judgment is still necessary. The EALs of this category provide the Shift Supervisor or Emergency Coordinator the latitude to classify emergency conditions consistent with the established classification criteria, based upon their judgment.

9-1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.1 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a potential degradation of the level of safety of the plant.

NUINARC IC:

Emergency Director Judgment FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Unusual Event emergency class.

From a broad perspective, one area that may warrant Emergency Coordinator judgment is related to likely or actual breakdown of site specific event mitigating actions. Examples to consider include inadequate emergency response procedures, transient response either unexpected or not understood, failure or unavailability of emergency systems during an accident in excess of that assumed in accident analysis, or insufhcient availability of equipment and/or support personnel.

PEG

Reference:

HU1.3 HU5.1

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

'Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.2 Unusual Event Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead to or has led to a loss or potential loss of containment,

. Attachment A.

NUbXARC IC:

N/A FPB loss/potential loss:

Containment loss/potential loss Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the containment barrier is lost or potentially lost. In addition, the inability to monitor, the barrier should also be incorporated in this EAL as a factor in Emergency Coordinator judgment that the barrier may be considered lost or potentially lost.

PEG

Reference:

PCS.X Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.3 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could cause or has caused actual substantial degradation of the level of safety of the plant.

NMGLRC IC:

Emergency Director Judgment FPB loss/potential loss:

N/A Mode Applicability:

Basis This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the Alert emergency class.

PEG

Reference:

HA6.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.4 Alert Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to a loss or potential loss of either fuel clad or RCS barrier, Attachment A.

NM4A'RC IC:

N/A FPB loss/potential loss:

Loss or potential loss of either fuel clad or RCS barrier Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses any other factors that are to be used by the Emergency Coordinator in determining whether the fuel clad or RCS barriers are lost or potentially lost. In addition, the inability to monitor the barriers should also be considered in this EAL as a factor in Emergency Coordinator judgment that the barriers may be considered lost or potentially lost.

PEG

Reference:

FC7.1 RCS6.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 OCher 9.1.5 Site Area Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or likely failures of plant systems needed to protect the public. Any releases are not expected to result in exposures which exceed EPA PAGs.

NUMARC IC:

Emergency Director Judgment FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.

PEG

Reference:

HS3.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 8.0 Other 9.1.6 Site Area Emergency Any event, as determined by the Shik Supervisor or Emergency Coordinator, that could lead or has led to either:

Loss or potential loss of both fuel clad and RCS barrier, Attachment A OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment, Attachment A NUIKARC IC:

N/A FPB loss/potential loss:

Loss or potential loss of both fuel clad and RCS barrier OR Loss or potential loss of either fuel clad or RCS barrier in conjunction with a loss of containment Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere. Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for Site Area Emergency.

PEG

Reference:

FC7.1 RCS6.1 PC8.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0>> Other 9.1.7 General Emergency As determined by the Shift Supervisor or Emergency Coordinator, events are in progress which indicate actual or imminent core damage and the potential

. for a large release of radioactive material in excess of EPA PAGs outside the site boundary.

NUINARC IC:

Emergency Director Judgment FPB loss/potential loss:

N/A Mode Applicability:

Basis:

This EAL addresses unanticipated conditions not addressed explicitly elsewhere but that warrant declaration of an emergency because conditions exist which are believed by the Emergency Coordinator to fall under the General Emergency class.

Releases can reasonably be expected to exceed EPA PAG plume exposure levels outside the site boundary.

. PEG

Reference:

HG2.1 Basis Reference(s):

None

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 9.0 Other 9.1.8 General Emergency Any event, as determined by the Shift Supervisor or Emergency Coordinator, that could lead or has led to a loss of any two fission product barriers and loss or potential loss of the third, Attachment A.

NUIKARC IC:

N/A FPB loss/potential loss:

Loss of any two fission product barriers and loss or potential loss of the third Mode Applicability:

Power operation, hot shutdown Basis:

This EAL addresses unanticipated conditions affecting fission product barriers which are not addressed explicitly elsewhere. Declaration of an emergency is warranted because conditions exist which are believed by the Emergency Coordinator to fall under the emergency class description for the General Emergency class.

PEG

Reference:

FC7.1 HCS6.1 PC8.1 Basis Reference(s):

None 9-10

OS SI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 ATTACHMENTA FISSION PRODUCT BARRIER LOSS 4 POTENTIAL LOSS INDICATORS

Fission Product Barrier Loss / Potential Loss Matrix (Rose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)

Potential Loss

,ORANGE path in F-0.2, CORE COOLING RED path in F-0.2, CORE COOLING RED path in F-0.3, HEAT SINK Coolant activity > 300 IiCi/cc of 1-131 Core Exit Thermocouple Readings > /00 'F Core Exit Thermocouple Readings > 1200 'F RVLIS 5 43% w/ no RCPs running Containment rad monitor reading >100 R/hr Emergency Coordinator Judgment Letdown Monitor (R-9) reading > 10 R/hr Emergency Coordinator Judgment Potential Loss RED path on F-0.4, INTEGRITY RCS subcooling < EOP Fig. MIN SUBCOOLING due to RCS leakage RED path on F-0.3, HEAT SINK Unisolable secondary side line break with SG tube rupture as identified in E-3 "Steam Generator Tube Rupture" Primaiy system leakage > 46 gpm Containment radiation monitor reading > 10 R/hr Emergency Coordinator Judgment Emergency Coordinator Judgment A-2

Fission Product Barrier Loss / Potential Loss Matrix

+hose thresholds for which loss or potential is determined to be imminent, classify as though the threshold(s) has been exceeded)

Potential Lose RED path F-0.5, CONTAINMENT Rapid uncontrolled decrease in Containment Pressure following initial increase Either: Loss of primary coolant inside containment with containment pressure Core exit thermocouples >1200 'F or sump level response not consistent with LOCA conditions, i.e.

OR unexpected changes occur in these parameters that are not explainable Core exit thermocouples >700 'F with RVLIS <43% (no RCPs) due to operator actions or automatic system actions.

AND Restoration procedures not effective within 15 minutes Safety injection signal due to LOCA with < the minimum containment Either.

cooling safeguards equipment operating: CI or CVI isolation required and CI or CVI valve(s) not closed when CNMT pressure <28 psig: 2 CNMT Recirc Fans required OR CNMT pressure 228 psig: 2 CNMT Spray Pumps Inability to isolate any primary system discharging outside OR containment 2 CNMT Recirc Fans AND and 1 CNMT Spray Pump Radiological release pathway to the environment exists Containment pressure 60 psig and increasing Release of secondary side to atmosphere with primary to secondary leakage greater than tech spec allowable of 0.1 CPM per steam generator h4% hydrogen concentration in containment Both doors open on containment airlock OR Inability to close containment pressure relief or purge valves which results in a radiological release pathway to the environment OR Cl or CVI valve(s) not closed when required which results in a radiological release pathway to the environment Containment radiation monitor reading >1000 R/hr Emergency Coordinator Judgment Emergency Coordinator Judgment A-3

ATTACHIVlENTB WORD LIST/DEFINITIONS

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Actuate To put into operation; to move to action; commonly used to refer to automated, multi-faceted operations. "Actuate ECCS".

Adversary As applied to security EALs, an individual whose intent is to commit sabotage, disrupt Station operations or otherwise commit a crime on station property.

Events are in process or have occurred which involve an actual or potential substantial degradation of the level of safety of the plant. Any releases are expected to be limited to small fractions of the EPA Protective Action Guideline exposure levels.

Available The state or condition of being ready and able to be used (placed into operation) to accomplish the stated (or implied) action or function. As applied to a system, this requires the operability of necessary support systems (electrical power supplies, cooling water, lubrication, etc.).

Can/Cannot be determined (</>)

The current value or status of an identified parameter relative to that specified can/cannot be ascertained using all available indications (direct and indirect, singly or in combination).

Can/Cannot be maintained above/below (c/>)

The value of the identified parameter(s) is/is not able to be kept above /below specified limits. This determination includes making an evaluation that considers both current and future system performance in relation to the current value and trend of the parameter(s). Neither implies that the parameter must actually exceed the limit before the action is taken nor that the action must be taken before the limit is reached.

B-2

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Can/Cannot be restored above/below (c/>)

The value of the identified parameter(s) is/is not able to be returned to above/below speci6ed limits after having passed those limits. This determination includes making an evaluation that considers both current and future systems performances in relation to the current value and trend of the parameter(s). Does not imply any specific time interval but does not permit prolonged operation beyond a limit without taking the specified action.

As applied to loss of electrical power sources (ex.: Power cannot be restored to any vital bus in < 4 hrs) the specified power source cannot be returned to service within the specified time. This determination includes making an evaluation that considers both current and future restoration capabilities.

Implies that the declaration should be made as soon as the determination is made that the power source cannot be restored within the specified time.

Close To position a valve or damper so as to prevent flow of the process fluid.

To make an electrical connection to supply power.

Con6rm / Con6rmation To validate, through visual observation or physical inspection, that an assumed condition is as expected or required, without taking action to alter the "as found" configuration.

Control Take action, as necessary, to maintain the value of a specified parameter within applicable limits; to fix or adjust the time, amount, or rate of; to regulate or restrict.

Decrease To become progressively less in size, amount, number, or intensity.

Discharge Removal of a fluid/gas &om a volume or system.

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Enter To go into.

Establish To perform actions necessary to meet a stated condition. "Establish communication with the Control Room."

Evacuate To remove the contents of; to remove personnel from an area.

Exceeds To go or be beyond a stated or implied limit, measure, or degree.

Exist To have being with respect to understood limitations or conditions.

Failure A state of inability to perform a normal function.

General Emergency Events are in process or have occurred which involve actual or imminent substantial core degradation or melting with potential for loss of containment integrity. Releases can be reasonably expected to exceed EPA Protective Action Guideline exposure levels oFsite for more than the immediate site area.

Logic term which indicates that taking the action prescribed is contingent upon the current existence of the stated condition(s). Ifthe identi6ed conditions do not exist, the prescribed action is not to be taken and execution of operator a'ctions must proceed promptly in accordance with subsequent instructions.

B-4

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1

'ncrease To become progressively greater in size, amount, number or intensity.

Indicate To point out or point to; to display the value of a process variable; to be a sign or symbol.

Initiate The act of placing equipment or a system into service, either manually or automatically. Activation of a function or protective feature (i.e. initiate a manual trip).

Iajection The act of forcing a fluid into a volume or vessel.

Inoperable Not able to perform it's intended function Intrusion The act of entering without authorization Failure of operability or lack of access to.

Maintain Take action, as necessary, to keep the value of the specified parameter within the applicable limits.

Monitor Observe and evaluate at a frequency sufBcient to remain apprised of the value, trend, and rate of change of the specified parameter.

B-5

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Notify To give notice of or report the occurrence of; to make known to; to inform specified personnel; to advise; to communicate; to contact; to relay.

Open To position a valve or damper so as to allow flow of the process fluid.

To break an electrical connection which removes a power supply from an electrical device.

To make available for entry or passage by turning back, removing, or clearing away.

Operable Able to perform it's intended function Perform To carry out an action; to accomplish; to aFect; to reach an objective.

Primary System The pipes, valves, and other equipment which connect directly to the reactor vessel or reactor coolant system such that a reduction in reactor coolant system pressure will effect a decrease in the steam or water being discharged through an unisolated break in the system.

Remove To change the location or position of.

Report To describe as being in a specific state.

Require To demand as necessary or essential.

8-6

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Take the appropriate action requires to return the value of an identified parameter to within applicable limits.

Rise Describes an increase in a parameter as the result of an operator or automatic action.

Sample To perform an analysis on a specified media to determine its properties.

Shut down To perform operations necessary to cause equipment to cease or suspend operation; to stop. "Shut down unnecessary equipment."

Site Area Emergency Events are in process or have occurred which involve actual or likely major failures of plant functions needed for protection of the public. Any releases are not expected to result in exposure levels which exceed EPA Protective Action Guideline exposure levels except near the site boundary.

Sustained Prolonged. Not intermittent or of transitory nature TFlp To de-energize a pump or fan motor; to position a breaker so as to interrupt or prevent the flow of current in the associated circuit; to manually activate a semi-automatic feature.

I To take action to cause shutdown of the reactor by rapidly inserting a control rod or control rods (PWR).

8-7

OSSI-92-402A-4-REG Ginna EAL Technical Bases Document, Rev 1 Uncontrolled An evolution lacking control but is not the result of operator action.

Unplanned Not as an expected result of deliberate action.

Until Indicates that the associated prescribed action is to proceed only so long as the identified condition does not exist.

Unusual Event Events are in process or have occurred which indicate a potential degradation of the level of safety of the plant. No releases of radioactive material requiring offsite response or monitoring are expected unless further degradation of safety systems occurs.

Valid Supported or corroborated on a sound basis.

Vent To open an effluent (exhaust) flowpath from an enclosed volume; to reduce pressure in an enclosed volume.

Verify To conGrm a condition and take action to establish that condition "Verifyreactor trip, verify SI pumps running."

ifrequired.

B-8

f4) pi(

i'I I

l~ 'I

<<->~a)

A