ML17059A086: Difference between revisions

From kanterella
Jump to navigation Jump to search
Created page by program invented by StriderTol
Created page by program invented by StriderTol
Line 17: Line 17:


=Text=
=Text=
{{#Wiki_filter:NUNINEEARLEPOINTATION-UNIT2
{{#Wiki_filter:NU NINE EAR LE POINT ATION-UNIT 2


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESGENERALTABLEOFCONTENTSPageT=TableF=FicFure PagePageAmendment T=TableAmendment T=TableAmendment NumberF=FicFure NumberF=FicFure NumberiiiiiiivR04ROOROOR03R03USARRevision4EPiOctober1992 J
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES GENERAL TABLE OF CONTENTS Page T=Table F=FicFure Page Page Amendment T=Table Amendment T=Table Amendment Number F=FicFure Number F=FicFure Number i ii iii iv R04 ROO ROO R03 R03 USAR Revision 4 EP i October 1992 J
NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER1PAGESPageT=TableF=Ficpure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number1-3.1-3.3.1-iii1-iv1-V1-Vi1-V1i1-Vi111-ix1-x1.1-11.1-21~13F1.1-11~211~221e231.2-41.2-51.2-61\271.2-81.2-91.2-101.2-111.2-121.2-131.2-141.2-151.2-161'-171.2-181.2-191.2-201~2-211.2-221~2231.2-241.2-251.2-261e2271.2-281.2-291.2-30A24A24A24A24ROOAOOR02R04R02R03A19AOOA24A21AOOAOOA21AOOAOOAOOAOOAOOAOOAOOA21R04AOOAOOA21A21AOOA18AOOROOR03A19AOOA21R03AOOA18AOOAOOA281.2-311'-321~2331~233a1.2-33b1.2-341.2-351.2-361e2-371.2-381.2-391.2-401.2-41F1.2-1F1.2-2F1.2-3F1.2-4F1.2-5F1.2-6Sh1F1.2-6Sh2F1.2-7Sh1F1.2-7Sh2F1.2-8Sh1F1.2-8Sh2F1.2-9Sh1F1.2-9Sh2F1.2-10Sh1F1.2-10Sh2F1.2-11Sh1F1.2-11Sh2F1.2-11Sh3F1.2-11Sh4F1.2-12F1.2-13Sh1F1.2-13Sh2F1.2-13Sh3F1'-14F12-15Sh1F1.2-15Sh2F1.2-15Sh3F1'-15Sh4F1'-16F1.2-17Sh1F1.2-17Sh2F1.2-17Sh3F1.2-17Sh4A28AOOA23A18A18AOOAOOAOOAOOAOOA23AOOA21R03R04A26A26A26ROOR02R02R01R03A26R03R01R01R02R03ROOROOROOROOROOA26ROOROOR04R04R04R04ROOROOROOROOROOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF1.2-171.2-171.2-181.2-191.2-191.2-201.2-201.2-211.2-211.2-221.2-2212-2312-231.2-241.2-251.2-261.2-261-2-271.2-271.2-281.2-291.2-291.2-291.2-301.2-311.2-321~2321e2321e2331.2-341.2-351.2-361~2371e2371.2-381.2-391.2-40Sh5Sh6Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh3Sh1Sh2Sh3Sh1Sh2Sh1Sh2Sh3Sh4Sh1Sh2Sh11~31T1~31T1e31T1.3-1T1~31T1~32T1.3-2T1~33ROOROOROOR02R03A26ROOR04ROOA26A26A26A26ROOA26R02R02R02R02R03AOOAOOR04AOOROOROOROOR04ROOROOA26A26A26A26AOOAOOA23ROOA21A21AOOA21AOOROOA21USARRevision4EP1-1October1992 e
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 1 PAGES Page T=Table F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 1-3.1-3.3.1-iii 1-iv 1-V 1-Vi 1-V1i 1-Vi11 1-ix 1-x 1.1-1 1.1-2 1~1 3 F 1.1-1 1~2 1 1~2 2 1 e 2 3 1.2-4 1.2-5 1.2-6 1\2 7 1.2-8 1.2-9 1.2-10 1.2-11 1.2-12 1.2-13 1.2-14 1.2-15 1.2-16 1'-17 1.2-18 1.2-19 1.2-20 1~2-21 1.2-22 1~2 23 1.2-24 1.2-25 1.2-26 1 e 2 27 1.2-28 1.2-29 1.2-30 A24 A24 A24 A24 ROO AOO R02 R04 R02 R03 A19 AOO A24 A21 AOO AOO A21 AOO AOO AOO AOO AOO AOO AOO A21 R04 AOO AOO A21 A21 AOO A18 AOO ROO R03 A19 AOO A21 R03 AOO A18 AOO AOO A28 1.2-31 1'-32 1~2 33 1~2 33a 1.2-33b 1.2-34 1.2-35 1.2-36 1e2-37 1.2-38 1.2-39 1.2-40 1.2-41 F 1.2-1 F 1.2-2 F 1.2-3 F 1.2-4 F 1.2-5 F 1.2-6 Sh 1 F 1.2-6 Sh 2 F 1.2-7 Sh 1 F 1.2-7 Sh 2 F 1.2-8 Sh 1 F 1.2-8 Sh 2 F 1.2-9 Sh 1 F 1.2-9 Sh 2 F 1.2-10 Sh 1 F 1.2-10 Sh 2 F 1.2-11 Sh 1 F 1.2-11 Sh 2 F 1.2-11 Sh 3 F 1.2-11 Sh 4 F 1.2-12 F 1.2-13 Sh 1 F 1.2-13 Sh 2 F 1.2-13 Sh 3 F 1'-14 F 1 2-15 Sh 1 F 1.2-15 Sh 2 F 1.2-15 Sh 3 F 1'-15 Sh 4 F 1'-16 F 1.2-17 Sh 1 F 1.2-17 Sh 2 F 1.2-17 Sh 3 F 1.2-17 Sh 4 A28 AOO A23 A18 A18 AOO AOO AOO AOO AOO A23 AOO A21 R03 R04 A26 A26 A26 ROO R02 R02 R01 R03 A26 R03 R01 R01 R02 R03 ROO ROO ROO ROO ROO A26 ROO ROO R04 R04 R04 R04 ROO ROO ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 1.2-17 1.2-17 1.2-18 1.2-19 1.2-19 1.2-20 1.2-20 1.2-21 1.2-21 1.2-22 1.2-22 1 2-23 1 2-23 1.2-24 1.2-25 1.2-26 1.2-26 1-2-27 1.2-27 1.2-28 1.2-29 1.2-29 1.2-29 1.2-30 1.2-31 1.2-32 1~2 32 1 e 2 3 2 1e233 1.2-34 1.2-35 1.2-36 1~2 3 7 1 e 2 3 7 1.2-38 1.2-39 1.2-40 Sh 5 Sh 6 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 1 1~3 1 T 1~3 1 T 1 e 3 1 T 1.3-1 T 1~3 1 T 1~3 2 T 1.3-2 T 1~3 3 ROO ROO ROO R02 R03 A26 ROO R04 ROO A26 A26 A26 A26 ROO A26 R02 R02 R02 R02 R03 AOO AOO R04 AOO ROO ROO ROO R04 ROO ROO A26 A26 A26 A26 AOO AOO A23 ROO A21 A21 AOO A21 AOO ROO A21 USAR Revision 4 EP 1-1 October 1992 e
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER1PageT=TableAmendment F=Ficrure NumberPageT=TableF=Picpure Amendment NumberPageT=TableF=FicFure Amendment NumberT1.3-3T1.3-3T1.3-4T1.3-5T1.3-5T1.3-6T1.3-7T1.3-8T1.3-8T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-9T1.3-91.4-11.4-21.4-31.4-41.4-51.4-61.4-71.4-8T1.4-1T1.4-11.5-11.5-21.5-31.5-41.5-51~6-1T1.6-1T1.6-1T1.6-1T1.6-1T1.6-1T1.6-1T1.6-1Sh2Sh3Sh1Sh2Sh1Sh2Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh10aSh1Sh2Sh1ShlaSh2Sh3Sh4Sh5Sh6A28AOOAOOA20AOOA28A04A21A23A04A18A28A18A18A18AOOA23AOOA23A23AOOAOOA04AOOAOOAOOAOOAOOA21A23AOOAOOAOOAOOAOOAOOA28A28AloA19AloAloA19T1.6-1T1.6-1T16-11~71T1.7-1T1.7-1T1.7-1T1.7-1T1e71T1.7-1T1~71T1.7-1T1.7-1T1.7-1T1.7-1T1.7-1T1e71T1.7-1T1.7-1T1~71T1.7-1T1.7-1T1~7-1T1.7-1T1~71T1.7-1T1~71T1~71T1.7-1T1~71T1~7-1T1\71Tl.7-1Tl.7-1T1.7-1T1.7-1T1~71T1~71T1.7-1T1.7-1T1.7-1T1.7-1T1.7-1T1~7-1T1e71shShSh6a78Sh1Sh2Sh3..Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh19aSh20Sh21Sh22Sh23Sh23aSh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39A19RolAloROOA23A23A23AolAolAolAolAolAolAolAolAolAOlAolAolAolAolA23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23T17-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1-7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT17-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-1ShT1.7-2ShT1.7-2ShT1.7-2ShT1.7-2ShF1.7-1aF1.7-1bF1.7-1cF1.7-1dF1.7-le404142434444a45464748495051525353a545555a55b55c55d55e55f55g5656a5757a5858a5959a6060a60b60c1234A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A23A09A09A09A09A09A09A09A09A09A09A23A23A23A23A23A23A23A23A24A23ROOROOROOROOROOROOROOROOR03USARRevision4EP1-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table Amendment F=Ficrure Number Page T=Table F=Picpure Amendment Number Page T=Table F=FicFure Amendment Number T 1.3-3 T 1.3-3 T 1.3-4 T 1.3-5 T 1.3-5 T 1.3-6 T 1.3-7 T 1.3-8 T 1.3-8 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 1.4-1 1.4-2 1.4-3 1.4-4 1.4-5 1.4-6 1.4-7 1.4-8 T 1.4-1 T 1.4-1 1.5-1 1.5-2 1.5-3 1.5-4 1.5-5 1~6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 10a Sh 1 Sh 2 Sh 1 Sh la Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 A28 AOO AOO A20 AOO A28 A04 A21 A23 A04 A18 A28 A18 A18 A18 AOO A23 AOO A23 A23 AOO AOO A04 AOO AOO AOO AOO AOO A21 A23 AOO AOO AOO AOO AOO AOO A28 A28 Alo A19 Alo Alo A19 T 1.6-1 T 1.6-1 T 1 6-1 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1 e 7 1 T 1.7-1 T 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1 e 7 1 T 1.7-1 T 1.7-1 T 1~7 1 T 1.7-1 T 1.7-1 T 1~7-1 T 1.7-1 T 1~7 1 T 1.7-1 T 1~7 1 T 1~7 1 T 1.7-1 T 1~7 1 T 1~7-1 T 1\7 1 T l.7-1 T l.7-1 T 1.7-1 T 1.7-1 T 1~7 1 T 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1~7-1 T 1 e 7 1 sh Sh Sh 6a 7 8 Sh 1 Sh 2 Sh3..Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 19a Sh 20 Sh 21 Sh 22 Sh 23 Sh 23a Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 A19 Rol Alo ROO A23 A23 A23 Aol Aol Aol Aol Aol Aol Aol Aol Aol AOl Aol Aol Aol Aol A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 T 1 7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1-7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1 7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-2 Sh T 1.7-2 Sh T 1.7-2 Sh T 1.7-2 Sh F 1.7-1a F 1.7-1b F 1.7-1c F 1.7-1d F 1.7-le 40 41 42 43 44 44a 45 46 47 48 49 50 51 52 53 53a 54 55 55a 55b 55c 55d 55e 55f 55g 56 56a 57 57a 58 58a 59 59a 60 60a 60b 60c 1 2 3 4 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A09 A09 A09 A09 A09 A09 A09 A09 A09 A09 A23 A23 A23 A23 A23 A23 A23 A23 A24 A23 ROO ROO ROO ROO ROO ROO ROO ROO R03 USAR Revision 4 EP 1-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER1PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberFFFF1~72l.7-31~731.7-41.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1~8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1~8-1T1.8-1T1~8-1T1.8-1T1~8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1.8-1T1~8-1T1.8-1ShShSh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh,16Sh17Sh18Sh19Sh20Sh20aSh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh3laSh32Sh33Sh34Sh35Sh36Sh37Sh38AOOROOROOROOAOOAOOAOOA04AOOA23AOOA12AOOAOOA05A03AOOAOOAOOAOOAOORolAOOA03A18A19AOOAOOAOOR02AOOAOOAOOAOOROOAOOROOROOAOOA23AOOAOOAOOA18ROOT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT18-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT18-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT18-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1Sh38a3940414243444546474849505152535455SSa56S6a56b5757a58596060a616263646566676869707172737475767778ROOROOROOAOOAOOAOOA28AOOAOOA05R03AOOA21R03AOOAOOAOOA07A07A24A24ROOROOA18A26AOOA28A08AOORolAOORolR02R02R02AOOAOOAOOAOOA08AOOAOOAOOAOOAOOAOOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT1.8-11.8-11.8-11.8-11.8-11.8-11~8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-118-118-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11~8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11.8-11~8-11.8-11.8-1Sh79Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh89aSh89bSh90Sh91Sh92Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100Sh101Sh102Sh102aSh103Sh104Sh105Sh106Sh107Sh108Sh108aSh109Sh110Sh111Sh112Sh113Sh114Sh115Sh116Sh117Sh118Sh119Sh120AOOAOOAOOA05AOOA22A13AOOAOOAOOROOROOROOAOOAOOAOOAOOAOOAOOAOOAOOA18ROOAOOAOOROOROOAOOAOOAOOAOORolROOROOAllA28ROOAOOR03A04AOOAOOAOOA08A27A20USARRevision4EP1-3October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number F F F F 1~7 2 l.7-3 1~7 3 1.7-4 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 Sh Sh Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh, 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 20a Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 3la Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 AOO ROO ROO ROO AOO AOO AOO A04 AOO A23 AOO A12 AOO AOO A05 A03 AOO AOO AOO AOO AOO Rol AOO A03 A18 A19 AOO AOO AOO R02 AOO AOO AOO AOO ROO AOO ROO ROO AOO A23 AOO AOO AOO A18 ROO T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1 8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh 38a 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 SSa 56 S6a 56b 57 57a 58 59 60 60a 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 ROO ROO ROO AOO AOO AOO A28 AOO AOO A05 R03 AOO A21 R03 AOO AOO AOO A07 A07 A24 A24 ROO ROO A18 A26 AOO A28 A08 AOO Rol AOO Rol R02 R02 R02 AOO AOO AOO AOO A08 AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1 8-1 1 8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 89a Sh 89b Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 102a Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 108a Sh 109 Sh 110 Sh 111 Sh 112 Sh 113 Sh 114 Sh 115 Sh 116 Sh 117 Sh 118 Sh 119 Sh 120 AOO AOO AOO A05 AOO A22 A13 AOO AOO AOO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO A18 ROO AOO AOO ROO ROO AOO AOO AOO AOO Rol ROO ROO All A28 ROO AOO R03 A04 AOO AOO AOO A08 A27 A20 USAR Revision 4 EP 1-3 October 1992 A g f s I, Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh.T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 155a 156 157 158 159 160 160a 161 162 163 164 AOO R02 AOO AOO AOO AOO AOO AOO AOO ROO AOO A07 AOO AOO AOO AOO ROO A03 A03 AOO AOO AOO AOO AOO A03 AOO AOO A21 R02 AOO AOO A15 AOO AOO A17 A17 A07 A07 AOO AOO ROO ROO Rol ROO AOO ROO ROO A28 A28 AOO ROO T 1 8-1 Sh 165 T 1.8-1 Sh 166 T 1.8-1 Sh 167 T 1.8-1 Sh 168 T 1.8-1 Sh 169 T 1.8-1 Sh 169 T 1.8-1a Sh 1 T 1.8-1a Sh 2..T 1.8-1a Sh 3 T 1.8-1a Sh 4 T 1.8-1a Sh 5 T 1.8-1a Sh 6 T 1.8-1a Sh 7 T 1.8-1a Sh 8 T 1.8-1a Sh 9 T 1.8-1a Sh 10 T 1.8-1a Sh 11 T 1.8-1a Sh 12 T 1.8-1a Sh 13 T 1.8-1a Sh 14 T 1.8-1a Sh 15 T 1.8-1a Sh 16 T 1.8-1a Sh 17 T 1.8-2 Sh 1 T 1.8-2 Sh 2 T 1.8-2 Sh 3 T 1.8-2 Sh 4 T 1.8-2 Sh 5 T 1.8-2 Sh 5a T 1.8-2 Sh 6 T 1.8-2 Sh 7 T 1.8-2 Sh 7a T 1.8-2 Sh 8 T 1.8-2 Sh 9 T 1.8-2 Sh 10 T 1.8-2 Sh 10a T 1.8-2 Sh lob T 1.8-2 Sh 10c T 1.8-2 Sh 11 T 1.8-2 Sh lla T 1.8-2 Sh 12 T 1.8-2 Sh 13 T 1.8-2 Sh 13a=T 1.8-2 Sh 14 F 1.8-1 a ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO AOO AOO AOO AOO A07 All A28 A14 AOO A14 AOO A07 A07 A07 AOO A07 AOO AOO Rol AOO ROO 1.9-1 T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1'Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh Att 1.9-1 Att 1.9-2 Att 1.9-3 Att 1.9-4 Att 1.9-5 Att 1.9-6 Att 1.9-7 Att 1.9-8 Att 1.9-9 Att 1.9-10 Att 1.9-11 Att 1.9-12 Att 1.9-13 Att 1.9-13 Att 1.9-13 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-15 Att 1.9-16 Att 1.9-17 Att 1.9-18 Att 1.9-19 Att 1.9-20 Att 1.9-21 Att 1.9-22 Att 1.9-23 Att 1.9-24 Att 1.9-25 Att 1.9-26 Att 1.9-27 1 2 3 4 5 6 7 8 9 10 11 Sh Sh Sh Sh Sh Sh Sh Sh Sh Aol A07 R03 Aol A18 ROO A23 Rol A26 Aol Aol Aol A07 Aol Aol Aol Aol Aol Aol Aol Aol Aol Aol A05 Aol Aol R03 Aol A12 2aA12 2bA12 Aol R03 A27 Aol Aol A25 Aol Aol Aol Aol Aol Aol Aol Aol Aol USAR Revision 4 EP 1-4 October 1992
: AgfsI, NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER1PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1Sh.T1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT18-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1.8-1ShT1~8-1ShT1.8-1ShT1.8-1Sh121122123124125126127128129130131132133134135136137138139140141142143144145146147148149150151152153154155155a156157158159160160a161162163164AOOR02AOOAOOAOOAOOAOOAOOAOOROOAOOA07AOOAOOAOOAOOROOA03A03AOOAOOAOOAOOAOOA03AOOAOOA21R02AOOAOOA15AOOAOOA17A17A07A07AOOAOOROOROORolROOAOOROOROOA28A28AOOROOT18-1Sh165T1.8-1Sh166T1.8-1Sh167T1.8-1Sh168T1.8-1Sh169T1.8-1Sh169T1.8-1aSh1T1.8-1aSh2..T1.8-1aSh3T1.8-1aSh4T1.8-1aSh5T1.8-1aSh6T1.8-1aSh7T1.8-1aSh8T1.8-1aSh9T1.8-1aSh10T1.8-1aSh11T1.8-1aSh12T1.8-1aSh13T1.8-1aSh14T1.8-1aSh15T1.8-1aSh16T1.8-1aSh17T1.8-2Sh1T1.8-2Sh2T1.8-2Sh3T1.8-2Sh4T1.8-2Sh5T1.8-2Sh5aT1.8-2Sh6T1.8-2Sh7T1.8-2Sh7aT1.8-2Sh8T1.8-2Sh9T1.8-2Sh10T1.8-2Sh10aT1.8-2ShlobT1.8-2Sh10cT1.8-2Sh11T1.8-2ShllaT1.8-2Sh12T1.8-2Sh13T1.8-2Sh13a=T1.8-2Sh14F1.8-1aROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOAOOAOOAOOAOOAOOA07AllA28A14AOOA14AOOA07A07A07AOOA07AOOAOORolAOOROO1.9-1T1.9-1ShT1.9-1ShT1.9-1ShT1.9-1'ShT1.9-1ShT1.9-1ShT1.9-1ShT1.9-1ShT1.9-1ShT1.9-1ShT1.9-1ShAtt1.9-1Att1.9-2Att1.9-3Att1.9-4Att1.9-5Att1.9-6Att1.9-7Att1.9-8Att1.9-9Att1.9-10Att1.9-11Att1.9-12Att1.9-13Att1.9-13Att1.9-13Att1.9-14Att1.9-14Att1.9-14Att1.9-14Att1.9-14Att1.9-14Att1.9-15Att1.9-16Att1.9-17Att1.9-18Att1.9-19Att1.9-20Att1.9-21Att1.9-22Att1.9-23Att1.9-24Att1.9-25Att1.9-26Att1.9-271234567891011ShShShShShShShShShAolA07R03AolA18ROOA23RolA26AolAolAolA07AolAolAolAolAolAolAolAolAolAolA05AolAolR03AolA122aA122bA12AolR03A27AolAolA25AolAolAolAolAolAolAolAolAolUSARRevision4EP1-4October1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTERPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=Ficrure NumberPageT=TableAmendment FFirureNumberShShShShShShAtt1.9-53Att'1.9-54 Att1.9-55Att1.9-56Att1.9-57Att1.9-58Att1.9-59Att1.9-60Att1.9-61Att1.9-61Att1.9-61Att1.9-61Att1.9-61Att1.9-61Att1.9-62Att1.9-63Att1.9-64ShShShshshShAtt1.9-28Att1.9-29Att1.9-30Att1.9-30Att1.9-31Att1.9-32Att1.9-33Att1.9-34Att1.9-35Att1.9-36Att1.9-37Att1.9-37Att1.9-38Att1.9-39Att1.9-40Att1.9-41Att1.9-42Att1.9-42Att1.9-43Att1.9-44Att1.9-45Att1.9-46Att1.9-47Att1.9-48Att1.9-49Att1.9-50Att1.9-51Att1.9-52Att1.9-52aA01ROO1A012A01A01A01A01A01A18A011A272A01A01A01R01A221A052A26A01A01A01A05A23A01A01A01A23A23R04A01A18A01A18A01A01A01A011ROO1aROO1bA272A273A274ROOA21A01A01Att1.9-65Att1.9-66Att1.9-67Att1.9-68ShAtt1.9-68ShAtt1.9-69Att1.9-70Att1.9-71ShAtt1.9-71ShAtt1.9-72Att1.9-73Att1.9-74Att1.9-75Att1.9-76Att1.9-77Att1.9-78Att1.9-79Att1.9-80Att1.9-81Att1.9-82Att1.9-831.10-11.10-21.10-31.10-3a1.10-3b1.10-41'0-51.10-61.10-6a1.10-6b1.10-71.10-81.10-91.10-9a1.10-9b1.10-101.10-111'0-121.10-131.10-13a1.10-13b1.10-141.10-151.10-16A01A01A011A012A01A26A251A012A01A01A01A01A01A01A01A27A01ROOA01A01A01AOOA09A23A23A09A09AOOR04A25A25A23R03R03A17A14R03A23AOOR03R03A09AOOAOOR021.10-171.10-181.10-191.10-19a1.10-19b1.10-201.10-211.10-221.10-231.10-241.10-251.10-261.10-271.10-27a1.10-27b1.10-281.10-291.10-301.10-30a1.10-30b1.10-31110-321.10-331.10-33a1.10-33b1.10-341.10-351.10-35a1.10-35b1.10-361.10-371.10-381.10-391.10-401.10-411.10-421.10-431.10-441.10-451.10-461.10-46a1.10-46b1.10-471.10-47a1.10-47b1.10-48AOOROOR03R03A09AOOAOOAOOAOOR03A23A17A23A23A23R03R03A23A23A14AOOAOOR04R04A14A23A14A14A14A23A23R03ROOAOOAOOAOOAOOAOOAOOA03ROOA03A23A23A14A23USARRevisionEP1-5October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Firure Number Sh Sh Sh Sh Sh Sh Att 1.9-53 Att'1.9-54 Att 1.9-55 Att 1.9-56 Att 1.9-57 Att 1.9-58 Att 1.9-59 Att 1.9-60 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-62 Att 1.9-63 Att 1.9-64 Sh Sh Sh sh sh Sh Att 1.9-28 Att 1.9-29 Att 1.9-30 Att 1.9-30 Att 1.9-31 Att 1.9-32 Att 1.9-33 Att 1.9-34 Att 1.9-35 Att 1.9-36 Att 1.9-37 Att 1.9-37 Att 1.9-38 Att 1.9-39 Att 1.9-40 Att 1.9-41 Att 1.9-42 Att 1.9-42 Att 1.9-43 Att 1.9-44 Att 1.9-45 Att 1.9-46 Att 1.9-47 Att 1.9-48 Att 1.9-49 Att 1.9-50 Att 1.9-51 Att 1.9-52 Att 1.9-52a A01 ROO 1 A01 2 A01 A01 A01 A01 A01 A18 A01 1 A27 2 A01 A01 A01 R01 A22 1 A05 2 A26 A01 A01 A01 A05 A23 A01 A01 A01 A23 A23 R04 A01 A18 A01 A18 A01 A01 A01 A01 1 ROO 1aROO 1bA27 2 A27 3 A27 4 ROO A21 A01 A01 Att 1.9-65 Att 1.9-66 Att 1.9-67 Att 1.9-68 Sh Att 1.9-68 Sh Att 1.9-69 Att 1.9-70 Att 1.9-71 Sh Att 1.9-71 Sh Att 1.9-72 Att 1.9-73 Att 1.9-74 Att 1.9-75 Att 1.9-76 Att 1.9-77 Att 1.9-78 Att 1.9-79 Att 1.9-80 Att 1.9-81 Att 1.9-82 Att 1.9-83 1.10-1 1.10-2 1.10-3 1.10-3a 1.10-3b 1.10-4 1'0-5 1.10-6 1.10-6a 1.10-6b 1.10-7 1.10-8 1.10-9 1.10-9a 1.10-9b 1.10-10 1.10-11 1'0-12 1.10-13 1.10-13a 1.10-13b 1.10-14 1.10-15 1.10-16 A01 A01 A01 1 A01 2 A01 A26 A25 1 A01 2 A01 A01 A01 A01 A01 A01 A01 A27 A01 ROO A01 A01 A01 AOO A09 A23 A23 A09 A09 AOO R04 A25 A25 A23 R03 R03 A17 A14 R03 A23 AOO R03 R03 A09 AOO AOO R02 1.10-17 1.10-18 1.10-19 1.10-19a 1.10-19b 1.10-20 1.10-21 1.10-22 1.10-23 1.10-24 1.10-25 1.10-26 1.10-27 1.10-27a 1.10-27b 1.10-28 1.10-29 1.10-30 1.10-30a 1.10-30b 1.10-31 1 10-32 1.10-33 1.10-33a 1.10-33b 1.10-34 1.10-35 1.10-35a 1.10-35b 1.10-36 1.10-37 1.10-38 1.10-39 1.10-40 1.10-41 1.10-42 1.10-43 1.10-44 1.10-45 1.10-46 1.10-46a 1.10-46b 1.10-47 1.10-47a 1.10-47b 1.10-48 AOO ROO R03 R03 A09 AOO AOO AOO AOO R03 A23 A17 A23 A23 A23 R03 R03 A23 A23 A14 AOO AOO R04 R04 A14 A23 A14 A14 A14 A23 A23 R03 ROO AOO AOO AOO AOO AOO AOO A03 ROO A03 A23 A23 A14 A23 USAR Revision EP 1-5 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTERPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number1.10-491.10-501.10-511.10-51a1.10-51b1.10-521.10-531.10-541.10-551.10-561.10-571.10-57a1.10-57b1.10-581.10-58a1.10-58b1.10-591.10-601.10-611.10-621.10-631.10-641.10-64a1.10-64b1.10-64c1.10-64d1.10-64e1.10-64f1.10-64fa 1.10-64fb 1.10-64g1.10-64ga 1.10-64gb 1.10-64h1.10-64i1.10-64ia 1.10-64ib 1.10-64j1.10-64]Q 1.10-64L1.10-64m1.10-64n1.10-64o1e10-64PTII.B.3-1TII.B.3-1ShShAOOAOOA05A05A05AOOAOOAOOAOOA23A13A13A13A13A13A13A25A07R01A23A07A26A07A20A23A23A10ROOA10A10A10A10A10A27A28A10A10A07A10A10A23A23A07A07ROOROOTII~B.3-2FII-B.3-1ShFII.B.3-1ShFZI.B.3-1a FZI.B.3-2FII'.3-3FII.B.3-4FII.B.3-5FII.B.3-61.10-651.10-661.10-671.10-681.10-691.10-69a1.10-69b1.10-69b.1 1.10-69b.2 1.10-69c1.10-69d1.10-69e1.10-69f1.10-69g1.10-69h1.10-69i1.10-69j1e10-69]%
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 1.10-49 1.10-50 1.10-51 1.10-51a 1.10-51b 1.10-52 1.10-53 1.10-54 1.10-55 1.10-56 1.10-57 1.10-57a 1.10-57b 1.10-58 1.10-58a 1.10-58b 1.10-59 1.10-60 1.10-61 1.10-62 1.10-63 1.10-64 1.10-64a 1.10-64b 1.10-64c 1.10-64d 1.10-64e 1.10-64f 1.10-64fa 1.10-64fb 1.10-64g 1.10-64ga 1.10-64gb 1.10-64h 1.10-64i 1.10-64ia 1.10-64ib 1.10-64j 1.10-64]Q 1.10-64L 1.10-64m 1.10-64n 1.10-64o 1e10-64P T II.B.3-1 T II.B.3-1 Sh Sh AOO AOO A05 A05 A05 AOO AOO AOO AOO A23 A13 A13 A13 A13 A13 A13 A25 A07 R01 A23 A07 A26 A07 A20 A23 A23 A10 ROO A10 A10 A10 A10 A10 A27 A28 A10 A10 A07 A10 A10 A23 A23 A07 A07 ROO ROO T II~B.3-2 F II-B.3-1 Sh F II.B.3-1 Sh F ZI.B.3-1a F ZI.B.3-2 F II'.3-3 F II.B.3-4 F II.B.3-5 F II.B.3-6 1.10-65 1.10-66 1.10-67 1.10-68 1.10-69 1.10-69a 1.10-69b 1.10-69b.1 1.10-69b.2 1.10-69c 1.10-69d 1.10-69e 1.10-69f 1.10-69g 1.10-69h 1.10-69i 1.10-69j 1e10-69]%1.10-69L 1.10-69m 1.10-69n 1.10-70 1.10-70a 1.10-70b 1.10-71 1.10-72 1.10-73 1.10-73a 1.10-73a1 1.10-73a2 1.10-73b 1.10-73c 1.10-73ca 1.10-73cb 1.10-73d 1.10-73e 1.10-73f ROO 1 A23 2 A23 ROO A07 A20 A20 A20 A20 A23 A23 AOO A13 ROO A23 A23 A23 A23 A15 A15 A15 A15 A15 A15 A15 A15 A15 R03 A15 A15 A10 A10 A10 AOO AOO A04 A23 A23 A23 A23 A28 A08 A08 A24 A23 A22 1.10-73g 1.10-73h 1.10-73i 1.10-73j 1.10-73ja 1.10-73jb 1e10-73)(1.10-73L 1.10-73m T II.E.4'-1 Sh 1 T II.E.4.2-1 Sh 1a T II E.4'-1 Sh 2 T II E.4-2-1 Sh 3 1.10-73n 1.10-74 1.10-75 1.10-76 1.10-77 1.10-78 1.10-79 1.10-80 1.10-80a 1.10-80b 1.10-81 1.10-82 1.10-83 1.10-84 1.10-84a 1.10-84b 1.10-84c 1.10-84d 1.10-85 1.10-85.1 1.10-85.2 1.10-85a 1.10-85a1 1.10-85a2 1.10-85b 1.10-85c 1.10-85d 1.10-85e 1.10-85f A23 A22 A22 A22 A23 A08 A23 A22 A22 A24 A24 A08 A08 A04 A23 AOO A23 AOO AOO AOO R01 A13 A13 A23 AOO AOO R03 ROO ROO ROO ROO A23 A23 A23 A23 A23 A23 R03 R03 R03 A15 R03 USAR Revision EP 1-6 October 1992
1.10-69L1.10-69m1.10-69n1.10-701.10-70a1.10-70b1.10-711.10-721.10-731.10-73a1.10-73a1 1.10-73a2 1.10-73b1.10-73c1.10-73ca 1.10-73cb 1.10-73d1.10-73e1.10-73fROO1A232A23ROOA07A20A20A20A20A23A23AOOA13ROOA23A23A23A23A15A15A15A15A15A15A15A15A15R03A15A15A10A10A10AOOAOOA04A23A23A23A23A28A08A08A24A23A221.10-73g1.10-73h1.10-73i1.10-73j1.10-73ja 1.10-73jb 1e10-73)(
1.10-73L1.10-73mTII.E.4'-1Sh1TII.E.4.2-1 Sh1aTIIE.4'-1Sh2TIIE.4-2-1Sh31.10-73n1.10-741.10-751.10-761.10-771.10-781.10-791.10-801.10-80a1.10-80b1.10-811.10-821.10-831.10-841.10-84a1.10-84b1.10-84c1.10-84d1.10-851.10-85.1 1.10-85.2 1.10-85a1.10-85a1 1.10-85a2 1.10-85b1.10-85c1.10-85d1.10-85e1.10-85fA23A22A22A22A23A08A23A22A22A24A24A08A08A04A23AOOA23AOOAOOAOOR01A13A13A23AOOAOOR03ROOROOROOROOA23A23A23A23A23A23R03R03R03A15R03USARRevisionEP1-6October1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER1PageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=Ficrure Numberle10-85g1elo-8541.10-861.10-871.10-881.10-891.10-901.10-90a1~10-90b110-911.10-921.10-92a1.10-92b1.10-931.10-941.10-951.10-961.10-971.10-981.10-991.10-99a1.10-99b1~10-99c1-10-99d1.10-1001.10-1011.10-1021.10-1031.10-1041.10-1051.10-106110-1071.10-1081.10-1091.10-1101-10-1111.10-1121-10-1131.10-1141.10-1151-10-1161-10-1171-10-1181.10-1191.10-1201.10-121A23A15A27AOOA23AOOR03ROOA09A27AloAloAloR02AOOA27A27ROOA23A19A19R04R04R04AOOA27AOOAOOA13AOOAOORolR01A23A23A23A23A23A23A23A23A23A23A23A23R011.10-1221.10-1231.10-1241.10-1251.10-1261.10-1271.10-1281.10-1291.10-1301.10-1311.10-1321.10-1331.11-1T1~11-1T1.11-1T1.11-1T1.11-1T1.11-1T1.11-11~12-11.12-21.12-31~12-41.12-51~12-61.12-6a1.12-6b1~12-71.12-81.12-91.12-101.12-111.12-1la1.12-11b1.12-121.12-131.12-141.12-151.12-161.12-171.12-181.12-191.12-201.12-21Sh1S?12Sh3Sh4S115S?16AOORolA23A18A15AOOAOOAOOAOOAOOR04R04AOOAOOAOORolR03R03R03A03A03A03A03A03A18A18A18A03A03A03A03R03R04R04A03R03A23A23A03A28A03A03A03A281.12-221.12-231.12-241~12-251.12-261.12-27112-281.12-291.12-301.12-31112-321.12-32a1~12-32b1012-331.12-341.12-351.12-361~1237112-381~12-391.12-401.12-411.12-421~13-11.13-21~1331.13-41.13-51.13-61~13-71.13-81.13-91.13-101.13-111.13-121.13-131.13-141.13-151.13-161.13-171.13-181.13-191.13-201~13-211~13-22A03A03A03A03A03A03A03A03A03A03R02R02R02A04A04A04A04A27A04A04A04A04A04R04A09A09A09R04R04R04R04A09R04R04R04R04R04R04R04R04R04R04R04R04R04USARRevision4EP1-7October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number le10-85g 1elo-854 1.10-86 1.10-87 1.10-88 1.10-89 1.10-90 1.10-90a 1~10-90b 1 10-91 1.10-92 1.10-92a 1.10-92b 1.10-93 1.10-94 1.10-95 1.10-96 1.10-97 1.10-98 1.10-99 1.10-99a 1.10-99b 1~10-99c 1-10-99d 1.10-100 1.10-101 1.10-102 1.10-103 1.10-104 1.10-105 1.10-106 1 10-107 1.10-108 1.10-109 1.10-110 1-10-111 1.10-112 1-10-113 1.10-114 1.10-115 1-10-116 1-10-117 1-10-118 1.10-119 1.10-120 1.10-121 A23 A15 A27 AOO A23 AOO R03 ROO A09 A27 Alo Alo Alo R02 AOO A27 A27 ROO A23 A19 A19 R04 R04 R04 AOO A27 AOO AOO A13 AOO AOO Rol R01 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 R01 1.10-122 1.10-123 1.10-124 1.10-125 1.10-126 1.10-127 1.10-128 1.10-129 1.10-130 1.10-131 1.10-132 1.10-133 1.11-1 T 1~11-1 T 1.11-1 T 1.11-1 T 1.11-1 T 1.11-1 T 1.11-1 1~12-1 1.12-2 1.12-3 1~12-4 1.12-5 1~12-6 1.12-6a 1.12-6b 1~12-7 1.12-8 1.12-9 1.12-10 1.12-11 1.12-1la 1.12-11b 1.12-12 1.12-13 1.12-14 1.12-15 1.12-16 1.12-17 1.12-18 1.12-19 1.12-20 1.12-21 Sh 1 S?1 2 Sh 3 Sh 4 S11 5 S?1 6 AOO Rol A23 A18 A15 AOO AOO AOO AOO AOO R04 R04 AOO AOO AOO Rol R03 R03 R03 A03 A03 A03 A03 A03 A18 A18 A18 A03 A03 A03 A03 R03 R04 R04 A03 R03 A23 A23 A03 A28 A03 A03 A03 A28 1.12-22 1.12-23 1.12-24 1~12-25 1.12-26 1.12-27 1 12-28 1.12-29 1.12-30 1.12-31 1 12-32 1.12-32a 1~12-32b 1012-33 1.12-34 1.12-35 1.12-36 1~12 37 1 12-38 1~12-39 1.12-40 1.12-41 1.12-42 1~13-1 1.13-2 1~13 3 1.13-4 1.13-5 1.13-6 1~13-7 1.13-8 1.13-9 1.13-10 1.13-11 1.13-12 1.13-13 1.13-14 1.13-15 1.13-16 1.13-17 1.13-18 1.13-19 1.13-20 1~13-21 1~13-22 A03 A03 A03 A03 A03 A03 A03 A03 A03 A03 R02 R02 R02 A04 A04 A04 A04 A27 A04 A04 A04 A04 A04 R04 A09 A09 A09 R04 R04 R04 R04 A09 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 USAR Revision 4 EP 1-7 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER1PagePagePageT=TableAmendment T=TableAmendment T=TableAmendment, F=FicFure NumberF=FicFure NumberF=FicFure Number1~13231.13-24R04A09USARRevision4EP1-8October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment, F=FicFure Number F=FicFure Number F=FicFure Number 1~13 23 1.13-24 R04 A09 USAR Revision 4 EP 1-8 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER2PAGESPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment FFicFureNumber23.2-ii2-iia2-iib2-lil2-iiia2-iiib2-3.V2-V2-V3.2-Vll2-viia2-viib2-Vii3.2-vi3.ia2-viiib2-lx2-X2-Xi2-xia2-xib2-X3.3.2-xiia2-xiib2-Xlll2-xiiia2-xiiib2-XiV2-XV2-XV3.2-XVi3.2-XViii2-xviiia2-xviiib2-Xlx2-xixa2-xixb2-XX2-XXi2-xxia2-xxib2-XX3.3.2-XX3.i3.2-XX3.V2-XXV2-XXV3.R04A24A24A24ROOA24A24ROOA24AOOA24A24A24R04ROOA14A07R02A24ROOA03A24A24A24A24A24A15ROOAOOAOOAOOA05ROOA05A26A26A03A24A13A13A13AOOA24A24A24A242-xxvia2-xxvib2-XXV112-XXVii3.2-XX3.X2XXX2-XXX3.2-XXXi3.2.1-12~122~132~13a2.1-3b2.1-42.1-52.1-62.1-6a2.1-6b2~172~17a2.1-7b2.1-82.1-9T2'-1T2'-2T2~13T2.1-4T2.1-5T2.1-6T2.1-7T2'-8T2.1-9T2.1-10T2'-11T2.1-12T2'-13T2.1-14T2.1-15T2.1-16T2~117T2.1-18T2'-19T2.1-20T2.1-21T2.1-22A26A11A24A24A24A24A24A24ROOR04ROOA04A04ROOA07A07A07A07ROOROOA11A11A07R04A28A28A07A07A07A07A07A07A07A07A07A07A07A07A07A07AOOA07A07A07A07F2.1-1F2.1-2F2.1-3F2.1-4F2.1-5F2.1-6F2.1-7F2.1-8F2.1-9FF1-10F2'-11.F2'-12F2'-13F2'-14F2.1-15F2.1-16F2.1-17F2.1-18F2.1-19F2.1-202~212~222~232~2-42'-52.2-5a2.2-5b2.2-62~272.2-82'-92.2-102.2-11T2.2-1T2.2-2T2.2-3T2.2-4S?11T2.2-4S112T2'-4S113T2.2-5Sh1T2.2-5Sll2T2'-6T2.2-7T2.2-8T2.2-9A13ROOROOA07A07A07A07A07A07A07A07A07A07A07A07A07A07A07AOOA11A19R02R02A26A03A03ROOR02R04R04R02A03ROOA25AOOR02A25A25AOOR02ROOAOOR02R02A28USARRevision4EP2-1October1992 E
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 2 PAGES Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F FicFure Number 2 3.2-ii 2-iia 2-iib 2-lil 2-iiia 2-iiib 2-3.V 2-V 2-V3.2-Vll 2-viia 2-viib 2-Vii3.2-vi3.ia 2-viiib 2-lx 2-X 2-Xi 2-xia 2-xib 2-X3.3.2-xiia 2-xiib 2-Xlll 2-xiiia 2-xiiib 2-XiV 2-XV 2-XV3.2-XVi 3.2-XViii 2-xviiia 2-xviiib 2-Xlx 2-xixa 2-xixb 2-XX 2-XXi 2-xxia 2-xxib 2-XX3.3.2-XX3.i 3.2-XX3.V 2-XXV 2-XXV3.R04 A24 A24 A24 ROO A24 A24 ROO A24 AOO A24 A24 A24 R04 ROO A14 A07 R02 A24 ROO A03 A24 A24 A24 A24 A24 A15 ROO AOO AOO AOO A05 ROO A05 A26 A26 A03 A24 A13 A13 A13 AOO A24 A24 A24 A24 2-xxvia 2-xxvib 2-XXV1 1 2-XXVi i 3.2-XX3.X 2 XXX 2-XXX3.2-XXXi3.2.1-1 2~1 2 2~1 3 2~1 3a 2.1-3b 2.1-4 2.1-5 2.1-6 2.1-6a 2.1-6b 2~1 7 2~1 7a 2.1-7b 2.1-8 2.1-9 T 2'-1 T 2'-2 T 2~1 3 T 2.1-4 T 2.1-5 T 2.1-6 T 2.1-7 T 2'-8 T 2.1-9 T 2.1-10 T 2'-11 T 2.1-12 T 2'-13 T 2.1-14 T 2.1-15 T 2.1-16 T 2~1 17 T 2.1-18 T 2'-19 T 2.1-20 T 2.1-21 T 2.1-22 A26 A11 A24 A24 A24 A24 A24 A24 ROO R04 ROO A04 A04 ROO A07 A07 A07 A07 ROO ROO A11 A11 A07 R04 A28 A28 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO A07 A07 A07 A07 F 2.1-1 F 2.1-2 F 2.1-3 F 2.1-4 F 2.1-5 F 2.1-6 F 2.1-7 F 2.1-8 F 2.1-9 F F 1-10 F 2'-11.F 2'-12 F 2'-13 F 2'-14 F 2.1-15 F 2.1-16 F 2.1-17 F 2.1-18 F 2.1-19 F 2.1-20 2~2 1 2~2 2 2~2 3 2~2-4 2'-5 2.2-5a 2.2-5b 2.2-6 2~2 7 2.2-8 2'-9 2.2-10 2.2-11 T 2.2-1 T 2.2-2 T 2.2-3 T 2.2-4 S?1 1 T 2.2-4 S11 2 T 2'-4 S11 3 T 2.2-5 Sh 1 T 2.2-5 Sll 2 T 2'-6 T 2.2-7 T 2.2-8 T 2.2-9 A13 ROO ROO A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO A11 A19 R02 R02 A26 A03 A03 ROO R02 R04 R04 R02 A03 ROO A25 AOO R02 A25 A25 AOO R02 ROO AOO R02 R02 A28 USAR Revision 4 EP 2-1 October 1992 E
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFFreAmendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberF2.2-12~312~322~332.3-42'-52.3-5a2.3-5b2.3-62~372~3-82.3-8a2'-8b2.3-8c2'-Sd2'-92.3-102.3-10a2.3-10b2'-112.3-11a2-3-11b2'-122~3132.3-142.3-152.3-162~3172'-182.3-192.3-19a2'-19b2-3-2023-212~3222~3232'-242.3-252.3-262.3-26a2.3-26b2~3272.3-282'-292.3-30A09AOOAOOAOOAOOA05A05A05A23AOOA22A22A19A22A19A10A10A05A05A05A05A05AOOAOOAOOAOOAOOA26AOOA05A05A05A03AOOAOOAOOA26A19A03A03A03A26A26AOOAOO2~3312~3322~332a2.3-32b2~3332~333a2.3-33b2.3-342.3-34a2'-34b2'-352.3-35a2.3-35b2.3-362~3372'-382'-392.3-402.3-412'-422'-432'-442.3-452'-462.3-472'-482'-492.3-502'-512.3-51a2.3-51b2.3-522.3-532'-542'-5523-562'-572'-582'-592.3-602'-612.3-622.3-62a2'-62bT2~31T2~32A03R02ROOROOA23A23A23ROOA13A13A13A13A13A13AOOA26A23A23A26A13A23A13A13A23ROOA03AOOAOOA23A23A23AOOAOOROOAOOAOOAOOAOOA10A13A13A19R02A19AOOAOOTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2~332.3-4Sh12.3-4Sh22.3-4a2.3-5Sh12.3-5Sh22.3-5aSh12.3-5aSh22.3-62~372~312~322~332.3-42.3-52.3-62~372.3-82.3-92.3-102~3112.3-122~3132.3-142.3-152.3-162~3172.3-182.3-192.3-202~3212~3222~3232.3-242.3-252.3-262~3272.3-282.3-292.3-302.3-312~3322~3332.3-342.3-352.3-36AOOAOOAOOR01AOOAOOROOROOA05A19AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=F icFFre Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 2.2-1 2~3 1 2~3 2 2~3 3 2.3-4 2'-5 2.3-5a 2.3-5b 2.3-6 2~3 7 2~3-8 2.3-8a 2'-8b 2.3-8c 2'-Sd 2'-9 2.3-10 2.3-10a 2.3-10b 2'-11 2.3-11a 2-3-11b 2'-12 2~3 1 3 2.3-14 2.3-15 2.3-16 2~3 17 2'-18 2.3-19 2.3-19a 2'-19b 2-3-20 2 3-21 2~3 22 2~3 23 2'-24 2.3-25 2.3-26 2.3-26a 2.3-26b 2~3 27 2.3-28 2'-29 2.3-30 A09 AOO AOO AOO AOO A05 A05 A05 A23 AOO A22 A22 A19 A22 A19 A10 A10 A05 A05 A05 A05 A05 AOO AOO AOO AOO AOO A26 AOO A05 A05 A05 A03 AOO AOO AOO A26 A19 A03 A03 A03 A26 A26 AOO AOO 2~3 3 1 2~3 32 2~3 3 2 a 2.3-32b 2~3 3 3 2~3 33a 2.3-33b 2.3-34 2.3-34a 2'-34b 2'-35 2.3-35a 2.3-35b 2.3-36 2~3 37 2'-38 2'-39 2.3-40 2.3-41 2'-42 2'-43 2'-44 2.3-45 2'-46 2.3-47 2'-48 2'-49 2.3-50 2'-51 2.3-51a 2.3-51b 2.3-52 2.3-53 2'-54 2'-55 2 3-56 2'-57 2'-58 2'-59 2.3-60 2'-61 2.3-62 2.3-62a 2'-62b T 2~3 1 T 2~3 2 A03 R02 ROO ROO A23 A23 A23 ROO A13 A13 A13 A13 A13 A13 AOO A26 A23 A23 A26 A13 A23 A13 A13 A23 ROO A03 AOO AOO A23 A23 A23 AOO AOO ROO AOO AOO AOO AOO A10 A13 A13 A19 R02 A19 AOO AOO T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2~3 3 2.3-4 Sh 1 2.3-4 Sh 2 2.3-4a 2.3-5 Sh 1 2.3-5 Sh 2 2.3-5a Sh 1 2.3-5a Sh 2 2.3-6 2~3 7 2~3 1 2~3 2 2~3 3 2.3-4 2.3-5 2.3-6 2~3 7 2.3-8 2.3-9 2.3-10 2~3 1 1 2.3-12 2~3 13 2.3-14 2.3-15 2.3-16 2~3 17 2.3-18 2.3-19 2.3-20 2~3 2 1 2~3 2 2 2~3 23 2.3-24 2.3-25 2.3-26 2~3 27 2.3-28 2.3-29 2.3-30 2.3-31 2~3 32 2~3 33 2.3-34 2.3-35 2.3-36 AOO AOO AOO R01 AOO AOO ROO ROO A05 A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-2 October 1992
'8 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=Table~F=F'reAmendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=Ficrure NumberF2.3-37F2.3-38F2.3-39F2.3-40F2.3-40aF2.3-41F2.3-42F2'-43F2'-44F2.3-45F2.3-462.4-12'4-22.4-32.4-3a2.4-3b2'-42'-4a2.4-4b2'-52.4-5a2'-5b2.4-62'-72.4-82.4-92.4-102.4-112.4-122.4-12a2.4-12b2.4-132'-13a2.4-13b2.4-142.4-14a2.4-14b2.4-152.4-15a2'-15b2.4-162.4-16a2.4-16b2.4-172.4-18AOOAOOAOOA05A05A03A03A03A03A03A03AOOAOOA03A03A03ROOROOROOA26A26A26A25R04AOOAOOA26AOOROOROOROOROOA26A26A26A26A26R04ROOROOROOROOA23R04R042.4-192.4-202.4-212.4-222.4-232.4-242.4-252.4-262.4-272'-282.4-2924-302.4-312.4-322.4-332'-342.4-352.4-362'-36a2.4-36b2.4-372.4-382.4-392.4-402.4-412'-422.4-432.4-44T2.4-1T2.4-2T2.4-3T2'-4T2.4-5T2.4-6T2.4-7T2.4-8T2.4-9T2.4-10T2.4-10T2.4-10T2.4-11T2.4-11T2.4-11T2.4-11T2.4-12T2.4-13S?11Sh2Sh3S?11Sh2S?13Sh4A03AOOA26R01A25AOOAOOAOOAOOA27AOOAOOAOOAOOAOOAOOAOOA19A19A19A26AOOAOOA05A26AOOAOOA25AOOAOOA26AOOAOOAOOAOOAOOA04AOOAOOAOOA03A03A03A03A03A03T2.4-14T2.4-15T2'-15F2.4-1F2.4-2F2.4-3F2.4-4F2.4-5F2.4-6F2.4-7,F2.4-8aF2.4-8bF2.4-9F2.4-10F2'-11F2'-12F2'-13F2.4-14F2'-15F2.4-16F2.4-17F2'-182.5-12.5-1a2.5-1b2.5-22.5-32.5-42.5-52.5-5a2.5-5b2.5-62.5-72.5-82.5-92.5-102.5-112.5-122.5-132.5-142.5-152.5-162.5-172.5-182.5-19ShS?1A03R02R02ROOA08AOOA26AOOA26AOOROOROOAOOA08AOOAOOAOOAOOAOOA03A03A26A04A25A04AOOAOOAOOA28A28A28AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-3October1992 b'
'8 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table~F=F're Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficrure Number F 2.3-37 F 2.3-38 F 2.3-39 F 2.3-40 F 2.3-40a F 2.3-41 F 2.3-42 F 2'-43 F 2'-44 F 2.3-45 F 2.3-46 2.4-1 2'4-2 2.4-3 2.4-3a 2.4-3b 2'-4 2'-4a 2.4-4b 2'-5 2.4-5a 2'-5b 2.4-6 2'-7 2.4-8 2.4-9 2.4-10 2.4-11 2.4-12 2.4-12a 2.4-12b 2.4-13 2'-13a 2.4-13b 2.4-14 2.4-14a 2.4-14b 2.4-15 2.4-15a 2'-15b 2.4-16 2.4-16a 2.4-16b 2.4-17 2.4-18 AOO AOO AOO A05 A05 A03 A03 A03 A03 A03 A03 AOO AOO A03 A03 A03 ROO ROO ROO A26 A26 A26 A25 R04 AOO AOO A26 AOO ROO ROO ROO ROO A26 A26 A26 A26 A26 R04 ROO ROO ROO ROO A23 R04 R04 2.4-19 2.4-20 2.4-21 2.4-22 2.4-23 2.4-24 2.4-25 2.4-26 2.4-27 2'-28 2.4-29 2 4-30 2.4-31 2.4-32 2.4-33 2'-34 2.4-35 2.4-36 2'-36a 2.4-36b 2.4-37 2.4-38 2.4-39 2.4-40 2.4-41 2'-42 2.4-43 2.4-44 T 2.4-1 T 2.4-2 T 2.4-3 T 2'-4 T 2.4-5 T 2.4-6 T 2.4-7 T 2.4-8 T 2.4-9 T 2.4-10 T 2.4-10 T 2.4-10 T 2.4-11 T 2.4-11 T 2.4-11 T 2.4-11 T 2.4-12 T 2.4-13 S?1 1 Sh 2 Sh 3 S?1 1 Sh 2 S?1 3 Sh 4 A03 AOO A26 R01 A25 AOO AOO AOO AOO A27 AOO AOO AOO AOO AOO AOO AOO A19 A19 A19 A26 AOO AOO A05 A26 AOO AOO A25 AOO AOO A26 AOO AOO AOO AOO AOO A04 AOO AOO AOO A03 A03 A03 A03 A03 A03 T 2.4-14 T 2.4-15 T 2'-15 F 2.4-1 F 2.4-2 F 2.4-3 F 2.4-4 F 2.4-5 F 2.4-6 F 2.4-7, F 2.4-8a F 2.4-8b F 2.4-9 F 2.4-10 F 2'-11 F 2'-12 F 2'-13 F 2.4-14 F 2'-15 F 2.4-16 F 2.4-17 F 2'-18 2.5-1 2.5-1a 2.5-1b 2.5-2 2.5-3 2.5-4 2.5-5 2.5-5a 2.5-5b 2.5-6 2.5-7 2.5-8 2.5-9 2.5-10 2.5-11 2.5-12 2.5-13 2.5-14 2.5-15 2.5-16 2.5-17 2.5-18 2.5-19 Sh S?1 A03 R02 R02 ROO A08 AOO A26 AOO A26 AOO ROO ROO AOO A08 AOO AOO AOO AOO AOO A03 A03 A26 A04 A25 A04 AOO AOO AOO A28 A28 A28 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-3 October 1992 b'
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment FFicFureNumber2.5-202.5-212.5-222.5-22a2.5-22b2.5-232.5-242.5-252.5-262.5-272.5-282'-292.5-302.5-312.5-322.5-332.5-342.5-352.5-362.5-372.5-382.5-392.5-402.5-412.5-422.5-432.5-442.5-452.5-462.5-472.5-482.5-492.5-502.5-512.5-522.5-532.5-542.5-552.5-562.5-572.5-582.5-592.5-602.5-612.5-622.5-63AOOAOOROOROOROOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA26AOOAOOAOOAOOAOOROOAOOAOOAOOAOOROOROOROOROOROOAOOAOOROOAOOA04ROO2.5-642.5-652.5-662.5-672.5-682.5-692.5-702.5-712.5-722.5-732.5-742.5-752.5-762.5-772.5-782.5-792.5-802.5-812.5-822.5-832.5-842.5-852.5-862.5-872.5-882.5-892.5-902.5-912.5-922.5-932.5-942.5-952.5-962.5-972.5-982.5-992.5-1002.5-1012.5-1022.5-1032'-1042.5-1052.5-1062.5-1072.5-1082.5-109ROOROOAOOAOOAOOAOOAOOAOOROOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOROOROOAOOROOAOOAOOAOOAOOROOAOOAOOAOOAOOAOOAOOA26AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOO2.5-1102.5-1112.5-1122.5-1132.5-1142.5-1152.5-1162.5-1172.5-1182.5-1192.5-1202.5-1212.5-1222.5-1232.5-1242.5-1252.5-1262.5-1272.5-1282.5-1292'-1302.5-1312.5-1322.5-1332.5-1342.5-1352.5-1362.5-1372.5-1382.5-1392.5-1402.5-1412'-1422.5-1432.5-1442.5-1452.5-1462.5-1472.5-1482.5-1492'-1502.5-1512.5-1522.5-1532.5-1542.5-155AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOROOROOROOAOOROOAOOAOOROOA28AOOAOOAOOAOOA04AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA26AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-4October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F FicFure Number 2.5-20 2.5-21 2.5-22 2.5-22a 2.5-22b 2.5-23 2.5-24 2.5-25 2.5-26 2.5-27 2.5-28 2'-29 2.5-30 2.5-31 2.5-32 2.5-33 2.5-34 2.5-35 2.5-36 2.5-37 2.5-38 2.5-39 2.5-40 2.5-41 2.5-42 2.5-43 2.5-44 2.5-45 2.5-46 2.5-47 2.5-48 2.5-49 2.5-50 2.5-51 2.5-52 2.5-53 2.5-54 2.5-55 2.5-56 2.5-57 2.5-58 2.5-59 2.5-60 2.5-61 2.5-62 2.5-63 AOO AOO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO AOO ROO AOO A04 ROO 2.5-64 2.5-65 2.5-66 2.5-67 2.5-68 2.5-69 2.5-70 2.5-71 2.5-72 2.5-73 2.5-74 2.5-75 2.5-76 2.5-77 2.5-78 2.5-79 2.5-80 2.5-81 2.5-82 2.5-83 2.5-84 2.5-85 2.5-86 2.5-87 2.5-88 2.5-89 2.5-90 2.5-91 2.5-92 2.5-93 2.5-94 2.5-95 2.5-96 2.5-97 2.5-98 2.5-99 2.5-100 2.5-101 2.5-102 2.5-103 2'-104 2.5-105 2.5-106 2.5-107 2.5-108 2.5-109 ROO ROO AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO AOO ROO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2.5-110 2.5-111 2.5-112 2.5-113 2.5-114 2.5-115 2.5-116 2.5-117 2.5-118 2.5-119 2.5-120 2.5-121 2.5-122 2.5-123 2.5-124 2.5-125 2.5-126 2.5-127 2.5-128 2.5-129 2'-130 2.5-131 2.5-132 2.5-133 2.5-134 2.5-135 2.5-136 2.5-137 2.5-138 2.5-139 2.5-140 2.5-141 2'-142 2.5-143 2.5-144 2.5-145 2.5-146 2.5-147 2.5-148 2.5-149 2'-150 2.5-151 2.5-152 2.5-153 2.5-154 2.5-155 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO ROO AOO ROO AOO AOO ROO A28 AOO AOO AOO AOO A04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-4 October 1992
'
'
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number2.5-1562.5-1572.5-1582.5-1592.5-1602.5-1612.5-1622.5-1632.5-1642.5-1652.5-1662.5-1672.5-167a2.5-167b2.5-167c2.5-167d2.5-1682.5-168a2.5-168b2.5-168c2.5-168d2.5-1692.5-1702.5-1712.5-171a2.5-171b2.5-1722.5-1732.5-173a2.5-173b2.5-1742.5-174a2.5-174b2.5-174c2.5-174d2.5-1752.5-1762.5-176a'2.5-176b 2.5-1772.5-177a2.5-177b2.5-177c2.5-177d2.5-1782.5-178aAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA27A05ROOA05A05A18A05A05A05A05AOOAOOR01ROOA05AOOROOROOROOROOA15A15A15A15A11A11A05A05A05A18ROOROOROOA18A122.5-178b2.5-178c2.5-178d2.5-1792.5-1802.5-1812.5-1822.5-1832.5-1842.5-1852.5-1862.5-1872.5-1882.5-1892.5-1902'-1912.5-1922.5-192a2.5-192b2.5-1932.5-1942.5-194.1 2'-194.22.5-194a2.5-194b2.5-194c2.5-194d2.5-194e2.5-194f2.5-194g2.5-194?1 2.5-194i2.5-194j2.5-194k2.5-194L2.5-1952.5-1962.5-1972.5-1982.5-1992.5-2002.5-2012.5-2022.5-2032.5-2042.5-205A12ROOA12A12ROOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA15R04A11AOOROOA24A24A14A27A26A26A19A14A14A14A14A14A26A26A14AOOAOOAOOAOOAOOAOOAOOAOOAOOAOO2.5-2062.5-2072.5-2082.5-2092.5-2102.5-2112'-21225-2132'-2142.5-2152.5-2162'-21725-2182.5-2192.5-220T2.5-1T2.5-2S111T2.5-2S?12T2.5-2Sh3T2.5-2S114T2'-2Sh5T2.5-2S?16T2.5-3S?11T2.5-3SB2T2.5-3S113T2.5-4T2.5-5Sh1T2.5-5S?12T2.5-5S113T2.5-6T2.5-7T2.'5-8T2.5-9S?11T2.5-9Sh2T2.5-10T2.5-11T2.5-12Sh1T2.5-12S112T2.5-13T2.5-14T2.5-15T2.5-16S?11T2.5-16S?I2T2.5-17T2.5-18S?I1T2.5-18Sh2AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA13ROOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-5October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 2.5-156 2.5-157 2.5-158 2.5-159 2.5-160 2.5-161 2.5-162 2.5-163 2.5-164 2.5-165 2.5-166 2.5-167 2.5-167a 2.5-167b 2.5-167c 2.5-167d 2.5-168 2.5-168a 2.5-168b 2.5-168c 2.5-168d 2.5-169 2.5-170 2.5-171 2.5-171a 2.5-171b 2.5-172 2.5-173 2.5-173a 2.5-173b 2.5-174 2.5-174a 2.5-174b 2.5-174c 2.5-174d 2.5-175 2.5-176 2.5-176a'2.5-176b 2.5-177 2.5-177a 2.5-177b 2.5-177c 2.5-177d 2.5-178 2.5-178a AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A05 ROO A05 A05 A18 A05 A05 A05 A05 AOO AOO R01 ROO A05 AOO ROO ROO ROO ROO A15 A15 A15 A15 A11 A11 A05 A05 A05 A18 ROO ROO ROO A18 A12 2.5-178b 2.5-178c 2.5-178d 2.5-179 2.5-180 2.5-181 2.5-182 2.5-183 2.5-184 2.5-185 2.5-186 2.5-187 2.5-188 2.5-189 2.5-190 2'-191 2.5-192 2.5-192a 2.5-192b 2.5-193 2.5-194 2.5-194.1 2'-194.2 2.5-194a 2.5-194b 2.5-194c 2.5-194d 2.5-194e 2.5-194f 2.5-194g 2.5-194?1 2.5-194i 2.5-194j 2.5-194k 2.5-194L 2.5-195 2.5-196 2.5-197 2.5-198 2.5-199 2.5-200 2.5-201 2.5-202 2.5-203 2.5-204 2.5-205 A12 ROO A12 A12 ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A15 R04 A11 AOO ROO A24 A24 A14 A27 A26 A26 A19 A14 A14 A14 A14 A14 A26 A26 A14 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2.5-206 2.5-207 2.5-208 2.5-209 2.5-210 2.5-211 2'-212 2 5-213 2'-214 2.5-215 2.5-216 2'-217 2 5-218 2.5-219 2.5-220 T 2.5-1 T 2.5-2 S11 1 T 2.5-2 S?1 2 T 2.5-2 Sh 3 T 2.5-2 S11 4 T 2'-2 Sh 5 T 2.5-2 S?1 6 T 2.5-3 S?1 1 T 2.5-3 SB 2 T 2.5-3 S11 3 T 2.5-4 T 2.5-5 Sh 1 T 2.5-5 S?1 2 T 2.5-5 S11 3 T 2.5-6 T 2.5-7 T 2.'5-8 T 2.5-9 S?1 1 T 2.5-9 Sh 2 T 2.5-10 T 2.5-11 T 2.5-12 Sh 1 T 2.5-12 S11 2 T 2.5-13 T 2.5-14 T 2.5-15 T 2.5-16 S?1 1 T 2.5-16 S?I 2 T 2.5-17 T 2.5-18 S?I 1 T 2.5-18 Sh 2 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A13 ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-5 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=Ficrure Amendment NumberPageT=TableF=FicFureAmendment NumberPageT=TableAmendment F=FicFure NumberT2.5-18T2'-18T2.5-19T2.5-20T2.5-21T2.5-21T2'-21T2.5-21T2'-21T2.5-22T2.5-22T2.5-23T2.5-23T2.5-24T2.5-25T2.5-26T2.5-27T2.5-28Sh3Sh4Sh1Sh2Sh3Sh4Sh5Sh1Sh2Sh1Sh2T2.5-29T2.5-29T2.5-29T2.5-29T2.5-29T2.5-29T2.5-29T2.5-30T2.5-31T2.5-32T2.5-33T2.5-33T2.5-33T2.5-33T2.5-33T2.5-34T2.5-35T2.5-36T2.5-37T2.5-38T2.5-39T2'-40T2.5-41T2.5-42T2.5-43T2.5-43T2.5-44Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh1Sh2Sh3Sh4Sh5Sh1Sh2T2.5-28AAOOAOOAOOA05AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA21A06A06A06A06A06A06A06AOOAOOAOOAOOAOOAOOAOOAOOA22AOOA05A05A05A05A05A05A05A18A09A11T2.5-45T2.5-45AT2.5-46T2.5-46AT2.5-46BT2.5-46CT2.5-47T2.5-48AT2.5-48BT2.5-48CT2.5-49T2.5-50F2.5-1F2.5-2F2.5-3F2.5-4F2.5-5F2.5-6F2.5-7F2.5-8F2.5-9F2.5-10F2.5-11F2.5-12F2.5-13F2.5-14F2.5-15F2.5-16F2.5-17F2.5-18F2'-19F2.5-20F2.5-21F2.5-22F2.5-23F2.5-24F2.5-25F2.5-26F2.5-27F2.5-28F2.5-28AF2.5-29F2.5-30F2.5-31F2.5-32F2.5-33A18A19A18A14A17A17A14A14A14A17A17A22AOOAOOAOOAOOAOOAOOA06AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA06A13AOOAOOAOOAOOAOOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2.5-342.5-352.5-362.5-372.5-382.5-392.5-402.5-412.5-422.5-432.5-442.5-452.5-462.5-472.5-482.5-492.5-502.5-512.5-522.5-532.5-542.5-552.5-562.5-572.5-582.5-592.5-602.5-612.5-622.5-632.5-642.5-652.5-662.5-672.5-682.5-692.5-702.5-712.5-722.5-732.5-742.5-752.5-762.5-772.5-782.5-79AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA03AOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-6October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=Ficrure Amendment Number Page T=Table F=F icFu re Amendment Number Page T=Table Amendment F=FicFure Number T 2.5-18 T 2'-18 T 2.5-19 T 2.5-20 T 2.5-21 T 2.5-21 T 2'-21 T 2.5-21 T 2'-21 T 2.5-22 T 2.5-22 T 2.5-23 T 2.5-23 T 2.5-24 T 2.5-25 T 2.5-26 T 2.5-27 T 2.5-28 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-30 T 2.5-31 T 2.5-32 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-34 T 2.5-35 T 2.5-36 T 2.5-37 T 2.5-38 T 2.5-39 T 2'-40 T 2.5-41 T 2.5-42 T 2.5-43 T 2.5-43 T 2.5-44 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 T 2.5-28A AOO AOO AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A21 A06 A06 A06 A06 A06 A06 A06 AOO AOO AOO AOO AOO AOO AOO AOO A22 AOO A05 A05 A05 A05 A05 A05 A05 A18 A09 A11 T 2.5-45 T 2.5-45A T 2.5-46 T 2.5-46A T 2.5-46B T 2.5-46C T 2.5-47 T 2.5-48A T 2.5-48B T 2.5-48C T 2.5-49 T 2.5-50 F 2.5-1 F 2.5-2 F 2.5-3 F 2.5-4 F 2.5-5 F 2.5-6 F 2.5-7 F 2.5-8 F 2.5-9 F 2.5-10 F 2.5-11 F 2.5-12 F 2.5-13 F 2.5-14 F 2.5-15 F 2.5-16 F 2.5-17 F 2.5-18 F 2'-19 F 2.5-20 F 2.5-21 F 2.5-22 F 2.5-23 F 2.5-24 F 2.5-25 F 2.5-26 F 2.5-27 F 2.5-28 F 2.5-28A F 2.5-29 F 2.5-30 F 2.5-31 F 2.5-32 F 2.5-33 A18 A19 A18 A14 A17 A17 A14 A14 A14 A17 A17 A22 AOO AOO AOO AOO AOO AOO A06 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A06 A13 AOO AOO AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2.5-34 2.5-35 2.5-36 2.5-37 2.5-38 2.5-39 2.5-40 2.5-41 2.5-42 2.5-43 2.5-44 2.5-45 2.5-46 2.5-47 2.5-48 2.5-49 2.5-50 2.5-51 2.5-52 2.5-53 2.5-54 2.5-55 2.5-56 2.5-57 2.5-58 2.5-59 2.5-60 2.5-61 2.5-62 2.5-63 2.5-64 2.5-65 2.5-66 2.5-67 2.5-68 2.5-69 2.5-70 2.5-71 2.5-72 2.5-73 2.5-74 2.5-75 2.5-76 2.5-77 2.5-78 2.5-79 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-6 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2.5-802.5-812.5-822.5-832.5-842.5-852.5-862.5-872.5-882.5-892.5-902'-912.5-922.5-932'-942.5-952.5-962.5-96A2.5-96B2.5-96C2.5-96D2.5-96E2.5-96F2.5-972.5-982.5-992.5-1002.5-1012.5-1022.5-102A2.5-102B2.5-1032.5-1042.5-1052.5-105A2.5-105B2.5-105C2.5-105D2.5-105E2.5-105F2.5-105G2.5-105H2.5-105I2.5-105J2.5-1062.5-107AOOAOOAOOAOOA06AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05A05A05A05A27A27AOOAOOAOOAOOAOOAOOA05A05AOOAOOAOOA05A05A05A05A05A05A05A05A05A11AOOAOOF2.5-108F2.5-109F2.5-110F2.5-111F2.5-112F2.5-113F2.5-114F2.5-115ShF2.5-115ShF2.5-116F2.5-117ShF2.5-117ShF2.5-118F2.5-119ShF2.5-119ShF2.5-119ShF2.5-119ShF2.5-120ShF2.5-120ShF2.5-120ShF2.5-120ShF2.5-121ShF2.5-121ShF2.5-121ShF2.5-122F2.5-123F2.5-124F2.5-125F2.5-126F2.5-127F2.5-127a.F2.5-127bF2.5-128F2.5-129F2.5-130F2.5-131F2.5-132F2.5-133F2.5-134F2.5-135F2.5-136F2.5-137F2.5-138F2.5-139F2.5-140F2.5-1411212123412341"23AOOAOOA05A05AOOA05AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA22A09A09A23A05A05A05A05A05A05A11A12A12A12A12A12A12F2'-142F2.5-143F2.5-144F2.5-145F2.5-146F2.5-147F25-148F2.5-149F25-150F2.5-151F2.5-152F2.5-153F2.5-154F2.5-155F2.5-156F2.5-157F2.5-158F2.5-159F2.5-160F2.5-161F2.5-162F2.5-163F2.5-164F2.5-165F2.5-166F2.5-167F2.5-168F2.5-169F2.5-170F2.5-171F2.5-172F2.5-173F2.5-174F2.5-175F2.5-176F2.5-177F2.5-178F2.5-179F2.5-180F2'-181F2.5-182F2.5-183F2.5-184F2.5-185F2.5-186F2.5-187A12A12A12A12A12A12A12A12A28A13A13A13A22A22A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14USARRevision4EP2-7October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2.5-80 2.5-81 2.5-82 2.5-83 2.5-84 2.5-85 2.5-86 2.5-87 2.5-88 2.5-89 2.5-90 2'-91 2.5-92 2.5-93 2'-94 2.5-95 2.5-96 2.5-96A 2.5-96B 2.5-96C 2.5-96D 2.5-96E 2.5-96F 2.5-97 2.5-98 2.5-99 2.5-100 2.5-101 2.5-102 2.5-102A 2.5-102B 2.5-103 2.5-104 2.5-105 2.5-105A 2.5-105B 2.5-105C 2.5-105D 2.5-105E 2.5-105F 2.5-105G 2.5-105H 2.5-105I 2.5-105J 2.5-106 2.5-107 AOO AOO AOO AOO A06 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A05 A05 A05 A27 A27 AOO AOO AOO AOO AOO AOO A05 A05 AOO AOO AOO A05 A05 A05 A05 A05 A05 A05 A05 A05 A11 AOO AOO F 2.5-108 F 2.5-109 F 2.5-110 F 2.5-111 F 2.5-112 F 2.5-113 F 2.5-114 F 2.5-115 Sh F 2.5-115 Sh F 2.5-116 F 2.5-117 Sh F 2.5-117 Sh F 2.5-118 F 2.5-119 Sh F 2.5-119 Sh F 2.5-119 Sh F 2.5-119 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-121 Sh F 2.5-121 Sh F 2.5-121 Sh F 2.5-122 F 2.5-123 F 2.5-124 F 2.5-125 F 2.5-126 F 2.5-127 F 2.5-127a.F 2.5-127b F 2.5-128 F 2.5-129 F 2.5-130 F 2.5-131 F 2.5-132 F 2.5-133 F 2.5-134 F 2.5-135 F 2.5-136 F 2.5-137 F 2.5-138 F 2.5-139 F 2.5-140 F 2.5-141 1 2 1 2 1 2 3 4 1 2 3 4 1" 2 3 AOO AOO A05 A05 AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A22 A09 A09 A23 A05 A05 A05 A05 A05 A05 A11 A12 A12 A12 A12 A12 A12 F 2'-142 F 2.5-143 F 2.5-144 F 2.5-145 F 2.5-146 F 2.5-147 F 2 5-148 F 2.5-149 F 2 5-150 F 2.5-151 F 2.5-152 F 2.5-153 F 2.5-154 F 2.5-155 F 2.5-156 F 2.5-157 F 2.5-158 F 2.5-159 F 2.5-160 F 2.5-161 F 2.5-162 F 2.5-163 F 2.5-164 F 2.5-165 F 2.5-166 F 2.5-167 F 2.5-168 F 2.5-169 F 2.5-170 F 2.5-171 F 2.5-172 F 2.5-173 F 2.5-174 F 2.5-175 F 2.5-176 F 2.5-177 F 2.5-178 F 2.5-179 F 2.5-180 F 2'-181 F 2.5-182 F 2.5-183 F 2.5-184 F 2.5-185 F 2.5-186 F 2.5-187 A12 A12 A12 A12 A12 A12 A12 A12 A28 A13 A13 A13 A22 A22 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 USAR Revision 4 EP 2-7 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableFFicFureAmendment NumberF2.5-188F2.5-189F2.5-190F2.5-191F2.5-192F2.5-192F2.5-193F2.5-193F2.5-194F2.5-195F2.5-196F2.5-197F2.5-197F2.5-197F2.5-198F2.5-198F2.5-198F2.5-198F2.5-198F2.5-198F2.5-199F2.5-199F25-199F2.5-199F2.5-199F2.5-200F2.5-200F2.5-201F2.5-201F2.5-201F2.5-202F2.5-203F2.5-204F2.5-205F2.5-206F2.5-207F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208F2.5-208Sh1Sh2Sh1Sh2Sh1Sh2Sh3Sh1Sh2Sh3Sh4Sh5Sh6Sh1Sh2Sh3Sh4Sh5Sh1Sh2Sh1Sh2Sh3Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10A27A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14A14F2.5-209F2.5-210F2.5-210F2.5-210F2.5-210F2.5-211F2.5-211F2.5-212F2.5-212F2.5-212App2A2A-12A-22A-32A-42A-5T2A-1ShT2A-1ShT2A-1ShT2A-1ShF2A-1App2B2B-i2B-ii2B-iii2B-ivT2B-1T2B-2T2B-2AT2B-2BT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-3ShT2B-4ShT2B-4ShT2B-4ShT2B-4ShT2B-4ShSh1Sh2Sh3Sh4Sh1.Sh2Sh1Sh2Sh312345678912345A23A26A26A26A26A26A26A26A26A26AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05A02AOOA05A05A05AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOSh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33T2B-4T2B-4T2B-4T2B-4T2B-5T2B-5T2B-5T2B-5T2B-5T2B-5T2B-5T2B-5T2B-5T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevisionEP2-8October1992 I.
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F FicFure Amendment Number F 2.5-188 F 2.5-189 F 2.5-190 F 2.5-191 F 2.5-192 F 2.5-192 F 2.5-193 F 2.5-193 F 2.5-194 F 2.5-195 F 2.5-196 F 2.5-197 F 2.5-197 F 2.5-197 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-199 F 2.5-199 F 2 5-199 F 2.5-199 F 2.5-199 F 2.5-200 F 2.5-200 F 2.5-201 F 2.5-201 F 2.5-201 F 2.5-202 F 2.5-203 F 2.5-204 F 2.5-205 F 2.5-206 F 2.5-207 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 A27 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 F 2.5-209 F 2.5-210 F 2.5-210 F 2.5-210 F 2.5-210 F 2.5-211 F 2.5-211 F 2.5-212 F 2.5-212 F 2.5-212 App 2A 2A-1 2A-2 2A-3 2A-4 2A-5 T 2A-1 Sh T 2A-1 Sh T 2A-1 Sh T 2A-1 Sh F 2A-1 App 2B 2B-i 2B-ii 2B-iii 2B-iv T 2B-1 T 2B-2 T 2B-2A T 2B-2B T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh Sh 1 Sh 2 Sh 3 Sh 4 Sh 1.Sh 2 Sh 1 Sh 2 Sh 3 1 2 3 4 5 6 7 8 9 1 2 3 4 5 A23 A26 A26 A26 A26 A26 A26 A26 A26 A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A02 AOO A05 A05 A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 T 2B-4 T 2B-4 T 2B-4 T 2B-4 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision EP 2-8 October 1992 I.
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=Tableg~F'ueAmendment NumberT2B-6Sh34T2B-6Sh35T2B-6Sh36T2B-6Sh37T2B-6Sh38T2B-6Sh39T2B-6Sh40T2B-6Sh41T2B-6Sh42T2B-6Sh43T2B-6Sh44T2B-6Sh45T2B-6Sh46T2B-6Sh47T2B-6Sh48T2B-6Sh49T2B-6Sh50T2B-6Sh51T2B-6Sh52T2B-6Sh53T2B-6Sh54T2B-6Sh55T2B-6Sh56T2B-6Sh57T2B-6Sh58T2B-6Sh59T2B-6Sh60T2B-6Sh61T2B-6Sh62T2B-6Sh63T2B-6Sh64T2B-6Sh65T'2B-6Sh66T2B-6Sh67T2B-6Sh68T2B-6Sh69T2B-6Sh70T2B-6Sh71T2B-6Sh72T2B-6Sh73T2B-6Sh74T2B-6Sh75T2B-6Sh76T2B-6Sh77T2B-6Sh78T2B-6Sh79AOOAOOAOOAOOAOOAOOAOO'OOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOT2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-6T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100Sh101Sh102Sh103Sh104Sh105Sh106Sh107Sh108Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOT2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-.7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7ShShShShSh1819202122Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48Sh49Sh50Sh51Sh52Sh53Sh54Sh55Sh56Sh57Sh58Sh59Sh60Sh61Sh62Sh63AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-9October1992 I
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table g~F'ue Amendment Number T 2B-6 Sh 34 T 2B-6 Sh 35 T 2B-6 Sh 36 T 2B-6 Sh 37 T 2B-6 Sh 38 T 2B-6 Sh 39 T 2B-6 Sh 40 T 2B-6 Sh 41 T 2B-6 Sh 42 T 2B-6 Sh 43 T 2B-6 Sh 44 T 2B-6 Sh 45 T 2B-6 Sh 46 T 2B-6 Sh 47 T 2B-6 Sh 48 T 2B-6 Sh 49 T 2B-6 Sh 50 T 2B-6 Sh 51 T 2B-6 Sh 52 T 2B-6 Sh 53 T 2B-6 Sh 54 T 2B-6 Sh 55 T 2B-6 Sh 56 T 2B-6 Sh 57 T 2B-6 Sh 58 T 2B-6 Sh 59 T 2B-6 Sh 60 T 2B-6 Sh 61 T 2B-6 Sh 62 T 2B-6 Sh 63 T 2B-6 Sh 64 T 2B-6 Sh 65 T'2B-6 Sh 66 T 2B-6 Sh 67 T 2B-6 Sh 68 T 2B-6 Sh 69 T 2B-6 Sh 70 T 2B-6 Sh 71 T 2B-6 Sh 72 T 2B-6 Sh 73 T 2B-6 Sh 74 T 2B-6 Sh 75 T 2B-6 Sh 76 T 2B-6 Sh 77 T 2B-6 Sh 78 T 2B-6 Sh 79 AOO AOO AOO AOO AOO AOO AOO'OO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-.7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 Sh Sh Sh Sh Sh 18 19 20 21 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-9 October 1992 I
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableFFiciureAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableFFicFureAmendment NumberT2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-7T2B-8Sh64Sh65Sh66Sh67Sh68Sh69Sh70Sh71Sh72Sh73Sh74Sh75Sh76Sh77Sh78Sh79Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100Sh101Sh102Sh103Sh104Sh105Sh106Sh107Sh108Sh1AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOT2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOT2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8T2B-8Sh48Sh49Sh50Sh51Sh52Sh53Sh54Sh55Sh56Sh57Sh58Sh59Sh60Sh61Sh62Sh63Sh64Sh65Sh66Sh67Sh68Sh69Sh70Sh71Sh72Sh73Sh74Sh75Sh76Sh77Sh78Sh79Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92Sh93AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-10October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F Ficiure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F FicFure Amendment Number T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-8 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-10 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER-2 PageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberT2B-8Sh94T2B-8Sh95T2B-8Sh96T2B-8Sh97T2B-8Sh98T2B-8Sh99T2B-8Sh100T2B-8Sh101T2B-8Sh102T2B-8Sh103T2B-8Sh104T2B-8Sh105T2B-8Sh106T2B-8Sh107T2B-8Sh108T2B-9T2B-10Sh1T2B-10Sh2T2B-10Sh3T2B-10Sh4T2B-10Sh5T2B-10Sh6T2B-10Sh7T2B-10Sh8T2B-11T2B-12T2B-13T2B-14Sh1T2B-14Sh2T2B-14Sh3T2B-15Sh1T2B-15Sh2T2B-15Sh3T2B-16Sh1T2B-16Sh2T2B-16Sh3T2B-17Sh1T2B-17Sh2T2B-17Sh3T2B-17Sh4T2B-17Sh5T2B-17Sh6T2B-17Sh7T2B-17Sh8T2B-17Sh9T2B-17Sh10AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOT2B-17T2B-17T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-18T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-19T2B-20T2B-21T2B-22T2B-23T2B-24T2B-25T2B-25T2B-26T2B-27T2B-28T2B-29T2B-29T2B-29T2B-29T2B-29T2B-29T2B-30T2B-31T2B-32T2B-33Sh11Sh12Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12ShShShShShShShShshAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05A05A05A05A05A05AOOAOOAOOAOOT2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-33T2B-34T2B-34T2B-34T2B-34T2B-34T2B-34T2B-34T2B-34T2B-34T2B-35T2B-35T2B-35T2B-35T2B-35T2B-35T2B-35T2B-35T2B-35T2B-36T2B-36T2B-36T2B-36T2B-36T2B-36T2B-36T2B-36T2B-36T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-11October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER-2 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T 2B-8 Sh 94 T 2B-8 Sh 95 T 2B-8 Sh 96 T 2B-8 Sh 97 T 2B-8 Sh 98 T 2B-8 Sh 99 T 2B-8 Sh 100 T 2B-8 Sh 101 T 2B-8 Sh 102 T 2B-8 Sh 103 T 2B-8 Sh 104 T 2B-8 Sh 105 T 2B-8 Sh 106 T 2B-8 Sh 107 T 2B-8 Sh 108 T 2B-9 T 2B-10 Sh 1 T 2B-10 Sh 2 T 2B-10 Sh 3 T 2B-10 Sh 4 T 2B-10 Sh 5 T 2B-10 Sh 6 T 2B-10 Sh 7 T 2B-10 Sh 8 T 2B-11 T 2B-12 T 2B-13 T 2B-14 Sh 1 T 2B-14 Sh 2 T 2B-14 Sh 3 T 2B-15 Sh 1 T 2B-15 Sh 2 T 2B-15 Sh 3 T 2B-16 Sh 1 T 2B-16 Sh 2 T 2B-16 Sh 3 T 2B-17 Sh 1 T 2B-17 Sh 2 T 2B-17 Sh 3 T 2B-17 Sh 4 T 2B-17 Sh 5 T 2B-17 Sh 6 T 2B-17 Sh 7 T 2B-17 Sh 8 T 2B-17 Sh 9 T 2B-17 Sh 10 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-17 T 2B-17 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-20 T 2B-21 T 2B-22 T 2B-23 T 2B-24 T 2B-25 T 2B-25 T 2B-26 T 2B-27 T 2B-28 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-30 T 2B-31 T 2B-32 T 2B-33 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh Sh Sh Sh Sh Sh Sh Sh sh AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A05 A05 A05 A05 A05 AOO AOO AOO AOO T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-11 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=PicFure Amendment NumberT2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37T2B-37Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48Sh49Sh50Sh51Sh52Sh53Sh54AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOTTTTTTTTTTTTTTTTTTTTTTTT.TTTTTTTTTTTTTTTTTTTTTT2B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-372B-37Sh55Sh56Sh57Sh58Sh59Sh60Sh61Sh62,Sh63Sh64Sh65Sh66Sh67Sh68Sh69Sh70Sh71Sh72Sh73Sh74Sh75Sh76Sh77Sh78Sh79Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOO.AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT2B-372B-372B-372B-372B-372B-372B-372B-372B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-38ShShShshShShShShShShShShShShShShShShShshShShshShShShShShshShShShShShShShShShShShShShShShShSh1011021031041051061071081234567891011121314151617181920212223242526272829303132333435363738AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-12October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=PicFure Amendment Number T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T.T T T T T T T T T T T T T T T T T T T T T T 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62, Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO.AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 101 102 103 104 105 106 107 108 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-12 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=Ficpure Amendment NumberPageT=TableF=Ficrure Amendment NumberT2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38T2B-38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48Sh49Sh50Sh51Sh52Sh53Sh54Sh55Sh56Sh57Sh58Sh59Sh60Sh61Sh62Sh63Sh64Sh65Sh66Sh67Sh68Sh69Sh70Sh71Sh72Sh73Sh74Sh75Sh76Sh77Sh78Sh79Sh80Sh81Sh82Sh83Sh84AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT2B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-382B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-39Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92.Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100Sh101Sh102Sh103Sh104Sh105Sh106Sh107Sh108Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOSh16Sh17Sh18Sh19Sh20Sh21Sh22AOOAOOAOOAOOAOOAOOAOOSh12AOOSh13AOOSh14AOOSh15AOOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT2B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-392B-39Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48Sh49Sh50Sh51Sh52Sh53Sh54Sh55Sh56Sh57Sh58Sh59Sh60Sh61Sh62Sh63Sh64Sh65Sh66Sh67Sh68AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-13October1992 I
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=Ficpure Amendment Number Page T=Table F=Ficrure Amendment Number T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92.Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 AOO AOO AOO AOO AOO AOO AOO Sh 12 AOO Sh 13 AOO Sh 14 AOO Sh 15 AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-13 October 1992 I
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFFre NumberPageT=TableAmendment F=FicFure NumberSh69Sh70Sh71Sh72Sh73Sh74Sh75Sh76Sh77Sh78Sh79Sh80Sh81Sh82Sh83Sh84Sh85Sh86Sh87Sh88Sh89Sh90Sh91Sh92Sh93Sh94Sh95Sh96Sh97Sh98Sh99Sh100Sh101Sh102Sh103Sh104Sh105Sh106Sh107Sh108ShT2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-39T2B-40T2B-41T2B-42T2B-42AT2B-43T2B-44AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05AOOAOOA05AOOAOOT2B-44Sh2T2B-45T2B-46T2B-47T2B-48Sh1T2B-48Sh2T2B-49T2B-50T2B-51Sh1T2B-51Sh2T2B-52T2B-52AT2B-53T2B-54Sh1T2B-54Sh2App2C2C-12C-22C-32C-4T2C-1F2C-1F2C-2F2C-3App2D2D-i2D-12D-22D-32D-42D-52D-62D-72D-82D-9F2D-1F2D-2F2D-3App2E2E-12E-22E-3AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05AOOAOOA03AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA03AOOAOOAOOAOOApp2F2F-i2F-ia2F-ib2F-iiT2F-1Sh1T2F-1Sh2T2F-1Sh3T2F-2Sh1T2F-2Sh2T2F-2aSh1T2F-2aSh2T2F-2bT2F-2cSh1T2F-2cSh2T2F-3T2F-4T2F-5T2F-6Sh1T2F-6Sh2T2F-6Sh3T2F-6Sh4T2F-6Sh5T2F-6Sh6T2F-6Sh7T2F-6Sh8T2F-6Sh9T2F-6Sh10T2F6Sh11T2F-6Sh12T2F-7Sh1T2F-7Sh2T2F-7Sh3T2F-7Sh4T2F-7Sh5T2F-7Sh6T2F-7Sh7T2F-7Sh8T2F-7Sh9T2F-8T2F-9T2F-10T2F-11Sh1T2F-11Sh2T2F-11Sh3T2F-11Sh4AOOA23A23A23AOO'23A23A23A13A13A23A23A23A23A23A23AOOA13AOOAOOAOOA23AOOA23A23A23A23A23A23A23A24AOOAOOAOOAOOAOOAOOAOOAOOA23AOOAOOAOOAOOA23A23USARRevision4EP2-14October1992 Iw NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=Ficrure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberT2F-11Sh5T2F-11Sh6T2F-11Sh7T2F-11Sh8T2F-11Sh9App2G2G-iT2G-1T2G-2T2G-3T2G-4T2G-5T2G-6T2G-7T2G-7aT2G-8T2G-9App2H2H-i2H-ia2H-ib2H-ii2H-iii2H-iv2H-v2H-vi2H-vii2H-12HNotesSh12HNotesSh22HNotesSh3F2H-1F2H-1AF2H-2F2H-3F2H-4F2H-5F2H-6F2H-7F2H-8F2H-9F2H-10F2H-llF2H-12A23A23A23A23A23AOOA23AOOAOOAOOAOOAOOA23A23A23A23A04AOOA09A09A09AOOAOOAOOAOOAOOA09AOOAOOAOOAOOAOOA09AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOF2H-13F2H-14F2H-15F2H-16F2H-17F2H-18F2H-19F2H-20F2H-21F2H-22F2H-23F2H-24F2H-25F2H-26F2H-27F2H-28F2H-29F2H-30F2H-31Sh1F2H-31Sh2'F2H-32F2H-33F2H-34F2H-35F2H-36F2H-37F2H-38F2H-39F2H-40F2H-41F2H-42F2H-43F'2H-44F2H-45F2H-46F2H-47F2H-48F2H-49F2H-50F2H-51F2H-52F2H-53F2H-54Sh1F2H-54Sh2F2H-55F2H-56AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOFFFFFFFFFFFFF.FFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2H-572H-582H-592H-602H-612H-622H-632H-642H-652H-662H-672H-682H-692H-702H-712H-722H-732H-742H-752H-762H-762H-772H-782H-792H-802H-812H-822H-832H-842H-852H-862H-872H-872H-882H-892H-902H-912H-922H-932H-942H-952H-962H-972H-982H-992H-100ShShShShAOOAOOAOOAOO-AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA09A09A09A09A09USARRevision4EP2-15October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFFre Number Page T=Table Amendment F=FicFure Number Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-40 T 2B-41 T 2B-42 T 2B-42A T 2B-43 T 2B-44 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO A05 AOO AOO T 2B-44 Sh 2 T 2B-45 T 2B-46 T 2B-47 T 2B-48 Sh 1 T 2B-48 Sh 2 T 2B-49 T 2B-50 T 2B-51 Sh 1 T 2B-51 Sh 2 T 2B-52 T 2B-52A T 2B-53 T 2B-54 Sh 1 T 2B-54 Sh 2 App 2C 2C-1 2C-2 2C-3 2C-4 T 2C-1 F 2C-1 F 2C-2 F 2C-3 App 2D 2D-i 2D-1 2D-2 2D-3 2D-4 2D-5 2D-6 2D-7 2D-8 2D-9 F 2D-1 F 2D-2 F 2D-3 App 2E 2E-1 2E-2 2E-3 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO App 2F 2F-i 2F-ia 2F-ib 2F-ii T 2F-1 Sh 1 T 2F-1 Sh 2 T 2F-1 Sh 3 T 2F-2 Sh 1 T 2F-2 Sh 2 T 2F-2a Sh 1 T 2F-2a Sh 2 T 2F-2b T 2F-2c Sh 1 T 2F-2c Sh 2 T 2F-3 T 2F-4 T 2F-5 T 2F-6 Sh 1 T 2F-6 Sh 2 T 2F-6 Sh 3 T 2F-6 Sh 4 T 2F-6 Sh 5 T 2F-6 Sh 6 T 2F-6 Sh 7 T 2F-6 Sh 8 T 2F-6 Sh 9 T 2F-6 Sh 10 T 2F 6 Sh 11 T 2F-6 Sh 12 T 2F-7 Sh 1 T 2F-7 Sh 2 T 2F-7 Sh 3 T 2F-7 Sh 4 T 2F-7 Sh 5 T 2F-7 Sh 6 T 2F-7 Sh 7 T 2F-7 Sh 8 T 2F-7 Sh 9 T 2F-8 T 2F-9 T 2F-10 T 2F-11 Sh 1 T 2F-11 Sh 2 T 2F-11 Sh 3 T 2F-11 Sh 4 AOO A23 A23 A23 AOO'23 A23 A23 A13 A13 A23 A23 A23 A23 A23 A23 AOO A13 AOO AOO AOO A23 AOO A23 A23 A23 A23 A23 A23 A23 A24 AOO AOO AOO AOO AOO AOO AOO AOO A23 AOO AOO AOO AOO A23 A23 USAR Revision 4 EP 2-14 October 1992 I w Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number T 2F-11 Sh 5 T 2F-11 Sh 6 T 2F-11 Sh 7 T 2F-11 Sh 8 T 2F-11 Sh 9 App 2G 2G-i T 2G-1 T 2G-2 T 2G-3 T 2G-4 T 2G-5 T 2G-6 T 2G-7 T 2G-7a T 2G-8 T 2G-9 App 2H 2H-i 2H-ia 2H-ib 2H-ii 2H-iii 2H-iv 2H-v 2H-vi 2H-vii 2H-1 2H Notes Sh 1 2H Notes Sh 2 2H Notes Sh 3 F 2H-1 F 2H-1A F 2H-2 F 2H-3 F 2H-4 F 2H-5 F 2H-6 F 2H-7 F 2H-8 F 2H-9 F 2H-10 F 2H-ll F 2H-12 A23 A23 A23 A23 A23 AOO A23 AOO AOO AOO AOO AOO A23 A23 A23 A23 A04 AOO A09 A09 A09 AOO AOO AOO AOO AOO A09 AOO AOO AOO AOO AOO A09 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F 2H-13 F 2H-14 F 2H-15 F 2H-16 F 2H-17 F 2H-18 F 2H-19 F 2H-20 F 2H-21 F 2H-22 F 2H-23 F 2H-24 F 2H-25 F 2H-26 F 2H-27 F 2H-28 F 2H-29 F 2H-30 F 2H-31 Sh 1 F 2H-31 Sh 2'F 2H-32 F 2H-33 F 2H-34 F 2H-35 F 2H-36 F 2H-37 F 2H-38 F 2H-39 F 2H-40 F 2H-41 F 2H-42 F 2H-43 F'2H-44 F 2H-45 F 2H-46 F 2H-47 F 2H-48 F 2H-49 F 2H-50 F 2H-51 F 2H-52 F 2H-53 F 2H-54 Sh 1 F 2H-54 Sh 2 F 2H-55 F 2H-56 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F F F F F F F F F F F F F.F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2H-57 2H-58 2H-59 2H-60 2H-61 2H-62 2H-63 2H-64 2H-65 2H-66 2H-67 2H-68 2H-69 2H-70 2H-71 2H-72 2H-73 2H-74 2H-75 2H-76 2H-76 2H-77 2H-78 2H-79 2H-80 2H-81 2H-82 2H-83 2H-84 2H-85 2H-86 2H-87 2H-87 2H-88 2H-89 2H-90 2H-91 2H-92 2H-93 2H-94 2H-95 2H-96 2H-97 2H-98 2H-99 2H-100 Sh Sh Sh Sh AOO AOO AOO AOO-AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A09 A09 A09 A09 A09 USAR Revision 4 EP 2-15 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableAmendment F=Ficrure NumberPageT=TableAmendment F=Ficrure NumberPageT=TableAmendment FFicrureNumberF2H-101App2IDSZ2Z-i2I-ii2I-lii2I-iv2I-v2I-12I-22I-32I-42I-52I-62I-72I-82I-92I-102I-112I-122I-132I-142I-152I-162I-172I-3,82I-192I-202I-212I-222I-232I-242I-252I-262I-272I-282Z-292I-302I-312I-322I-332I-342I-352I-362I-37A09AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOO2I-382Z-392I-402I-412I-422I-432I-442I-452I-462I-472Z-482I-492I-502I-512I-522I-532I-542I-552I-562I-572I-582I-592I-602I-612I-622I-632I-642I-652Z-662Z-672I-682I-692I-702I-712I-722I-732Z-742I-752I-762I-772I-782I-792I-802I-812I-822I-83AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA19AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOO2I-842I-852I-862I-872I-882I-892I-902I-912I-922I-932I-942Z-952Z-962I-972I-982I-992Z-1002Z-1012I-1022I-1032I-1042I-1052Z-1062I-1072I-1082Z-1092I-1102I-1112I-1122Z-1132I-1142I-1152I-1162I-1172I-1182I-1192I-1202I-1212I-1222I-1232I-1242I-1252I-1262I-1272I-1282I-129AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-16October1992 U,d'1b4 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number2I-1302I-1312I-1322I-1332I-1342I-1352I-1362I-1372I-1382I-1392I-1402I-1412I-1422I-1432I-144App2J2J-i2J-12J-22J-32J-42J-52J-62J-72J-82J-92J-102J-112J-12App2K2K-i2K-ii2K-iii2K-iv2K-v2K-vi2K-vii2K-viiiF2K-1F2K-2F2K-3F2K-4AF2K-4BF2K-5AAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA03AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOF2K-5BF2K-6AF2K-6BF2K-6CF2K-7AF2K-7BF2K-7CF2K-8AF2K-8BF2K-8CF2K-9AF2K-9BF2K-9CF2K-10AF2K-10BF2K-11AF2K-11BF2K-12AF2K-12BF2K-12CF2K-12DF2K-12EF2K-12FF2K-13AF2K-13BF2K-13CF2K-13DF2K-13EF2K-13FF2K-14AF2K-14BF2K-14CF2K-15F2K-16AF2K-16BF2K-17AF2K-17BF2K-17CF2K-18AF2K-18BF2K-18CF2K-19AF2K-19BF2K-19CF2K-20AF2K-20BAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2K-20C2K-21A2K-21B2K-21C2K-22A2K-22B2K-22C2K-23A2K-23B2K-23C2K-24A2K-24B2K-24C2K-24D2K-24E2K-24F2K-25A2K-25B2K-25C2K-25D2K-25E2K-25F2K-26A2K-26B2K-26C2K-26D2K-26E2K-26F2K-27A2K-27B2K-27C2K-27D2K-27E2K-27F2K-28A2K-28B2K-28C2K-28D2K-28E2K-28F2K-29A2K-29B2K-29C2K-29D2K-29E2K-29FAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP2-17October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Ficrure Number F 2H-101 App 2I DSZ 2Z-i 2I-ii 2I-lii 2I-iv 2I-v 2I-1 2I-2 2I-3 2I-4 2I-5 2I-6 2I-7 2I-8 2I-9 2I-10 2I-11 2I-12 2I-13 2I-14 2I-15 2I-16 2I-17 2I-3,8 2I-19 2I-20 2I-21 2I-22 2I-23 2I-24 2I-25 2I-26 2I-27 2I-28 2Z-29 2I-30 2I-31 2I-32 2I-33 2I-34 2I-35 2I-36 2I-37 A09 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2I-38 2Z-39 2I-40 2I-41 2I-42 2I-43 2I-44 2I-45 2I-46 2I-47 2Z-48 2I-49 2I-50 2I-51 2I-52 2I-53 2I-54 2I-55 2I-56 2I-57 2I-58 2I-59 2I-60 2I-61 2I-62 2I-63 2I-64 2I-65 2Z-66 2Z-67 2I-68 2I-69 2I-70 2I-71 2I-72 2I-73 2Z-74 2I-75 2I-76 2I-77 2I-78 2I-79 2I-80 2I-81 2I-82 2I-83 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2I-84 2I-85 2I-86 2I-87 2I-88 2I-89 2I-90 2I-91 2I-92 2I-93 2I-94 2Z-95 2Z-96 2I-97 2I-98 2I-99 2Z-100 2Z-101 2I-102 2I-103 2I-104 2I-105 2Z-106 2I-107 2I-108 2Z-109 2I-110 2I-111 2I-112 2Z-113 2I-114 2I-115 2I-116 2I-117 2I-118 2I-119 2I-120 2I-121 2I-122 2I-123 2I-124 2I-125 2I-126 2I-127 2I-128 2I-129 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-16 October 1992 U ,d'1 b 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 2I-130 2I-131 2I-132 2I-133 2I-134 2I-135 2I-136 2I-137 2I-138 2I-139 2I-140 2I-141 2I-142 2I-143 2I-144 App 2J 2J-i 2J-1 2J-2 2J-3 2J-4 2J-5 2J-6 2J-7 2J-8 2J-9 2J-10 2J-11 2J-12 App 2K 2K-i 2K-ii 2K-iii 2K-iv 2K-v 2K-vi 2K-vii 2K-viii F 2K-1 F 2K-2 F 2K-3 F 2K-4A F 2K-4B F 2K-5A AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F 2K-5B F 2K-6A F 2K-6B F 2K-6C F 2K-7A F 2K-7B F 2K-7C F 2K-8A F 2K-8B F 2K-8C F 2K-9A F 2K-9B F 2K-9C F 2K-10A F 2K-10B F 2K-11A F 2K-11B F 2K-12A F 2K-12B F 2K-12C F 2K-12D F 2K-12E F 2K-12F F 2K-13A F 2K-13B F 2K-13C F 2K-13D F 2K-13E F 2K-13F F 2K-14A F 2K-14B F 2K-14C F 2K-15 F 2K-16A F 2K-16B F 2K-17A F 2K-17B F 2K-17C F 2K-18A F 2K-18B F 2K-18C F 2K-19A F 2K-19B F 2K-19C F 2K-20A F 2K-20B AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2K-20C 2K-21A 2K-21B 2K-21C 2K-22A 2K-22B 2K-22C 2K-23A 2K-23B 2K-23C 2K-24A 2K-24B 2K-24C 2K-24D 2K-24E 2K-24F 2K-25A 2K-25B 2K-25C 2K-25D 2K-25E 2K-25F 2K-26A 2K-26B 2K-26C 2K-26D 2K-26E 2K-26F 2K-27A 2K-27B 2K-27C 2K-27D 2K-27E 2K-27F 2K-28A 2K-28B 2K-28C 2K-28D 2K-28E 2K-28F 2K-29A 2K-29B 2K-29C 2K-29D 2K-29E 2K-29F AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-17 October 1992
'
'
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableAmendment F=FicFure NumberPageT=TableF=Picpure PageAmendment T=TableAmendment NumberF=FicFure NumberFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF2K-30A2K-30B2K-30C2K-30D2K-30E2K-30F2K-31A2K-31B2K-31C2K-31D2K-31E2K-31F2K-32A2K-32B2K-32C2K-32D2K-32E2K-32F2K-33A2K-33B2K-33C2K-34A2K-34B2K-34C2K-35A2K-35B2K-35C2K-36A2K-36B2K-36C2K-37A2K-37B2K-37C2K-37D2K-37E2K-37F2K-38A2K-38B2K-38C2K-38D2K-38E2K-38F2K-39A2K-39B2K-39C2K-39DAOOAOOAOOAOOAOOAOO,AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOApp2L.2L-i2L-ii2L-iii2L-1~2L-2T2L-1T2L-1T2L-2T2L-2T2L-3T2L-3T2L-4T2L-4T2L-5T2L-5T2L-6T2L-6T2L-7T2L-7S?11Sh2Sh1S112Sh1S?12S?11S112S?11SH2S111Sh2Sh1S112F2K-39EF2K-39FF2K-40AF2K-40BF2K-40CF2K-41AF2K-41BF2K-42AF2K-42BF2K-43AF2K-43BF2K-44AF2K-44BF2K-45AF2K-45BF2K-45CF2K-45DF2K-46AF2K-46BF2K-46CF2K-46DF2K-47AF2K-47BF2K-47CF2K-47DAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOTTTTTTTTTTTTTTTTTTTTFFAOOA07A07AOOA07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07AOOTAOOTAOOT2L8Sjl12L-8SN22L-9S?112L-9S?122L-102L-112L-122L-132L-142L-152L-162L-172L-182L-192L-202L-212L-222L-232L-242L-252L-262L-272L-282L-12L-2A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A07A13USARRevision4EP2-18October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=FicFure Number Page T=Table F=Picpure Page Amendment T=Table Amendment Number F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2K-30A 2K-30B 2K-30C 2K-30D 2K-30E 2K-30F 2K-31A 2K-31B 2K-31C 2K-31D 2K-31E 2K-31F 2K-32A 2K-32B 2K-32C 2K-32D 2K-32E 2K-32F 2K-33A 2K-33B 2K-33C 2K-34A 2K-34B 2K-34C 2K-35A 2K-35B 2K-35C 2K-36A 2K-36B 2K-36C 2K-37A 2K-37B 2K-37C 2K-37D 2K-37E 2K-37F 2K-38A 2K-38B 2K-38C 2K-38D 2K-38E 2K-38F 2K-39A 2K-39B 2K-39C 2K-39D AOO AOO AOO AOO AOO AOO ,AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO App 2L.2L-i 2L-ii 2L-iii 2L-1~2L-2 T 2L-1 T 2L-1 T 2L-2 T 2L-2 T 2L-3 T 2L-3 T 2L-4 T 2L-4 T 2L-5 T 2L-5 T 2L-6 T 2L-6 T 2L-7 T 2L-7 S?1 1 Sh 2 Sh 1 S11 2 Sh 1 S?1 2 S?1 1 S11 2 S?1 1 SH 2 S11 1 Sh 2 Sh 1 S11 2 F 2K-39E F 2K-39F F 2K-40A F 2K-40B F 2K-40C F 2K-41A F 2K-41B F 2K-42A F 2K-42B F 2K-43A F 2K-43B F 2K-44A F 2K-44B F 2K-45A F 2K-45B F 2K-45C F 2K-45D F 2K-46A F 2K-46B F 2K-46C F 2K-46D F 2K-47A F 2K-47B F 2K-47C F 2K-47D AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T F F AOO A07 A07 AOO A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO T AOO T AOO T 2L 8 Sjl 1 2L-8 SN 2 2L-9 S?1 1 2L-9 S?1 2 2L-10 2L-11 2L-12 2L-13 2L-14 2L-15 2L-16 2L-17 2L-18 2L-19 2L-20 2L-21 2L-22 2L-23 2L-24 2L-25 2L-26 2L-27 2L-28 2L-1 2L-2 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A13 USAR Revision 4 EP 2-18 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FBFureAmendment NumberPageT=TableF=FicFure Amendment NumberApp2MTableofContentsNRCSiteVisit(7pg)NRCMeetingFieldNotebook76-2(2MeetingatSite(4pg)Affidavit-DouglasE.IslerAffidavit-JohnJ.MarkhamAffidavit-JohnH.Peck(2pg)Figure1Figure2Figure3Figure4App2N2N-12N-22N-3/42N-5/6(F230.3-1)2N-72N-82N-92N-102N-112N-122N-132N-142N-152N-162N-172N-182N-192N-202N-212N-222N-23/242N-25/26(F231.10-1) 2N-27/282N-29/30(F231.11-1) 2N-312N-322N-332N-34pe)A16A16A16A16A16A16A16A16A16A16A16A16A16ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROO2N-352N-362N-372N-382N-392N-402N-41'N-42 2N-432N-442N-45/462N-47/48(T2N-492N-502N-512N-522N-532N-542N-552N-562N-57/58(T2N-59/60(T2N-61/62(T2N-63/64(TF241.16-1F241.16-2F241.16-3F241.16-4F241.16-5F241.16-6F241'6-7F241.16-8F241.16-9F241.16-10 F241.16-11 F241.16-12 F241.16-13 F241.16-14 F241.16-15 F241.16-16 F241.16-17 F241.16-18 F241.16-19 F241.16-20 F241.16-21 F241.16-22 241.2-1)241.16-1)241.16-2,24116-2,241.16-2, ShShSh1)2)3)ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOUSARRevision4EP2-19October1992 I~
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FBFure Amendment Number Page T=Table F=FicFure Amendment Number App 2M Table of Contents NRC Site Visit (7 pg)NRC Meeting Field Notebook 76-2 (2 Meeting at Site (4 pg)Affidavit-Douglas E.Isler Affidavit-John J.Markham Affidavit-John H.Peck (2 pg)Figure 1 Figure 2 Figure 3 Figure 4 App 2N 2N-1 2N-2 2N-3/4 2N-5/6 (F 230.3-1)2N-7 2N-8 2N-9 2N-10 2N-11 2N-12 2N-13 2N-14 2N-15 2N-16 2N-17 2N-18 2N-19 2N-20 2N-21 2N-22 2N-23/24 2N-25/26 (F 231.10-1)2N-27/28 2N-29/30 (F 231.11-1)2N-31 2N-32 2N-33 2N-34 pe)A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 2N-35 2N-36 2N-37 2N-38 2N-39 2N-40 2N-41'N-42 2N-43 2N-44 2N-45/46 2N-47/48 (T 2N-49 2N-50 2N-51 2N-52 2N-53 2N-54 2N-55 2N-56 2N-57/58 (T 2N-59/60 (T 2N-61/62 (T 2N-63/64 (T F 241.16-1 F 241.16-2 F 241.16-3 F 241.16-4 F 241.16-5 F 241.16-6 F 241'6-7 F 241.16-8 F 241.16-9 F 241.16-10 F 241.16-11 F 241.16-12 F 241.16-13 F 241.16-14 F 241.16-15 F 241.16-16 F 241.16-17 F 241.16-18 F 241.16-19 F 241.16-20 F 241.16-21 F 241.16-22 241.2-1)241.16-1)241.16-2, 241 16-2, 241.16-2, Sh Sh Sh 1)2)3)ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 2-19 October 1992 I~
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberF241.16-23 F241.16-24 F241.16-25 F241.16-26a F241.16-26b F241.16-27a F241.16-27b F241.16-27c F241.16-28a F241.16-28b F241.16-29 F241.16-30.
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number F 241.16-23 F 241.16-24 F 241.16-25 F 241.16-26a F 241.16-26b F 241.16-27a F 241.16-27b F 241.16-27c F 241.16-28a F 241.16-28b F 241.16-29 F 241.16-30.
F241.16-31a F24116-31bF241.16-32a F241.16-32b F241.16-32c F241.16-33 F241'6-34F241.16-35 F241.16-36 F241.16-37 F241.16-38 F241.16-39 F241.16-40 F241.16-41 F241.16-42 F241.16-43 F241.16-44 F241.16-45 F241.16-46 App2P2P-12P-22P-32P-42P-52P-62P-7/8(T451.13-1) 2P-9/10(T451.13-2) 2P-11/12(T451.13-3) 2P-13/14(T451.13-4) 2P-152P-162P-17/18ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROO2P-19/202P-21/222P-23/242P-252P-262P-272P-282P-292P-302P-312P-322P-33/342P-35/362P-37/382P-39/402P-41/422P-43/442P-45/462P-47/482P-49/502P-51/522P-53/542P-55/562P-57/582P-59/602P-61/622P-63/642P-65/66App2Q2Q-12Q-22Q-32Q-42Q-52Q-62Q-72Q-80Q-92Q-102Q-112Q-122Q-132Q-142Q-152Q-16(F451.14-1)(F451.14-2)(F451.14-3)(T451.15-1)(T451.15-2)(T451.15-3)(T451.15-4)'(T451.15-5, (T451.15-5, (T451'5-5,(T451.15-5, (T451'5-6,(T451.15-6, (T451.15-6, (T451.15-6, (T451.15-7, (T451.15-7, (T451.15-7, (T45115-7,Sh1)Sh2)Sh3)Sh4)Sh1)Sh2)Sh3)Sh4)Sh1)Sh2)Sh3)Sh4)ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROORO,OROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROO.ROOROOROOROOUSARRevision4EP2-20October1992
F 241.16-31a F 241 16-31b F 241.16-32a F 241.16-32b F 241.16-32c F 241.16-33 F 241'6-34 F 241.16-35 F 241.16-36 F 241.16-37 F 241.16-38 F 241.16-39 F 241.16-40 F 241.16-41 F 241.16-42 F 241.16-43 F 241.16-44 F 241.16-45 F 241.16-46 App 2P 2P-1 2P-2 2P-3 2P-4 2P-5 2P-6 2P-7/8 (T 451.13-1)2P-9/10 (T 451.13-2)2P-11/12 (T 451.13-3)2P-13/14 (T 451.13-4)2P-15 2P-16 2P-17/18 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 2P-19/20 2P-21/22 2P-23/24 2P-25 2P-26 2P-27 2P-28 2P-29 2P-30 2P-31 2P-32 2P-33/34 2P-35/36 2P-37/38 2P-39/40 2P-41/42 2P-43/44 2P-45/46 2P-47/48 2P-49/50 2P-51/52 2P-53/54 2P-55/56 2P-57/58 2P-59/60 2P-61/62 2P-63/64 2P-65/66 App 2Q 2Q-1 2Q-2 2Q-3 2Q-4 2Q-5 2Q-6 2Q-7 2Q-8 0Q-9 2Q-10 2Q-11 2Q-12 2Q-13 2Q-14 2Q-15 2Q-16 (F 451.14-1)(F 451.14-2)(F 451.14-3)(T 451.15-1)(T 451.15-2)(T 451.15-3)(T 451.15-4)'(T 451.15-5, (T 451.15-5, (T 451'5-5, (T 451.15-5, (T 451'5-6, (T 451.15-6, (T 451.15-6, (T 451.15-6, (T 451.15-7, (T 451.15-7, (T 451.15-7, (T 451 15-7, Sh 1)Sh 2)Sh 3)Sh 4)Sh 1)Sh 2)Sh 3)Sh 4)Sh 1)Sh 2)Sh 3)Sh 4)ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO RO,O ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO.ROO ROO ROO ROO USAR Revision 4 EP 2-20 October 1992
~I4 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER2PageT=TableF=FicFFre PageAmendment T=TableNumberF=FicFure Amendment Number2Q-172Q-182Q-192Q-202Q-212Q-22TGI-1ROOROOROOROOROOROOROOUSARRevision4EP2-21October1992 I't NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableAmendment F=FicFFreNumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number3i3-ii3-iii3-iV3-V3-Vl3-Vil3-Vlli3-ix3-X3-Xi3Xii3-xiia3-xiib3Xiii3-XiV3-XV3-XV13-XV113-XVlll3-XiX3-XX3-XXi3-XXii3-XXiii3-Xxlv3-xxiva3-xxivb3-XXV3-XXVi3-XXVii3-XXViii3-Xxlx3-XXX3XXXi3-XXXii3-xxxiia3-xxxiib3-XXXiii3-xxxiiia 3-xxxiiib 3-XXXiV3-xxxiva3-xxxivb3-XXXV3-XXXViAOOAOOAOOA09A25ROOR03AOOROOR04A19A24A24A24R04A08ROOROOR04A28A28R04A24A24ROOA07A07A07AOOR04A12A12A12A12A12A12A21A12ROOA25A05A24A23A05ROOA283-XXXVli3-XXXVlil3-XXXlX3-xl3-xla3-xlb3-xli3-xli13-xli23-xiii3-Xllll3-xliv3-xliva3-xlivb3-xlv3-xlvi3-xlvii3-xlviii3-xlix3~113~123~133.1-43.1-53.1-63~173.1-83.1-93.1-103.1-113.1-123~1133\113a3.1-13b3.1-143.1-153.1-163~1173.1-183.1-193.1-203~1213~1223.1-233.1-24A24A24A24A24A12A12R02R02A21AOOA24ROOROOA18R04R04ROOROOR04AOOAOOAOOAOOA18A12AOOAOOAOOAOOAOOAOOA28A19A19AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA283.1-253.1-263~1273.1-283.1-293.1-303~1313~1323~1333.1-343.1-353.1-363~1373.1-383.1-393.1-403.1-413.1-423.1-433.1-443.1-453.1-463.1-473.1-483.1-493.1-503.1-513.1-523.1-533.1-543.1-553.1-563.1-573.1-583.1-593.1-603.1-613.1-623.1-633.1-643'-653.1-663.1-673.1-683.1-693.1-70AOOAOOAOOAOOAOOAOOAOOAOOAOOA27AOOAOOAOOAOOAOOAOOAOOAOOA19AOOA19AOOA27AOOAOOAOOAOOA28AOOAOOAOOAOOAOOAOOROOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP3-1October1992 1
~I 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFFre Page Amendment T=Table Number F=FicFure Amendment Number 2Q-17 2Q-18 2Q-19 2Q-20 2Q-21 2Q-22 T GI-1 ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 2-21 October 1992 I't Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=F icFFre Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 3 i 3-ii 3-iii 3-iV 3-V 3-Vl 3-Vil 3-Vlli 3-ix 3-X 3-Xi 3 Xii 3-xiia 3-xiib 3 Xiii 3-XiV 3-XV 3-XV1 3-XV11 3-XVlll 3-XiX 3-XX 3-XXi 3-XXii 3-XXiii 3-Xxlv 3-xxiva 3-xxivb 3-XXV 3-XXVi 3-XXVii 3-XXViii 3-Xxlx 3-XXX 3 XXXi 3-XXXii 3-xxxiia 3-xxxiib 3-XXXiii 3-xxxiiia 3-xxxiiib 3-XXXiV 3-xxxiva 3-xxxivb 3-XXXV 3-XXXVi AOO AOO AOO A09 A25 ROO R03 AOO ROO R04 A19 A24 A24 A24 R04 A08 ROO ROO R04 A28 A28 R04 A24 A24 ROO A07 A07 A07 AOO R04 A12 A12 A12 A12 A12 A12 A21 A12 ROO A25 A05 A24 A23 A05 ROO A28 3-XXXVli 3-XXXVl il 3-XXXlX 3-xl 3-xla 3-xlb 3-xli 3-xli1 3-xli2 3-xiii 3-Xllll 3-xliv 3-xliva 3-xlivb 3-xlv 3-xlvi 3-xlvii 3-xlviii 3-xlix 3~1 1 3~1 2 3~1 3 3.1-4 3.1-5 3.1-6 3~1 7 3.1-8 3.1-9 3.1-10 3.1-11 3.1-12 3~1 1 3 3\113a 3.1-13b 3.1-14 3.1-15 3.1-16 3~1 1 7 3.1-18 3.1-19 3.1-20 3~1 2 1 3~1 2 2 3.1-23 3.1-24 A24 A24 A24 A24 A12 A12 R02 R02 A21 AOO A24 ROO ROO A18 R04 R04 ROO ROO R04 AOO AOO AOO AOO A18 A12 AOO AOO AOO AOO AOO AOO A28 A19 A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A28 3.1-25 3.1-26 3~1 27 3.1-28 3.1-29 3.1-30 3~1 3 1 3~1 32 3~1 33 3.1-34 3.1-35 3.1-36 3~1 37 3.1-38 3.1-39 3.1-40 3.1-41 3.1-42 3.1-43 3.1-44 3.1-45 3.1-46 3.1-47 3.1-48 3.1-49 3.1-50 3.1-51 3.1-52 3.1-53 3.1-54 3.1-55 3.1-56 3.1-57 3.1-58 3.1-59 3.1-60 3.1-61 3.1-62 3.1-63 3.1-64 3'-65 3.1-66 3.1-67 3.1-68 3.1-69 3.1-70 AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 AOO AOO AOO AOO AOO AOO AOO AOO A19 AOO A19 AOO A27 AOO AOO AOO AOO A28 AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-1 October 1992 1
NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER3PAGESPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicpureNumber3'71TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3~213~213.2-13~213~213~213e213~213~213~213~213~213~213~213~213~213~213~213~213~213~213~213~213.2-13~213~213~213~213~213~213~213~213~213~213~213~213~213~213~223~23T3~21T3'-13~213e21Sh1Sh2Sh3Sh3aSh4Sh5Sh5aSh6Sh7Sh8Sh9Sh9aSh10Sh10aSh11Sh11aSh12Sh12aSh13Sh13aSh14Sh14aSh15Sh15aSh16Sh16aSh17Sh17aSh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh26aSh26bSh26cSh26dAOOA26A15A09A28R01A27A19ROOA19A26A26A26A23A27A26ROOR03A26A19ROOROOR03ROOA27A26A27R01R04ROOROOROOAOOA20A07AOOROOA07R04R04R04R01ROOR01ROOT3.2-1T3.2-1T3~21T3~21T3~22T3.2-2T3~23T3.2-4T3.2-4F3.2-1Sh26eSh26fSh26gSh26hSh1Sh2Sh1Sh23e313~323~333.3-43.3-53.3-6T3.3-13.5-13.5-23.5-33.4-13.4-1a3.4-1b3.4-23.4-2a3.4-2b3.4-33.4-3a3.4-3b3.4-43.4-53.4-6T3.4-1Sh1T3.4-1Sh2T3.4-2Sh1T3.4-2Sh2T3.4-2Sh3T3.4-3T3.4-4T3.4-5Sh1T3.4-5Sh2T3.4-6T3.4-7R04ROOROOR03ROOROOA23A28A28A21A26A13AOOA05A05AOOAOOROOA05A05ROOROOROOROOROOA05ROOAOOAOOROOROOROOA25ROOROOROOROOROOROOA28A04A09A053.5-43.5-4a3.5-4b3.5-4c3.5-4d3.5-53.5-5a3.5-5b3.5-63.5-73'-83.5-93.5-103.5-113'-123.5-133.5-143.5-153.5-15a3.5-15b3.5-163.5-173.5-183.5-193.5-19a3.5-19b3.5-203.5-213.5-22T3.5-1ShT3.5-1ShT3.5-2T3.5-3T3.5-4T3.5-5T3.5-6T3.5-7T3.5-8T3.5-9T3.5-10T3.5-11T3.5-12T3.5-13T3.5-14T,3.5-15T3.5-16A27A27A27A27A26A27A27A27AOOA08AOOAOOAOOAOOA01AOOAOOR04R04A14R04R04A21ROOROOROOAOOAOOAOOROOAOOA26AOOAOOA28AOOAOOAOOAOOAOOA28AOOAOOA28AOOAOOUSARRevision4EP3-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=F icp ur e Number 3'71 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3~2 1 3~2 1 3.2-1 3~2 1 3~2 1 3~2 1 3 e 2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3.2-1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 2 3~2 3 T 3~2 1 T 3'-1 3~2 1 3 e 2 1 Sh 1 Sh 2 Sh 3 Sh 3a Sh 4 Sh 5 Sh 5a Sh 6 Sh 7 Sh 8 Sh 9 Sh 9a Sh 10 Sh 10a Sh 11 Sh 11a Sh 12 Sh 12a Sh 13 Sh 13a Sh 14 Sh 14a Sh 15 Sh 15a Sh 16 Sh 16a Sh 17 Sh 17a Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 26a Sh 26b Sh 26c Sh 26d AOO A26 A15 A09 A28 R01 A27 A19 ROO A19 A26 A26 A26 A23 A27 A26 ROO R03 A26 A19 ROO ROO R03 ROO A27 A26 A27 R01 R04 ROO ROO ROO AOO A20 A07 AOO ROO A07 R04 R04 R04 R01 ROO R01 ROO T 3.2-1 T 3.2-1 T 3~2 1 T 3~2 1 T 3~2 2 T 3.2-2 T 3~2 3 T 3.2-4 T 3.2-4 F 3.2-1 Sh 26e Sh 26f Sh 26g Sh 26h Sh 1 Sh 2 Sh 1 Sh 2 3 e 3 1 3~3 2 3~3 3 3.3-4 3.3-5 3.3-6 T 3.3-1 3.5-1 3.5-2 3.5-3 3.4-1 3.4-1a 3.4-1b 3.4-2 3.4-2a 3.4-2b 3.4-3 3.4-3a 3.4-3b 3.4-4 3.4-5 3.4-6 T 3.4-1 Sh 1 T 3.4-1 Sh 2 T 3.4-2 Sh 1 T 3.4-2 Sh 2 T 3.4-2 Sh 3 T 3.4-3 T 3.4-4 T 3.4-5 Sh 1 T 3.4-5 Sh 2 T 3.4-6 T 3.4-7 R04 ROO ROO R03 ROO ROO A23 A28 A28 A21 A26 A13 AOO A05 A05 AOO AOO ROO A05 A05 ROO ROO ROO ROO ROO A05 ROO AOO AOO ROO ROO ROO A25 ROO ROO ROO ROO ROO ROO A28 A04 A09 A05 3.5-4 3.5-4a 3.5-4b 3.5-4c 3.5-4d 3.5-5 3.5-5a 3.5-5b 3.5-6 3.5-7 3'-8 3.5-9 3.5-10 3.5-11 3'-12 3.5-13 3.5-14 3.5-15 3.5-15a 3.5-15b 3.5-16 3.5-17 3.5-18 3.5-19 3.5-19a 3.5-19b 3.5-20 3.5-21 3.5-22 T 3.5-1 Sh T 3.5-1 Sh T 3.5-2 T 3.5-3 T 3.5-4 T 3.5-5 T 3.5-6 T 3.5-7 T 3.5-8 T 3.5-9 T 3.5-10 T 3.5-11 T 3.5-12 T 3.5-13 T 3.5-14 T, 3.5-15 T 3.5-16 A27 A27 A27 A27 A26 A27 A27 A27 AOO A08 AOO AOO AOO AOO A01 AOO AOO R04 R04 A14 R04 R04 A21 ROO ROO ROO AOO AOO AOO ROO AOO A26 AOO AOO A28 AOO AOO AOO AOO AOO A28 AOO AOO A28 AOO AOO USAR Revision 4 EP 3-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableFFicFureAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberT3.5-17T3.5-17T3.5-17T3.5-18T3.5-18T3.5-18T3.5-19T3'-20T3.5-21T3.5-22T3.5-22F3.5-1F3.5-2F3.5-3F3.5-4F3.5-53.6A-13.6A-23.6A-33.6A-43.6A-53.6A-63.6A-73.6A-S3.6A-93.6A-103.6A-10a3.6A-10b3.6A-113.6A-123.6A-12a3.6A-12b3.6A-133.6A-143.6A-14a3.6A-14b3.6A-153.6A-15a3.6A-15b3.6A-163.6A-173.6A-17a3.6A-17b3.6A-183.6A-19Sh1Sh2Sh3Sh1Sh2Sh3Sh1Sh2AOOAOOAOOAOOAOOAOOAOOR04A25A24A24A04AOOAOOAOOAOOAOOAOOAOOAOOR03AOOROOROOAOOROOROOROOAOOR03ROOROOR03A12A12A12ROOROOROOROOR03A12A12AOOAOO3.6A-203.6A-213.6A-223.6A-233.6A-243.6A-253.6A-263.6A-273.6A-283.6A-28a3.6A-28b36A-293.6A-303.6A-313.6A-323.6A-333.6A-343.6A-353.6A-35a3.6A-35b3.6A-363.6A-373.6A-38T3.6A-1ShT3.6A-1ShT3.6A-1ShT3.6A-1ShT3.6A-1ShT3.6A-2T3.6A-3T3.6A-4T3.6A-5T3.6A-6T3.6A-7T3.6A-ST3.6A-9T3.6A-10T3.6A-11T3.6A-12T3.6A-13T3'A-14T3.6A-15T3.6A-16T3.6A-17T3.6A-18T3.6A-19AOOAOOAOOAOOAOOAOOAOOAOOROOROOROOAOOAOOA21AOOAOOAOOA12A12A12A05A27ROOR03R03R03R03A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3.6A-203.6A-213.6A-223.6A-233.6A-243.6A-253.6A-263.6A-273.6A-283.6A-293.6A-303.6A-313.6A-323.6A-333.6A-343.6A-353.6A-363.6A-373.6A-383.6A-393.6A-403.6A-413.6A-423.6A-433.6A-443.6A-453.6A-463.6A-473.6A-483.6A-493.6A-503.6A-513.6A-523.6A-533.6A-543.6A-553.6A-563.6A-573.6A-583.6A-593.6A-603.6A-613.6A-623.6A-633.6A-643.6A-65A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28A28USARRevision4EP3-3October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T 3.5-17 T 3.5-17 T 3.5-17 T 3.5-18 T 3.5-18 T 3.5-18 T 3.5-19 T 3'-20 T 3.5-21 T 3.5-22 T 3.5-22 F 3.5-1 F 3.5-2 F 3.5-3 F 3.5-4 F 3.5-5 3.6A-1 3.6A-2 3.6A-3 3.6A-4 3.6A-5 3.6A-6 3.6A-7 3.6A-S 3.6A-9 3.6A-10 3.6A-10a 3.6A-10b 3.6A-11 3.6A-12 3.6A-12a 3.6A-12b 3.6A-13 3.6A-14 3.6A-14a 3.6A-14b 3.6A-15 3.6A-15a 3.6A-15b 3.6A-16 3.6A-17 3.6A-17a 3.6A-17b 3.6A-18 3.6A-19 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 AOO AOO AOO AOO AOO AOO AOO R04 A25 A24 A24 A04 AOO AOO AOO AOO AOO AOO AOO AOO R03 AOO ROO ROO AOO ROO ROO ROO AOO R03 ROO ROO R03 A12 A12 A12 ROO ROO ROO ROO R03 A12 A12 AOO AOO 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-28a 3.6A-28b 3 6A-29 3.6A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 3.6A-35 3.6A-35a 3.6A-35b 3.6A-36 3.6A-37 3.6A-38 T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-2 T 3.6A-3 T 3.6A-4 T 3.6A-5 T 3.6A-6 T 3.6A-7 T 3.6A-S T 3.6A-9 T 3.6A-10 T 3.6A-11 T 3.6A-12 T 3.6A-13 T 3'A-14 T 3.6A-15 T 3.6A-16 T 3.6A-17 T 3.6A-18 T 3.6A-19 AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO ROO AOO AOO A21 AOO AOO AOO A12 A12 A12 A05 A27 ROO R03 R03 R03 R03 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-29 3.6A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 3.6A-35 3.6A-36 3.6A-37 3.6A-38 3.6A-39 3.6A-40 3.6A-41 3.6A-42 3.6A-43 3.6A-44 3.6A-45 3.6A-46 3.6A-47 3.6A-48 3.6A-49 3.6A-50 3.6A-51 3.6A-52 3.6A-53 3.6A-54 3.6A-55 3.6A-56 3.6A-57 3.6A-58 3.6A-59 3.6A-60 3.6A-61 3.6A-62 3.6A-63 3.6A-64 3.6A-65 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 USAR Revision 4 EP 3-3 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberTTTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF3.6A-663.6A-673.6A-683.6A-693.6A-703.6A-713.6A-723'A-723.6A-723.6A-723.6A-733.6A-733.6A-13.6A-23.6A-33.6A-43.6A-53.6A-63.6A-73.6A-83.6A-93.6A-103.6A-113.6A-123.6A-133.6A-143.6A-153.6A-163.6A-173.6A-183.6A-193.6A-203.6A-213.6A-223.6A-233.6A-243.6A-253.6A-263.6A-273.6A-283.6A-293'A-303.6A-313.6A-323.6A-333.6A-34Sh1Sh2Sh3Sh4Sh1Sh2A28A28A28A28A28A28A21A21A21A21A21A21AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27F3.6A-35F3.6A-36F3.6A-37F3.6A-38F3.6A-39F3.6A-40F3'A-41F3.6A-42F3.6A-43F3.6A-44F3.6A-45F3.6A-46F3.6A-47F3.6A-48F3.6A-49F3.6A-50F3.6A-51F3.6A-52'3.6A-53F3.6A-54F3.6A-55F3.6A-56F3.6A-57F3.6A-58F3.6A-59F3.6A-603.6B-13.6B-23.6B-33.6B-43.6B-53.6B-63.6B-73.6B-83.6B-93.6B-9a3.6B-9b3.6B-103.6B-113.6B-123.6B-133.6B-143.6B-153.6B-163.6B-17A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27A27ROOROOA27ROOR02R02R02ROOR02AOOAOOA23R03R03A12AOOA12A12A27A12A12AOOAOOAOOAOOAOOAOOAOO3.6B-183.6B-193.6B-203.6B-21T3.6B-1T3.6B-2F3'B-1F3.6B-2F3'B-33.7A-13.7A-23.7A-33.7A-3a3.7A-3b3.7A-43.7A-53.7A-5a3.7A-5b3.7A-63.7A-73.7A-7a3.7A-7b3.7A-83.7A-93.7A-103.7A-113.7A-123'A-133.7A-13a3.7A-13b3.7A-143.7A-153.7A-163.7A-173.7A-183.7A-193.7A-203.7A-20a3.7A-20b3.7A-213.7A-223.7A-22a3.7A-22b3.7A-233.7A-23a.AOOAOOAOOA23AOOA27A24AOOAOOA24A26A23A18A18AOOA23A05A05A23A27A23A05A23A24AOOROOAOOA20A20A20AOOAOOAOOAOOAOOA23R02ROOA03A18ROOROOROOA25A26USARRevision4EP3-4October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3.6A-66 3.6A-67 3.6A-68 3.6A-69 3.6A-70 3.6A-71 3.6A-72 3'A-72 3.6A-72 3.6A-72 3.6A-73 3.6A-73 3.6A-1 3.6A-2 3.6A-3 3.6A-4 3.6A-5 3.6A-6 3.6A-7 3.6A-8 3.6A-9 3.6A-10 3.6A-11 3.6A-12 3.6A-13 3.6A-14 3.6A-15 3.6A-16 3.6A-17 3.6A-18 3.6A-19 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-29 3'A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 A28 A28 A28 A28 A28 A28 A21 A21 A21 A21 A21 A21 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 F 3.6A-35 F 3.6A-36 F 3.6A-37 F 3.6A-38 F 3.6A-39 F 3.6A-40 F 3'A-41 F 3.6A-42 F 3.6A-43 F 3.6A-44 F 3.6A-45 F 3.6A-46 F 3.6A-47 F 3.6A-48 F 3.6A-49 F 3.6A-50 F 3.6A-51 F 3.6A-52'3.6A-53 F 3.6A-54 F 3.6A-55 F 3.6A-56 F 3.6A-57 F 3.6A-58 F 3.6A-59 F 3.6A-60 3.6B-1 3.6B-2 3.6B-3 3.6B-4 3.6B-5 3.6B-6 3.6B-7 3.6B-8 3.6B-9 3.6B-9a 3.6B-9b 3.6B-10 3.6B-11 3.6B-12 3.6B-13 3.6B-14 3.6B-15 3.6B-16 3.6B-17 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 ROO ROO A27 ROO R02 R02 R02 ROO R02 AOO AOO A23 R03 R03 A12 AOO A12 A12 A27 A12 A12 AOO AOO AOO AOO AOO AOO AOO 3.6B-18 3.6B-19 3.6B-20 3.6B-21 T 3.6B-1 T 3.6B-2 F 3'B-1 F 3.6B-2 F 3'B-3 3.7A-1 3.7A-2 3.7A-3 3.7A-3a 3.7A-3b 3.7A-4 3.7A-5 3.7A-5a 3.7A-5b 3.7A-6 3.7A-7 3.7A-7a 3.7A-7b 3.7A-8 3.7A-9 3.7A-10 3.7A-11 3.7A-12 3'A-13 3.7A-13a 3.7A-13b 3.7A-14 3.7A-15 3.7A-16 3.7A-17 3.7A-18 3.7A-19 3.7A-20 3.7A-20a 3.7A-20b 3.7A-21 3.7A-22 3.7A-22a 3.7A-22b 3.7A-23 3.7A-23a.AOO AOO AOO A23 AOO A27 A24 AOO AOO A24 A26 A23 A18 A18 AOO A23 A05 A05 A23 A27 A23 A05 A23 A24 AOO ROO AOO A20 A20 A20 AOO AOO AOO AOO AOO A23 R02 ROO A03 A18 ROO ROO ROO A25 A26 USAR Revision 4 EP 3-4 October 1992
~E NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER3PAGESPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFureNumberPageT=TableAmendment F=FicFure Number3.7A-23b3.7A-243.7A-253.7A-263.7A-273.7A-27a3.7A-27b3.7A-283.7A-28a3.7A-28b3.7A-293'A-303.7A-313.7A-323.7A-333.7A-34T3'A-1T3.7A-2T3'A-2T3.7A-3T3.7A-4T3.7A-5T3.7A-5T3.7A-6T3'A-7T3.7A-8T3.7A-9T3.7A-10ShShShShT3.7A-11T3.7A-12T3.7A-13F3'A-1F3.7A-2F3.7A-3F3.7A-4F3.7A-5F3.7A-6F3.7A-7F3.7A-8F3.7A-9F3.7A-10F3.7A-11F3.7A-12F3.7A-13F3'A-14F3.7A-15A25A03R02R02R02R02ROOA05ROOA05A26A26A26A27A26A12AOOAOOROOA22A22A22A22A22A22A22A22ROOA25A25ROOAOOAOOA26A26A22A22A22A22A22A22A22A22A22A22A22F3.7A-16F3.7A-17F3.7A-18F3.7A-19F3.7A-20F3.7A-21F3.7A-22F3.7A-23F3.7A-24F3.7A-25F3.7A-26F3.7A-27F3.7A-28F3.7A-29F3.7A-30F3.7A-31F3.7A-32F3.7A-33F3.7A-34F3.7A-35F3.7A-36F3.7A-363.7B-13.7B-23.7B-33.7B-43.7B-53.7B-63.7B-73.7B-83.7B-93.7B-103.7B-113.7B-123.7B-133.7B-143'B-153.7B-163.7B-173.7B-17a3.7B-17b3.7B-18-3.7B-193.7B-203.7B-21Sh1Sh2A22A22A23AOOA20A23A23A23A23A23A23A20A20A20A20A20A23A05A18ROOROOROOAOOAOOA23AOOAOOAOOA23A23AOOAOOAOOAOOA23A23A23AOOA20A20A20A19AOOAOOROO3.7B-21a3.7B-2lb3.7B-223.7B-233.7B-243.7B-253.7B-263.7B-27T3.7B-1T3.7B-2F3.7B-1F3.7B-2F3.7B-33.8-13.8-23.8-33.8-43.8-53.8-63.8-73'-83.8-93.8-103.8-10a3.8-10b3.8-113.8-123.8-133.8-143.8-153.8-163.8-173.8-17a3.8-17b3.8-183.8-193.8-19a3.8-19b3.8-203.8-213.8-223.8-233.8-243.8-253.8-25.1ROOROOA23A23.AOOA25AOOAOOA23AOOAOOAOOA19A23A18R04AOOAOOA18AOOAOOAOOA19A03A03AOOA20A20A26AOOA20A03A03A03A22A18A03A03ROOA19AOOAOOA26A24A24USARRevision4EP3-5October1992
~E Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=F i cFur e Number Page T=Table Amendment F=FicFure Number 3.7A-23b 3.7A-24 3.7A-25 3.7A-26 3.7A-27 3.7A-27a 3.7A-27b 3.7A-28 3.7A-28a 3.7A-28b 3.7A-29 3'A-30 3.7A-31 3.7A-32 3.7A-33 3.7A-34 T 3'A-1 T 3.7A-2 T 3'A-2 T 3.7A-3 T 3.7A-4 T 3.7A-5 T 3.7A-5 T 3.7A-6 T 3'A-7 T 3.7A-8 T 3.7A-9 T 3.7A-10 Sh Sh Sh Sh T 3.7A-11 T 3.7A-12 T 3.7A-13 F 3'A-1 F 3.7A-2 F 3.7A-3 F 3.7A-4 F 3.7A-5 F 3.7A-6 F 3.7A-7 F 3.7A-8 F 3.7A-9 F 3.7A-10 F 3.7A-11 F 3.7A-12 F 3.7A-13 F 3'A-14 F 3.7A-15 A25 A03 R02 R02 R02 R02 ROO A05 ROO A05 A26 A26 A26 A27 A26 A12 AOO AOO ROO A22 A22 A22 A22 A22 A22 A22 A22 ROO A25 A25 ROO AOO AOO A26 A26 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 F 3.7A-16 F 3.7A-17 F 3.7A-18 F 3.7A-19 F 3.7A-20 F 3.7A-21 F 3.7A-22 F 3.7A-23 F 3.7A-24 F 3.7A-25 F 3.7A-26 F 3.7A-27 F 3.7A-28 F 3.7A-29 F 3.7A-30 F 3.7A-31 F 3.7A-32 F 3.7A-33 F 3.7A-34 F 3.7A-35 F 3.7A-36 F 3.7A-36 3.7B-1 3.7B-2 3.7B-3 3.7B-4 3.7B-5 3.7B-6 3.7B-7 3.7B-8 3.7B-9 3.7B-10 3.7B-11 3.7B-12 3.7B-13 3.7B-14 3'B-15 3.7B-16 3.7B-17 3.7B-17a 3.7B-17b 3.7B-18-3.7B-19 3.7B-20 3.7B-21 Sh 1 Sh 2 A22 A22 A23 AOO A20 A23 A23 A23 A23 A23 A23 A20 A20 A20 A20 A20 A23 A05 A18 ROO ROO ROO AOO AOO A23 AOO AOO AOO A23 A23 AOO AOO AOO AOO A23 A23 A23 AOO A20 A20 A20 A19 AOO AOO ROO 3.7B-21a 3.7B-2lb 3.7B-22 3.7B-23 3.7B-24 3.7B-25 3.7B-26 3.7B-27 T 3.7B-1 T 3.7B-2 F 3.7B-1 F 3.7B-2 F 3.7B-3 3.8-1 3.8-2 3.8-3 3.8-4 3.8-5 3.8-6 3.8-7 3'-8 3.8-9 3.8-10 3.8-10a 3.8-10b 3.8-11 3.8-12 3.8-13 3.8-14 3.8-15 3.8-16 3.8-17 3.8-17a 3.8-17b 3.8-18 3.8-19 3.8-19a 3.8-19b 3.8-20 3.8-21 3.8-22 3.8-23 3.8-24 3.8-25 3.8-25.1 ROO ROO A23 A23.AOO A25 AOO AOO A23 AOO AOO AOO A19 A23 A18 R04 AOO AOO A18 AOO AOO AOO A19 A03 A03 AOO A20 A20 A26 AOO A20 A03 A03 A03 A22 A18 A03 A03 ROO A19 AOO AOO A26 A24 A24 USAR Revision 4 EP 3-5 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER3PAGESPageT=TableAmendment F=FicFFreNumberPageT=TableAmendment F=Ficpure NumberPageT=TableAmendment F=FicFure Number3.8-25.23.8-25a3.8-25b3.8-25ba3.8-25bb3.8-25c3.8-25d3.8-263.8-26a3.8-26b3.8-273.8-27a3.8-27b3.8-283.8-293.8-303.8-313.8-323.8-333.8-343.8-353.8-363.8-373.8-383.8-393.8-403.8-413.8-423.8-433.8-43a3.8-43b3.8-443.8-453.8-45a3.8-45b3.8-463.8-473.8-47a3.8-47b3.8-483.8-493.8-503.8-513.8-51a3.8-51b3.8-52A24A13A25A22A22A13A13A23A23A23A22A22A22AOOAOOAOOAOOAOOAOOAOOAOOAOOA27A23R01AOOAOOA26A26A21A21AOOA05A05A05AOOA21A03A03AOOA26A23A22A22A03AOO3.8<<533.8-543.8-553.8-563.8-573.8-583.8-593.8-603.8-613.8-623.8-633.8-63a3.8-63b3.8-643.8-653.8-65a3.8-65b3.8-663.8-673.8-683.8-693.8-69a3.8-69b3.8-703.8-713.8-71a3.8-71b3.8-723.8-733.8-73a3.8-73b3.8-743.8-753.8-763.8-773.8-78T3.8-1Sh1T3.8-1Sh2T3.8-1Sh3T3.8-1Sh4T3.8-1Sh5T3.8-1Sh6T3.8-2Sh1T3.8-2Sh2T3'.8-3Sh1T3.8-3Sh2AOOA26A21AOOA03AOOAOOAOOAOOAOOA21A21A21A26A23A23A21R01A23AOOA05A05A05AOOROOA26A05A21A23A23A23R04AOOA27A26AOOA25A23AOOAOOA26A26A19A26A26AOOTT-TTTTTTTTTTTTTTTTTTTTTTTTTTTTTFFFFFFFFFFFFFFF3.8-3Sh33.8-3Sh43.8-3Sh53.8-4Sh13.8-4Sh23.8-4Sh33.8-4Sh43.8-5Sh13.8-5Sh23.8-6Sh13.8-6Sh23.8-7Sh13.8-7Sh23.8-83.8-9Sh13.8-9Sh23.8-10Sh13.8-10Sh23.8-10Sh33.8-11Sh13.8-11Sh23.8-11Sh33.8-12Sh13.8-12Sh23.8-12Sh33.8-12Sh3a3'-12Sh43.8-133.8-143.8-15Sh13.8-15Sh23.8-13.8-23.8-33.8-3a3.8-43.8-53.8-63.8-73.8-83.8-93.8-103.8-113.8-123.8-133.8-14AOOAOOA26A25A28A26A25A27A27A27A27R03A27A26A26AOOA26R04A26A19A23A23AOOA19A26A26A26A26A26A27A23AOOAOOAOOR04AOOAOOAOOAOOA26AOOAOOAOOAOOAOOAOOUSARRevision4EP3-6October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table Amendment F=F icFFr e Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=FicFure Number 3.8-25.2 3.8-25a 3.8-25b 3.8-25ba 3.8-25bb 3.8-25c 3.8-25d 3.8-26 3.8-26a 3.8-26b 3.8-27 3.8-27a 3.8-27b 3.8-28 3.8-29 3.8-30 3.8-31 3.8-32 3.8-33 3.8-34 3.8-35 3.8-36 3.8-37 3.8-38 3.8-39 3.8-40 3.8-41 3.8-42 3.8-43 3.8-43a 3.8-43b 3.8-44 3.8-45 3.8-45a 3.8-45b 3.8-46 3.8-47 3.8-47a 3.8-47b 3.8-48 3.8-49 3.8-50 3.8-51 3.8-51a 3.8-51b 3.8-52 A24 A13 A25 A22 A22 A13 A13 A23 A23 A23 A22 A22 A22 AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A23 R01 AOO AOO A26 A26 A21 A21 AOO A05 A05 A05 AOO A21 A03 A03 AOO A26 A23 A22 A22 A03 AOO 3.8<<53 3.8-54 3.8-55 3.8-56 3.8-57 3.8-58 3.8-59 3.8-60 3.8-61 3.8-62 3.8-63 3.8-63a 3.8-63b 3.8-64 3.8-65 3.8-65a 3.8-65b 3.8-66 3.8-67 3.8-68 3.8-69 3.8-69a 3.8-69b 3.8-70 3.8-71 3.8-71a 3.8-71b 3.8-72 3.8-73 3.8-73a 3.8-73b 3.8-74 3.8-75 3.8-76 3.8-77 3.8-78 T 3.8-1 Sh 1 T 3.8-1 Sh 2 T 3.8-1 Sh 3 T 3.8-1 Sh 4 T 3.8-1 Sh 5 T 3.8-1 Sh 6 T 3.8-2 Sh 1 T 3.8-2 Sh 2 T 3'.8-3 Sh 1 T 3.8-3 Sh 2 AOO A26 A21 AOO A03 AOO AOO AOO AOO AOO A21 A21 A21 A26 A23 A23 A21 R01 A23 AOO A05 A05 A05 AOO ROO A26 A05 A21 A23 A23 A23 R04 AOO A27 A26 AOO A25 A23 AOO AOO A26 A26 A19 A26 A26 AOO T T-T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F 3.8-3 Sh 3 3.8-3 Sh 4 3.8-3 Sh 5 3.8-4 Sh 1 3.8-4 Sh 2 3.8-4 Sh 3 3.8-4 Sh 4 3.8-5 Sh 1 3.8-5 Sh 2 3.8-6 Sh 1 3.8-6 Sh 2 3.8-7 Sh 1 3.8-7 Sh 2 3.8-8 3.8-9 Sh 1 3.8-9 Sh 2 3.8-10 Sh 1 3.8-10 Sh 2 3.8-10 Sh 3 3.8-11 Sh 1 3.8-11 Sh 2 3.8-11 Sh 3 3.8-12 Sh 1 3.8-12 Sh 2 3.8-12 Sh 3 3.8-12 Sh 3a 3'-12 Sh 4 3.8-13 3.8-14 3.8-15 Sh 1 3.8-15 Sh 2 3.8-1 3.8-2 3.8-3 3.8-3a 3.8-4 3.8-5 3.8-6 3.8-7 3.8-8 3.8-9 3.8-10 3.8-11 3.8-12 3.8-13 3.8-14 AOO AOO A26 A25 A28 A26 A25 A27 A27 A27 A27 R03 A27 A26 A26 AOO A26 R04 A26 A19 A23 A23 AOO A19 A26 A26 A26 A26 A26 A27 A23 AOO AOO AOO R04 AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-6 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableF=Ficrure Amendment NumberPageT=TableFFicrureAmendment NumberPageT=TableAmendment F=Ficrure NumberF3.8-15F3.8-16F3.8-17F3.8-18F3.8-18F3.8-19F3.8-19F3~8-20F3~8-21F3'-22F3.8-233.9A-13.9A-1a3.9A-1b3.9A-23.9A-2a3.9A-2b3.9A-33.9A-3a3.9A-3b3'A-43.9A-4a3.9A-4b3.9A-53.9A-5a3.9A-5b3.9A-63.9A-6a39A-6b3.9A-73.9A-7a3.9A-7b3.9A-83.9A-8a3.9A-8b3'A-93.9A-9a3.9A-9b3.9A-103.9A-113.9A-11a3.9A-11b3.9A-123.9A-133.9A-13aSh1Sh2Sh1Sh2AOOAOOAOOAOOAOOA16AOOAOOAOOR04R04A26A26A26A23R03R03ROOR02ROOR02R02ROOR02A19A19ROOROOROOROOROOA28ROOROOROOA27A20A20AOOA27A27A27A12ROOROO3.9A-13b3.9A-143.9A-14a3.9A-14b3.9A-153.9A-15a3.9A-15b3.9A-1639A-173.9A-17a3.9A-17b3.9A-183.9A-193.9A-19a3.9A-19b3.9A-203.9A-20a3.9A-20b3.9A-213.9A-21a3.9A-21b3.9A-223.9A-233.9A-23a3.9A-23b3.9A-243.9A-24a3.9A-24b3.9A-24c3.9A-24d3.9A-253.9A-263.9A-26a3.9A-26b3.9A-26c3.9A-26d3'A-273.9A-27a3.9A-27b3.9A-28T3.9A-1T3.9A-1T3.9A-2T3.9A-2T3.9A-2T3.9A-2ShShShShshShROOR01ROOROOROOROOROOROOROOA21A20A23A20A20A20A23A20A20A27A20A23A28R02ROOA12ROOROOROOROOA23A23ROOA12A27R03A12ROOROOROOR01ROOROOA20A20ROOROOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3.9A-2Sh53.9A-2Sh63.9A-2Sh73.9A-2Sh83.9A-33.9A-4Sh13.9A-4Sh23.9A-4Sh33.9A-4Sh43.9A-4Sh53.9A-4Sh63.9A-4Sh6a3.9A-4Sh6b3.9A-5Sh13.9A-5Sh23.9A-5Sh33.9A-63.9A-73.9A-8Sh13.9A-8Sh23.9A-93.9A-10Sh13.9A-10Sh23.9A-10Sh33.9A-10Sh3a3.9A-113.9A-12Sh13.9A-12Sh23.9A-12Sh33.9A-12Sh43.9A-12Sh53.9A-12Sh63.9A-12Sh73.9A-12Sh83.9A-12Sh93.9A-12Sh103.9A-12Sh113.9A-12Sh123.9A-12Sh133.9A-12Sh143.9A-12Sh153.9A-12Sh163.9A-12Sh173.9A-12Sh183.9A-12Sh193.9A-12Sh20ROOROOA20A'20AOOA27A27A27A18A27A27A28A27AOOA27AOOAOOAOOAOOA12R03ROOR03ROOROOA18ROOR03R03R03R03R03R03R03R03R03R03R03R03R04R03ROOR01R03R03R03USARRevision4EP3-7October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=Ficrure Amendment Number Page T=Table F Ficrure Amendment Number Page T=Table Amendment F=Ficrure Number F 3.8-15 F 3.8-16 F 3.8-17 F 3.8-18 F 3.8-18 F 3.8-19 F 3.8-19 F 3~8-20 F 3~8-21 F 3'-22 F 3.8-23 3.9A-1 3.9A-1a 3.9A-1b 3.9A-2 3.9A-2a 3.9A-2b 3.9A-3 3.9A-3a 3.9A-3b 3'A-4 3.9A-4a 3.9A-4b 3.9A-5 3.9A-5a 3.9A-5b 3.9A-6 3.9A-6a 3 9A-6b 3.9A-7 3.9A-7a 3.9A-7b 3.9A-8 3.9A-8a 3.9A-8b 3'A-9 3.9A-9a 3.9A-9b 3.9A-10 3.9A-11 3.9A-11a 3.9A-11b 3.9A-12 3.9A-13 3.9A-13a Sh 1 Sh 2 Sh 1 Sh 2 AOO AOO AOO AOO AOO A16 AOO AOO AOO R04 R04 A26 A26 A26 A23 R03 R03 ROO R02 ROO R02 R02 ROO R02 A19 A19 ROO ROO ROO ROO ROO A28 ROO ROO ROO A27 A20 A20 AOO A27 A27 A27 A12 ROO ROO 3.9A-13b 3.9A-14 3.9A-14a 3.9A-14b 3.9A-15 3.9A-15a 3.9A-15b 3.9A-16 3 9A-17 3.9A-17a 3.9A-17b 3.9A-18 3.9A-19 3.9A-19a 3.9A-19b 3.9A-20 3.9A-20a 3.9A-20b 3.9A-21 3.9A-21a 3.9A-21b 3.9A-22 3.9A-23 3.9A-23a 3.9A-23b 3.9A-24 3.9A-24a 3.9A-24b 3.9A-24c 3.9A-24d 3.9A-25 3.9A-26 3.9A-26a 3.9A-26b 3.9A-26c 3.9A-26d 3'A-27 3.9A-27a 3.9A-27b 3.9A-28 T 3.9A-1 T 3.9A-1 T 3.9A-2 T 3.9A-2 T 3.9A-2 T 3.9A-2 Sh Sh Sh Sh sh Sh ROO R01 ROO ROO ROO ROO ROO ROO ROO A21 A20 A23 A20 A20 A20 A23 A20 A20 A27 A20 A23 A28 R02 ROO A12 ROO ROO ROO ROO A23 A23 ROO A12 A27 R03 A12 ROO ROO ROO R01 ROO ROO A20 A20 ROO ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9A-2 Sh 5 3.9A-2 Sh 6 3.9A-2 Sh 7 3.9A-2 Sh 8 3.9A-3 3.9A-4 Sh 1 3.9A-4 Sh 2 3.9A-4 Sh 3 3.9A-4 Sh 4 3.9A-4 Sh 5 3.9A-4 Sh 6 3.9A-4 Sh 6a 3.9A-4 Sh 6b 3.9A-5 Sh 1 3.9A-5 Sh 2 3.9A-5 Sh 3 3.9A-6 3.9A-7 3.9A-8 Sh 1 3.9A-8 Sh 2 3.9A-9 3.9A-10 Sh 1 3.9A-10 Sh 2 3.9A-10 Sh 3 3.9A-10 Sh 3a 3.9A-11 3.9A-12 Sh 1 3.9A-12 Sh 2 3.9A-12 Sh 3 3.9A-12 Sh 4 3.9A-12 Sh 5 3.9A-12 Sh 6 3.9A-12 Sh 7 3.9A-12 Sh 8 3.9A-12 Sh 9 3.9A-12 Sh 10 3.9A-12 Sh 11 3.9A-12 Sh 12 3.9A-12 Sh 13 3.9A-12 Sh 14 3.9A-12 Sh 15 3.9A-12 Sh 16 3.9A-12 Sh 17 3.9A-12 Sh 18 3.9A-12 Sh 19 3.9A-12 Sh 20 ROO ROO A20 A'2 0 AOO A27 A27 A27 A18 A27 A27 A28 A27 AOO A27 AOO AOO AOO AOO A12 R03 ROO R03 ROO ROO A18 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R03 ROO R01 R03 R03 R03 USAR Revision 4 EP 3-7 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER3PAGESPageT=TableF=FicFure Amendment NumberPageT=TableAmendment FFBFureNumberPageT=TableAmendment F=FicFure NumberTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF3.9A-123.9A-133.9A-133.9A-133.9A-143.9A-153.9A-153.9A-153.9A-163.9A-163.9A-13.9A-23.9A-33.9A-43.9A-53.9A-63.9A-73.9A-83.9A-93.9A-103.9A-113.9A-123.9A-133.9A-143.9A-153.9A-163.9A-173.9A-183.9A-193.9A-203.9A-213.9A-223.9A-233.9A-243.9A-253.9A-263.9A-273.9A-283.9A-293.9A-303.9A-313.9A-323.9A-333.9A-343.9A-353.9A-36Sh21Sh1Sh2Sh3Sh1Sh2Sh2aSh1Sh2R03A12A12A12R02A26A26A26ROOROOA08A12A12A12ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOF3.9A-37F3.9A-38F3.9A-39F3.9A-40F3.9A-41F3.9A-42F3'A-43F3.9A-44F3.9A-45F3.9A-46F3.9A-47F3.9A-48F3.9A-49F3.9A-50F3.9A-51F3.9A-52F3'A-53F3.9A-54F3.9A-55F3.9A-56F3.9A-57F3.9A-58F3.9A-59F3.9A-60F3.9A-61F3.9A-62F3.9A-63F3.9A-64F3.9A-65F3.9A-66F3.9A-673.9B-13.9B-23.9B-33.9B-43.9B-4a3.9B-4b3.9B-53.9B-63'B-73.9B-83.9B-93.9B-103.9B-113.9B-12ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOAOOAOOAOOA28A28A28AOOAOOAOOROOROOROOAOOAOO3.9B-133.9B-143.9B-153.9B-163.9B-16a3.9B-16b3.9B-173.9B-183.9B-193.9B-203.9B-213.9B-21a3.9B-21b3.9B-223.9B-233.9B-243.9B-253.9B-263.9B-26a3.9B-26b3.9B-273.9B-283.9B-293.9B-303.9B-313.9B-323.9B-32a3.9B-32b3.9B-333.9B-343.9B-34a3.9B-34b3.9B-353.9B-363.9B-373.9B-383.9B-393.9B-403.9B-413.9B-423.9B-433.9B-443.9B-453.9B-463.9B-473.9B-47aR01AOOR03A27A27A27AOOA24A26A26A12A28A12A20AOOA13AOOA13ROOA13A13AOOAOOAOOA26R03A07A07ROOA28A28A28AOOA20A20AOOAOOAOOAOOAOOAOOAOOA28AOOA20A20USARRevision4EP3-8October1992 d<\+
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table Amendment F FBFure Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3.9A-12 3.9A-13 3.9A-13 3.9A-13 3.9A-14 3.9A-15 3.9A-15 3.9A-15 3.9A-16 3.9A-16 3.9A-1 3.9A-2 3.9A-3 3.9A-4 3.9A-5 3.9A-6 3.9A-7 3.9A-8 3.9A-9 3.9A-10 3.9A-11 3.9A-12 3.9A-13 3.9A-14 3.9A-15 3.9A-16 3.9A-17 3.9A-18 3.9A-19 3.9A-20 3.9A-21 3.9A-22 3.9A-23 3.9A-24 3.9A-25 3.9A-26 3.9A-27 3.9A-28 3.9A-29 3.9A-30 3.9A-31 3.9A-32 3.9A-33 3.9A-34 3.9A-35 3.9A-36 Sh 21 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 2a Sh 1 Sh 2 R03 A12 A12 A12 R02 A26 A26 A26 ROO ROO A08 A12 A12 A12 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO F 3.9A-37 F 3.9A-38 F 3.9A-39 F 3.9A-40 F 3.9A-41 F 3.9A-42 F 3'A-43 F 3.9A-44 F 3.9A-45 F 3.9A-46 F 3.9A-47 F 3.9A-48 F 3.9A-49 F 3.9A-50 F 3.9A-51 F 3.9A-52 F 3'A-53 F 3.9A-54 F 3.9A-55 F 3.9A-56 F 3.9A-57 F 3.9A-58 F 3.9A-59 F 3.9A-60 F 3.9A-61 F 3.9A-62 F 3.9A-63 F 3.9A-64 F 3.9A-65 F 3.9A-66 F 3.9A-67 3.9B-1 3.9B-2 3.9B-3 3.9B-4 3.9B-4a 3.9B-4b 3.9B-5 3.9B-6 3'B-7 3.9B-8 3.9B-9 3.9B-10 3.9B-11 3.9B-12 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO AOO AOO A28 A28 A28 AOO AOO AOO ROO ROO ROO AOO AOO 3.9B-13 3.9B-14 3.9B-15 3.9B-16 3.9B-16a 3.9B-16b 3.9B-17 3.9B-18 3.9B-19 3.9B-20 3.9B-21 3.9B-21a 3.9B-21b 3.9B-22 3.9B-23 3.9B-24 3.9B-25 3.9B-26 3.9B-26a 3.9B-26b 3.9B-27 3.9B-28 3.9B-29 3.9B-30 3.9B-31 3.9B-32 3.9B-32a 3.9B-32b 3.9B-33 3.9B-34 3.9B-34a 3.9B-34b 3.9B-35 3.9B-36 3.9B-37 3.9B-38 3.9B-39 3.9B-40 3.9B-41 3.9B-42 3.9B-43 3.9B-44 3.9B-45 3.9B-46 3.9B-47 3.9B-47a R01 AOO R03 A27 A27 A27 AOO A24 A26 A26 A12 A28 A12 A20 AOO A13 AOO A13 ROO A13 A13 AOO AOO AOO A26 R03 A07 A07 ROO A28 A28 A28 AOO A20 A20 AOO AOO AOO AOO AOO AOO AOO A28 AOO A20 A20 USAR Revision 4 EP 3-8 October 1992 d<\+
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTERPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=Ficrure Number3.9B-47b3.9B-483.9B-493.9B-49a3.9B-49b3.9B-503.9B-50a3.9B-50b3.9B-513.9B-523.9B-52a3.9B-52b3.9B-533.9B-543.9B-553.9B-563.9B-56a3.9B-56b3.9B-573.9B-583.9B-593.9B-603.9B-613.9B-623.9B-633.9B-63a3.9B-63b3.9B-643.9B-653.9B-663.9B-673.9B-683.9B-693.9B-703.9B-713.9B-723.9B-73T3.9B-1Sh1T3.9B-1Sh2T3'B-2Sh1T3.9B-2Sh2T3.9B-2Sh3T3.9B-2Sh4T3.9B-2Sh5T3.9B-2aSh1T3.9B-2aSh2A20AOOA20A28A20A28A28A28AOOROOROOROOAOOAOOROOA12A12A12AOOA26AOOR04AOOA26A12A12A12AOOAOOA26AOOAOOAOOAOOAOOAOOA28A28A19AOOA28AOOAOOA12A22A22TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3.9B-2a3.9B-2b3.9B-2c3.9B-2d3.9B-2e3.9B-2f3.9B-2f3.9B-2f3.9B-2f3.9B-2g3.9B-2h3.9B-2h3.9B-2h3.9B-2h3.9B-2i3.9B-2i3.9B-2i3.9B-2i3.9B-2j3.9B-2j3.9B-2j3.9B-2j3.9B-2j3.9B-2j3.9B-2k3.9B-2k3.9B-2k3.9B-2k3.9B-2k3.9B-2k3.9B-2k3.9B-2k3.9B-2L3.9B-2L3.9B-2m3.9B-2m3.9B-2n3.9B-2n3.9B-2n3.9B-2o3.9B-2p3.9B-2q3.9B-2r3.9B-2r3.9B-2r3.9B-2rSh3Sh1Sh2Sh.3Sh4Sh1Sh2Sh3Sh4Sh1Sh2Sh3Sh4A23A28A22A22A22A22A22A26A24A22A22A22A26A22A22A22A22A22Sh2Sh3Sh4Sh5Sh6Sh1Sh2Sh3Sh4Sh5Sh6Sh7AOOAOOROOAOOAOOAOOAOOAOOAOOAOOAOOAOOSh8AOOSh1Sh2Sh1Sh2Sh1Sh2Sh3Sh1Sh2Sh3Sh4AOOAOOA28A28A28A26ROOA20AOOA28A20A26A20A26Sh1ROOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3.9B-2sSh13.9B-2sSh239B-2tSh13.9B-2tSh23.9B-2tSh33.9B-2QSh13.9B-2uSh23.9B-2uSh33.9B-2vSh13.9B-2vSh23.9B-2vSh33.9B-2vSh43.9B-2wSh13.9B-2wSh23.9B-2xSh13.9B-2xSh23.9B-2xSh33.9B-2xSh43.9B-2ySh13.9B-2ySh23.9B-2zSh13.9B-2zSh23.9B-2zSh33.9B-3Sh13.9B-3Sh23.9B-3Sh33.9B-3Sh43.9B-4Sh13.9B-4Sh1a3.9B-4Sh23.9B-53.9B-6Sh13.9B-6Sh23.9B-6Sh33.9B-73.9B-83.9B-9Sh13.9B-9Sh23.9B-9Sh33.9B-9Sh43.9B-10Sh13.9B-10Sh23.9B-10Sh33.9B-11Sh13.9B-11Sh23.9B-11Sh3A26A27A26A26A26A23A23R03AOOA28R03A24AOOA28A26A24A26A24A20A20A28A28A28AOOAOOAOOAOOA28A28A25AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP3-9October1992 RI NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FictureNumberPageT=TableAmendment F=FicFure NumberF3.9B-1F3.9B-2F3.9B-3F3.9B-4F3.9B-53.10A-13.10A-1a3.10A-1b3.10A-23.10A-33.10A-3a3.10A-3b3.10A-43.10A-5T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-1T3.10A-13.10B-13.10B-23.10B-2a3.10B-2b3.10B-33.10B-3a3.10B-3b3.10B-43.10B-5Sh1Sh2.Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21R04A26AOOAOOAOOA20A20A20AOOA20A20A20AOOA27A26A26A26A26A26A26A26A26A26A26A26A26R03R03A26A26A26A26A26A26A26A22A22A22A22A22A22A22A22A223.10B-5a3.10B-5b3.10B-63.10B-7T3.10B-1Sh1T3.10B-1Sh2T3.10B-1Sh3T3.10B-1Sh4T3.10B-1Sh5T3.10B-2F3.10B-1F3.10B-2F3.10B-3F3.10B-43.11-13.11-1a3.11-1b3'1-23~1133e113a3.11-3b3.11-43.11-53.11-63~117App3A3A-i3A-ii3A-iii3A-iv3A-iva3A-ivb3A-v3A-vi3A-vii3A-viii3A-ix3A-x3A-13A-23A.1-13A.1-23A.1-3T3A.1-1A22A22A22A22A20A20A20A20A20A22A22A22A22A22ROOROOA19ROOA19A19A07R01A19ROOR01AOOR03R02R02R02R02R02A27A19A23A27A05A27A09A23AOOAOOAOOA23F3A.1-13A.2-13A.2-23A.2-33A.2-4F3A.2-1F3A.2-23A.3-13A.3-23A.3-33A.3-43A.3-5T3A.3-1F3A.3-1F3A.3-23A.4-13A.4-2F3A.4-1F3A.4-2F3A.4-3F3A.4-43A.5-13A.5-1a3A.5-1b3A.5-23A.6-13A.6-2F3A.6-1F3A.6-23A.7-1T3A.7-1F3A.7-1F3A.7-23A.8-13A.8-23A.8-33A.9-13A.9-23A.9-33A.9-43A.9-53A.9-6F3A.9-1F3A.9-2F3A.9-3F3A.9-4~AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR03R03R03AOOAOOAOOAOOAOOA25A25A25A25AOOAOOAOOA27A27A27A27AOOA27AOOAOOAOOAOOUSARRevision4EP3-10October1992 4-J NineMilePointUnit2FSARLISTOFEFFECTIVE PAGES.CHAPTER3PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberF3A.9-5F3A.9-6F3A.9-73A.10-13A.10-23A.10-3T3A.10-1F3A.10-1F3A.10-2F3A.10-3F3A.10-43A.11-13A.12-13A.12-2T3A.12-1Sh1T3A.12-1Sh2F3A.12-13A.13-13A.13-2T3A.13-1T3A.13-2F3A.13-1F3A.13-23A.14-13A.14-23A.14-3T3A.14-1F3A.14-1F3A.14-23A.15-13A.15-2T3A.15-1T3A.15-2T3A.15-3T3A.15-4T3A.15-5T3A.15-6T3A.15-7T3A.15-8T3A.15-9T3A.15-10F3A.15-1F3A.15-2F3A.15-33A.15A-13A.15A-2AOOAOOAOOA27A27A27A27AOOAOOAOOA27AOOAOOAOOA26A26ROOA03AOO'03A03ROOA03AOOAOOAOOAOOAOOAOOR02R02AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR02R023A.16-13A.16-2T3A.16-1T3A.16-2T3A.16-3T3A.16-4T3A.16-53A.17-13A.17-23A.17-3T3A.17-1T3A.17-2T3A.17-3T3A.17-4T3A.17-53A.18-13A.18-1a3A.18-1b3A.18-2T3A.18-1F3A.18-1F3A.18-23A.19-1F3A.19-1F3A.19-23A.20-13A.20-2T3A.20-1F3A.20-1F3A.20-2F3A.20-3F3A.20-4F3A.20-53A.21-13A.21-2T3A.21-1T3A.21-2F3A.21-1F3A.21-2F3A.21-3F3A.21-43A.22-13A.22-2T3A.22-1T3A.22-2F3A.22-1A19A19A19A19A19A19A19AOOAOOAOOAOOAOOAOOAOOAOOA23A25A05A05A05A05A05AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA05AOOAOOAOOA273A.23-13A.23-2T3A.23-1Sh1T3A.23-1Sh23A.24-13A.24-2T3A.24-1T3A.24-2F3A.24-1F3A.24-2F3A.24-33A.25-13A.26-13A.26-2T3A.26-1F3A.26-1F3A.26-23A.27-13A.27-2T3A.27-13A.28-13A.28-23A.28-33A.29-13A.30-13A.30-23A.31-13A.31-23A.32-13A.33-13A.33-2T3A.33-1T3A.33-2App3B3B-i3B-ii3B-iii3B-iv3B-v3B-vi3B-13B-23B-33B-43B-5AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA04AOOAOOAOOA03A03AOOAOOAOOAOOAOOAOOA04A09A09A09A09A23A23A23A23A23AOOROOR02AOOROOROOROOROOROOROOROOROOUSARRevision4EP3-11October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number 3.9B-47b 3.9B-48 3.9B-49 3.9B-49a 3.9B-49b 3.9B-50 3.9B-50a 3.9B-50b 3.9B-51 3.9B-52 3.9B-52a 3.9B-52b 3.9B-53 3.9B-54 3.9B-55 3.9B-56 3.9B-56a 3.9B-56b 3.9B-57 3.9B-58 3.9B-59 3.9B-60 3.9B-61 3.9B-62 3.9B-63 3.9B-63a 3.9B-63b 3.9B-64 3.9B-65 3.9B-66 3.9B-67 3.9B-68 3.9B-69 3.9B-70 3.9B-71 3.9B-72 3.9B-73 T 3.9B-1 Sh 1 T 3.9B-1 Sh 2 T 3'B-2 Sh 1 T 3.9B-2 Sh 2 T 3.9B-2 Sh 3 T 3.9B-2 Sh 4 T 3.9B-2 Sh 5 T 3.9B-2a Sh 1 T 3.9B-2a Sh 2 A20 AOO A20 A28 A20 A28 A28 A28 AOO ROO ROO ROO AOO AOO ROO A12 A12 A12 AOO A26 AOO R04 AOO A26 A12 A12 A12 AOO AOO A26 AOO AOO AOO AOO AOO AOO A28 A28 A19 AOO A28 AOO AOO A12 A22 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9B-2a 3.9B-2b 3.9B-2c 3.9B-2d 3.9B-2e 3.9B-2f 3.9B-2f 3.9B-2f 3.9B-2f 3.9B-2g 3.9B-2h 3.9B-2h 3.9B-2h 3.9B-2h 3.9B-2i 3.9B-2i 3.9B-2i 3.9B-2i 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2L 3.9B-2L 3.9B-2m 3.9B-2m 3.9B-2n 3.9B-2n 3.9B-2n 3.9B-2o 3.9B-2p 3.9B-2q 3.9B-2r 3.9B-2r 3.9B-2r 3.9B-2r Sh 3 Sh 1 Sh 2 Sh.3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 A23 A28 A22 A22 A22 A22 A22 A26 A24 A22 A22 A22 A26 A22 A22 A22 A22 A22 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 8 AOO Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 AOO AOO A28 A28 A28 A26 ROO A20 AOO A28 A20 A26 A20 A26 Sh 1 ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9B-2s Sh 1 3.9B-2s Sh 2 3 9B-2t Sh 1 3.9B-2t Sh 2 3.9B-2t Sh 3 3.9B-2Q Sh 1 3.9B-2u Sh 2 3.9B-2u Sh 3 3.9B-2v Sh 1 3.9B-2v Sh 2 3.9B-2v Sh 3 3.9B-2v Sh 4 3.9B-2w Sh 1 3.9B-2w Sh 2 3.9B-2x Sh 1 3.9B-2x Sh 2 3.9B-2x Sh 3 3.9B-2x Sh 4 3.9B-2y Sh 1 3.9B-2y Sh 2 3.9B-2z Sh 1 3.9B-2z Sh 2 3.9B-2z Sh 3 3.9B-3 Sh 1 3.9B-3 Sh 2 3.9B-3 Sh 3 3.9B-3 Sh 4 3.9B-4 Sh 1 3.9B-4 Sh 1a 3.9B-4 Sh 2 3.9B-5 3.9B-6 Sh 1 3.9B-6 Sh 2 3.9B-6 Sh 3 3.9B-7 3.9B-8 3.9B-9 Sh 1 3.9B-9 Sh 2 3.9B-9 Sh 3 3.9B-9 Sh 4 3.9B-10 Sh 1 3.9B-10 Sh 2 3.9B-10 Sh 3 3.9B-11 Sh 1 3.9B-11 Sh 2 3.9B-11 Sh 3 A26 A27 A26 A26 A26 A23 A23 R03 AOO A28 R03 A24 AOO A28 A26 A24 A26 A24 A20 A20 A28 A28 A28 AOO AOO AOO AOO A28 A28 A25 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-9 October 1992 R I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=F icture Number Page T=Table Amendment F=FicFure Number F 3.9B-1 F 3.9B-2 F 3.9B-3 F 3.9B-4 F 3.9B-5 3.10A-1 3.10A-1a 3.10A-1b 3.10A-2 3.10A-3 3.10A-3a 3.10A-3b 3.10A-4 3.10A-5 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 3.10B-1 3.10B-2 3.10B-2a 3.10B-2b 3.10B-3 3.10B-3a 3.10B-3b 3.10B-4 3.10B-5 Sh 1 Sh 2.Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 R04 A26 AOO AOO AOO A20 A20 A20 AOO A20 A20 A20 AOO A27 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 R03 R03 A26 A26 A26 A26 A26 A26 A26 A22 A22 A22 A22 A22 A22 A22 A22 A22 3.10B-5a 3.10B-5b 3.10B-6 3.10B-7 T 3.10B-1 Sh 1 T 3.10B-1 Sh 2 T 3.10B-1 Sh 3 T 3.10B-1 Sh 4 T 3.10B-1 Sh 5 T 3.10B-2 F 3.10B-1 F 3.10B-2 F 3.10B-3 F 3.10B-4 3.11-1 3.11-1a 3.11-1b 3'1-2 3~1 1 3 3 e 1 1 3a 3.11-3b 3.11-4 3.11-5 3.11-6 3~1 1 7 App 3A 3A-i 3A-ii 3A-iii 3A-iv 3A-iva 3A-ivb 3A-v 3A-vi 3A-vii 3A-viii 3A-ix 3A-x 3A-1 3A-2 3A.1-1 3A.1-2 3A.1-3 T 3A.1-1 A22 A22 A22 A22 A20 A20 A20 A20 A20 A22 A22 A22 A22 A22 ROO ROO A19 ROO A19 A19 A07 R01 A19 ROO R01 AOO R03 R02 R02 R02 R02 R02 A27 A19 A23 A27 A05 A27 A09 A23 AOO AOO AOO A23 F 3A.1-1 3A.2-1 3A.2-2 3A.2-3 3A.2-4 F 3A.2-1 F 3A.2-2 3A.3-1 3A.3-2 3A.3-3 3A.3-4 3A.3-5 T 3A.3-1 F 3A.3-1 F 3A.3-2 3A.4-1 3A.4-2 F 3A.4-1 F 3A.4-2 F 3A.4-3 F 3A.4-4 3A.5-1 3A.5-1a 3A.5-1b 3A.5-2 3A.6-1 3A.6-2 F 3A.6-1 F 3A.6-2 3A.7-1 T 3A.7-1 F 3A.7-1 F 3A.7-2 3A.8-1 3A.8-2 3A.8-3 3A.9-1 3A.9-2 3A.9-3 3A.9-4 3A.9-5 3A.9-6 F 3A.9-1 F 3A.9-2 F 3A.9-3 F 3A.9-4~AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R03 R03 R03 AOO AOO AOO AOO AOO A25 A25 A25 A25 AOO AOO AOO A27 A27 A27 A27 AOO A27 AOO AOO AOO AOO USAR Revision 4 EP 3-10 October 1992 4-J Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES.CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 3A.9-5 F 3A.9-6 F 3A.9-7 3A.10-1 3A.10-2 3A.10-3 T 3A.10-1 F 3A.10-1 F 3A.10-2 F 3A.10-3 F 3A.10-4 3A.11-1 3A.12-1 3A.12-2 T 3A.12-1 Sh 1 T 3A.12-1 Sh 2 F 3A.12-1 3A.13-1 3A.13-2 T 3A.13-1 T 3A.13-2 F 3A.13-1 F 3A.13-2 3A.14-1 3A.14-2 3A.14-3 T 3A.14-1 F 3A.14-1 F 3A.14-2 3A.15-1 3A.15-2 T 3A.15-1 T 3A.15-2 T 3A.15-3 T 3A.15-4 T 3A.15-5 T 3A.15-6 T 3A.15-7 T 3A.15-8 T 3A.15-9 T 3A.15-10 F 3A.15-1 F 3A.15-2 F 3A.15-3 3A.15A-1 3A.15A-2 AOO AOO AOO A27 A27 A27 A27 AOO AOO AOO A27 AOO AOO AOO A26 A26 ROO A03 AOO'03 A03 ROO A03 AOO AOO AOO AOO AOO AOO R02 R02 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R02 R02 3A.16-1 3A.16-2 T 3A.16-1 T 3A.16-2 T 3A.16-3 T 3A.16-4 T 3A.16-5 3A.17-1 3A.17-2 3A.17-3 T 3A.17-1 T 3A.17-2 T 3A.17-3 T 3A.17-4 T 3A.17-5 3A.18-1 3A.18-1a 3A.18-1b 3A.18-2 T 3A.18-1 F 3A.18-1 F 3A.18-2 3A.19-1 F 3A.19-1 F 3A.19-2 3A.20-1 3A.20-2 T 3A.20-1 F 3A.20-1 F 3A.20-2 F 3A.20-3 F 3A.20-4 F 3A.20-5 3A.21-1 3A.21-2 T 3A.21-1 T 3A.21-2 F 3A.21-1 F 3A.21-2 F 3A.21-3 F 3A.21-4 3A.22-1 3A.22-2 T 3A.22-1 T 3A.22-2 F 3A.22-1 A19 A19 A19 A19 A19 A19 A19 AOO AOO AOO AOO AOO AOO AOO AOO A23 A25 A05 A05 A05 A05 A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO AOO A27 3A.23-1 3A.23-2 T 3A.23-1 Sh 1 T 3A.23-1 Sh 2 3A.24-1 3A.24-2 T 3A.24-1 T 3A.24-2 F 3A.24-1 F 3A.24-2 F 3A.24-3 3A.25-1 3A.26-1 3A.26-2 T 3A.26-1 F 3A.26-1 F 3A.26-2 3A.27-1 3A.27-2 T 3A.27-1 3A.28-1 3A.28-2 3A.28-3 3A.29-1 3A.30-1 3A.30-2 3A.31-1 3A.31-2 3A.32-1 3A.33-1 3A.33-2 T 3A.33-1 T 3A.33-2 App 3B 3B-i 3B-ii 3B-iii 3B-iv 3B-v 3B-vi 3B-1 3B-2 3B-3 3B-4 3B-5 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A04 AOO AOO AOO A03 A03 AOO AOO AOO AOO AOO AOO A04 A09 A09 A09 A09 A23 A23 A23 A23 A23 AOO ROO R02 AOO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 3-11 October 1992
~,lt' NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=Ficpure Number3B-63B-73B-83B-93B-103B-113B-12T3B-1Sh1T3B-1Sh2T3B-1Sh3T3B-2T3B-3Sh1T3B-3Sh2T3B-3Sh3T3B3Sh4T3B-3Sh5T3B-3Sh6T3B-3Sh7T3B-4Sh1T3B-4Sh2T3B-5Sh1T3B-5Sh2T3B-5Sh3T3B-5Sh4T3B-5Sh5T3B-5Sh5aT3B-6Sh1T3B-6Sh2T3B-6Sh3T3B-6Sh4T3B-6Sh5T3B-6Sh6T3B-7T3B-8T3B-9T3B-10T3B-11T3B-12T3B-13T3B-14T3B-15T3B-16T3B-17T3B-18F3B-1Sh1F3B-1Sh2ROOROOROOROOROOR01ROOROOROOROOROOROOROOROOROOROOROOROOR03R03R02ROOR02R02R02R02R02ROOR02R02R02R02R01ROOROOROOROOROOROOROOROOROOROOROOROOR01FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF3B-1Sh33B-1Sh43B-1Sh53B-2Sh13B-2Sh23B-2Sh33B-2Sh43B-2Sh53B-33B-43B-53B-63B-73B-83B-93B-103B-113B-123B-133B-143B-153B-163B-173B-183B-193B-203B-213B-223B-233B-243B-253B-263B-273B-283B-293B-303B-313B-323B-333B-343B-353B-363B-373B-383B-393B-40ROOROOROOROOR01R02ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOF3B-41F3B-42F3B-43F3B-44F3B-45F3B-46F3B-47F3B-48F3B-49F3B-50F3B-51F3B-52F3B-53F3B-54F3B-55F3B-56App3C3C-i3C-ii3C-13C-23C-33C-43C-53C-63C-73C-83C-93C-103C-113C-11a3C-11b3C-123C-133C-143C-153C-163C-173C-183C-193C-203C-213C-223C-233C-24ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOAOOR03A26AOOR03ROOR03R03R03R03R03R03R03A28R03A18R03R03A28A12A12A12A12A12A28A12ROOA13A27USARRevision4EP3-12October1992
~, lt' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number 3B-6 3B-7 3B-8 3B-9 3B-10 3B-11 3B-12 T 3B-1 Sh 1 T 3B-1 Sh 2 T 3B-1 Sh 3 T 3B-2 T 3B-3 Sh 1 T 3B-3 Sh 2 T 3B-3 Sh 3 T 3B3 Sh 4 T 3B-3 Sh 5 T 3B-3 Sh 6 T 3B-3 Sh 7 T 3B-4 Sh 1 T 3B-4 Sh 2 T 3B-5 Sh 1 T 3B-5 Sh 2 T 3B-5 Sh 3 T 3B-5 Sh 4 T 3B-5 Sh 5 T 3B-5 Sh 5a T 3B-6 Sh 1 T 3B-6 Sh 2 T 3B-6 Sh 3 T 3B-6 Sh 4 T 3B-6 Sh 5 T 3B-6 Sh 6 T 3B-7 T 3B-8 T 3B-9 T 3B-10 T 3B-11 T 3B-12 T 3B-13 T 3B-14 T 3B-15 T 3B-16 T 3B-17 T 3B-18 F 3B-1 Sh 1 F 3B-1 Sh 2 ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R03 R03 R02 ROO R02 R02 R02 R02 R02 ROO R02 R02 R02 R02 R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R01 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3B-1 Sh 3 3B-1 Sh 4 3B-1 Sh 5 3B-2 Sh 1 3B-2 Sh 2 3B-2 Sh 3 3B-2 Sh 4 3B-2 Sh 5 3B-3 3B-4 3B-5 3B-6 3B-7 3B-8 3B-9 3B-10 3B-11 3B-12 3B-13 3B-14 3B-15 3B-16 3B-17 3B-18 3B-19 3B-20 3B-21 3B-22 3B-23 3B-24 3B-25 3B-26 3B-27 3B-28 3B-29 3B-30 3B-31 3B-32 3B-33 3B-34 3B-35 3B-36 3B-37 3B-38 3B-39 3B-40 ROO ROO ROO ROO R01 R02 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO F 3B-41 F 3B-42 F 3B-43 F 3B-44 F 3B-45 F 3B-46 F 3B-47 F 3B-48 F 3B-49 F 3B-50 F 3B-51 F 3B-52 F 3B-53 F 3B-54 F 3B-55 F 3B-56 App 3C 3C-i 3C-ii 3C-1 3C-2 3C-3 3C-4 3C-5 3C-6 3C-7 3C-8 3C-9 3C-10 3C-11 3C-11a 3C-11b 3C-12 3C-13 3C-14 3C-15 3C-16 3C-17 3C-18 3C-19 3C-20 3C-21 3C-22 3C-23 3C-24 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO R03 A26 AOO R03 ROO R03 R03 R03 R03 R03 R03 R03 A28 R03 A18 R03 R03 A28 A12 A12 A12 A12 A12 A28 A12 ROO A13 A27 USAR Revision 4 EP 3-12 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER3PageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure Number3C-253C-263C-26a3C-26b3C-273C-27a3C-27b3C-283C-293C-303C-30a3C-30b3C-313C-323C-333C-34F3C.3-1F3C.3-2F3C.3-3T3C.4-1T3C.4-2T3C.4-3T3C.4-4T3C.4-5T3C.4-6T3C.5-1T3C.5-2ShT3C.5-2ShApp3D3D-13D-23D-33D-43D-53D-63D-73D-83D-93D-103D-113D-123D-133D-143D-153D-16ROOA27A27A27A27ROOA27A27A13A27A27A27A13A27ROOA27A12A12A12A27A27A27A27A18A13A27A26A13ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROO3D-173D-183D-19T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1T3D-1App3E3E-13E-23E-33E-4Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOUSARRevision4EP3-13October1992 n~
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 3C-25 3C-26 3C-26a 3C-26b 3C-27 3C-27a 3C-27b 3C-28 3C-29 3C-30 3C-30a 3C-30b 3C-31 3C-32 3C-33 3C-34 F 3C.3-1 F 3C.3-2 F 3C.3-3 T 3C.4-1 T 3C.4-2 T 3C.4-3 T 3C.4-4 T 3C.4-5 T 3C.4-6 T 3C.5-1 T 3C.5-2 Sh T 3C.5-2 Sh App 3D 3D-1 3D-2 3D-3 3D-4 3D-5 3D-6 3D-7 3D-8 3D-9 3D-10 3D-11 3D-12 3D-13 3D-14 3D-15 3D-16 ROO A27 A27 A27 A27 ROO A27 A27 A13 A27 A27 A27 A13 A27 ROO A27 A12 A12 A12 A27 A27 A27 A27 A18 A13 A27 A26 A13 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 3D-17 3D-18 3D-19 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 App 3E 3E-1 3E-2 3E-3 3E-4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 3-13 October 1992 n~
NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER4PAGESPageT=TableAmendment F=Picpure NumberPageT=TableAmendment F=Ficpure NumberPageT=TableAmendment F=FicFure Number4-i4-114-iii4-iiia4-iiib4-1v4-v4-vi4-vii4-viii4.1-14.1-24.1-34.1-44.1-54.1-64.1-74.1-84.1-94.1-104.1-114'-124.1-134'-144.1-154'-164.2-14.2-24'-14.3-24.3-34.3-4T4.3-1T4.3-2T4.3-3F4.3-1F4.3-24'-14'-24.4-2a4.4-2b4.4-3A07A24A16A16A16AOOR04R03R03A09R04R03AOOAOOA27A19A19AOOA19A19A19A19AOOA19A19AOOR03A14R03AOOA19AOOAOOAOOAOOAOOA19R03R03R01A07A194~4-44.4-54.4-64.4-74.4-84.4-94.4-9a4.4-9b4.4-9c4.4-9d4.4-104.4-11T4.4-1S?11T4.4-1Sh2T4.4-2T4.4-3T4.4-4T4.4-5T4.4-6T4.4-7T4.4-8T4'-9F4.4-1F4.4-2F4'-3F4.4-4F4.4-5F4.4-6F4.4-7F4.4-8F4.4-9F4.4-104.5-14.5-24.5-34.5-44.5-54.5-64.5-6a4.5-6b4.5-74.5-84.5-94.5-10R03R03A19AOOR03R03R03R03A17R03A09A07R03R03A19A19AOOA19A24A19A23R03AOOAOOAOOAOOAOOA16R03R03R03R03A19AOOA27AOOA27A19A19A19AOOA27AOOAOO4.6-14.6-24.6-34.6-44.6-54.6-64.6-74.6-84.6-8a4.6-8b4.6-94.6-104.6-114.6-124.6-12a4.6-12b4.6-12c4.6-12d4.6-12e4.6-12f4.6-12g4.6-12114.6-12i4.6-12j4.6-134.6-144.6-154.6-164.6-174.6-184.6-194.6-204.6-214.6-224.6-234.6-244.6-254.6-264.6-274.6-284'-294.6-304.6-314.6-324.6-334.6-34AOOAOOA27AOOAOOAOOAOOA05A23A05A19AOOAOOA05A05A05A05A05A05A05A25A07R03A07AOOAOOAOOA26AOOA26A19AOOR03AOOAOOAOOAOOAOOAOOA19AOOAOOAOOAOOAOOA19USARRevision4EP4-1October1992 I~+4A NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER4PagePagePageT=TableAmendment T=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberF=FicFure Number4.6-354.6-364.6-374.6-38F4.6-1F4.6-2F4.6-3F4.6-4F4.6-5aF4'-5bF4.6-5cF4.6-6F4.6-7S11F4.6-7S11F4.6-7S11F4.,6-8F4.6-9A25R04AOOA05AOOAOOA19AOOR03R03R01AOO1A232A233A23AOOAOOApp4A4A-14A-2ROOR01ROOUSARRevision4EP4-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 4 PAGES Page T=Table Amendment F=Picpure Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=FicFure Number 4-i 4-11 4-iii 4-iiia 4-iiib 4-1v 4-v 4-vi 4-vii 4-viii 4.1-1 4.1-2 4.1-3 4.1-4 4.1-5 4.1-6 4.1-7 4.1-8 4.1-9 4.1-10 4.1-11 4'-12 4.1-13 4'-14 4.1-15 4'-16 4.2-1 4.2-2 4'-1 4.3-2 4.3-3 4.3-4 T 4.3-1 T 4.3-2 T 4.3-3 F 4.3-1 F 4.3-2 4'-1 4'-2 4.4-2a 4.4-2b 4.4-3 A07 A24 A16 A16 A16 AOO R04 R03 R03 A09 R04 R03 AOO AOO A27 A19 A19 AOO A19 A19 A19 A19 AOO A19 A19 AOO R03 A14 R03 AOO A19 AOO AOO AOO AOO AOO A19 R03 R03 R01 A07 A19 4~4-4 4.4-5 4.4-6 4.4-7 4.4-8 4.4-9 4.4-9a 4.4-9b 4.4-9c 4.4-9d 4.4-10 4.4-11 T 4.4-1 S?1 1 T 4.4-1 Sh 2 T 4.4-2 T 4.4-3 T 4.4-4 T 4.4-5 T 4.4-6 T 4.4-7 T 4.4-8 T 4'-9 F 4.4-1 F 4.4-2 F 4'-3 F 4.4-4 F 4.4-5 F 4.4-6 F 4.4-7 F 4.4-8 F 4.4-9 F 4.4-10 4.5-1 4.5-2 4.5-3 4.5-4 4.5-5 4.5-6 4.5-6a 4.5-6b 4.5-7 4.5-8 4.5-9 4.5-10 R03 R03 A19 AOO R03 R03 R03 R03 A17 R03 A09 A07 R03 R03 A19 A19 AOO A19 A24 A19 A23 R03 AOO AOO AOO AOO AOO A16 R03 R03 R03 R03 A19 AOO A27 AOO A27 A19 A19 A19 AOO A27 AOO AOO 4.6-1 4.6-2 4.6-3 4.6-4 4.6-5 4.6-6 4.6-7 4.6-8 4.6-8a 4.6-8b 4.6-9 4.6-10 4.6-11 4.6-12 4.6-12a 4.6-12b 4.6-12c 4.6-12d 4.6-12e 4.6-12f 4.6-12g 4.6-1211 4.6-12i 4.6-12j 4.6-13 4.6-14 4.6-15 4.6-16 4.6-17 4.6-18 4.6-19 4.6-20 4.6-21 4.6-22 4.6-23 4.6-24 4.6-25 4.6-26 4.6-27 4.6-28 4'-29 4.6-30 4.6-31 4.6-32 4.6-33 4.6-34 AOO AOO A27 AOO AOO AOO AOO A05 A23 A05 A19 AOO AOO A05 A05 A05 A05 A05 A05 A05 A25 A07 R03 A07 AOO AOO AOO A26 AOO A26 A19 AOO R03 AOO AOO AOO AOO AOO AOO A19 AOO AOO AOO AOO AOO A19 USAR Revision 4 EP 4-1 October 1992 I~+4A Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 4 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 4.6-35 4.6-36 4.6-37 4.6-38 F 4.6-1 F 4.6-2 F 4.6-3 F 4.6-4 F 4.6-5a F 4'-5b F 4.6-5c F 4.6-6 F 4.6-7 S11 F 4.6-7 S11 F 4.6-7 S11 F 4.,6-8 F 4.6-9 A25 R04 AOO A05 AOO AOO A19 AOO R03 R03 R01 AOO 1 A23 2 A23 3 A23 AOO AOO App 4A 4A-1 4A-2 ROO R01 ROO USAR Revision 4 EP 4-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER5PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=Ficpure Number5-i5-ii5-iii5-iv5-v5-vi5-vii5-viii5-ix5-ixa5-ixb5-x5-xa5-xb5-xi5.1-15.1-25.1-35.1-4F5.1-1aF5.1-1bF5.1-2aF5'-2bF5.1-2c5.2-15.2-25.2-35.2-45.2-4a5.2-4b5.2-55.2-5a5.2-5b5.2-65.2-75.2-85.2-8a5'-8b5.2-95.2-9a5.2-9b5.2-105.2-10a5-2-10bA07R04A24R03A24R04A24R04R03R03R03.R03R02A07A24AOOAOOA19AOOA24A19R04R03R03A15R03R03A24R03A07R03R03ROOROOAOOA07A19A07A13A06A06A23A07A075'-115.2-125.2-12a5'-12b5.2-12c5'-12d5.2-1352-1452-155'-1652-1752-185.2-195'-205.2-215.2-21a5'-21b5.2-225.2-235.2-245.2-255.2-265'-275'-285.2-28a5'-28b5'-295'-305.2-315.2-325.2-32a5-2-32b5'-335.2-33a5.2-33b5.2-345-2-355'-3652-375.2-37a5.2-37b5'-385.2-395.2-405.2-415.2-42ROOA07'24A24R03A07AOOAOOAOOAOOR04AOOROOA05A19~R01A05AOOAOOAOOAOOAOOAOOR01A22A11R02R02R02A23A23A05R03R03A05ROOROOROOA23ROOA23A10ROOR01AOOAOO5.2-435.2-445.2-455.2-45a5.2-45b5.2-46T5.2-1ShTTT5.2-15.2-15.2-1ShShSh5.2-1ShTTTTT5.2-15.2-15.2-15.2-15.2-1ShShShShShTTTT5.2-15.2-15.2-15.2-1ShShShSh5.2-15.2-1ShShTTTT5.2-15.2-15.2-15.2-1ShShShSh5.2-2T5.2-3T5.2-4T5.2-5ShTTTTTT5.2>>55.2-55.2-55.2-55.2-55.2-5ShShShShShSh5.2-65.2-7TTT5.2-85.2-95.2-10FFFFF5.2-15.2-25.2-35.2-45.2-4ShSh1233a3b55a66a6b6b16ba788a8a18b8c8d1233a45612AOOR01A05A05A05ROOROOA23ROOA23R02A21A25ROOA28A23A28A21A19A11A19A21ROOA26A28A28R03R03R03A24A23A28A28R01A24A23A23R04R02ROOROOR03AOOAOOA23R03USARRevision4EP5-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 5 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number 5-i 5-ii 5-iii 5-iv 5-v 5-vi 5-vii 5-viii 5-ix 5-ixa 5-ixb 5-x 5-xa 5-xb 5-xi 5.1-1 5.1-2 5.1-3 5.1-4 F 5.1-1a F 5.1-1b F 5.1-2a F 5'-2b F 5.1-2c 5.2-1 5.2-2 5.2-3 5.2-4 5.2-4a 5.2-4b 5.2-5 5.2-5a 5.2-5b 5.2-6 5.2-7 5.2-8 5.2-8a 5'-8b 5.2-9 5.2-9a 5.2-9b 5.2-10 5.2-10a 5-2-10b A07 R04 A24 R03 A24 R04 A24 R04 R03 R03 R03.R03 R02 A07 A24 AOO AOO A19 AOO A24 A19 R04 R03 R03 A15 R03 R03 A24 R03 A07 R03 R03 ROO ROO AOO A07 A19 A07 A13 A06 A06 A23 A07 A07 5'-11 5.2-12 5.2-12a 5'-12b 5.2-12c 5'-12d 5.2-13 5 2-14 5 2-15 5'-16 5 2-17 5 2-18 5.2-19 5'-20 5.2-21 5.2-21a 5'-21b 5.2-22 5.2-23 5.2-24 5.2-25 5.2-26 5'-27 5'-28 5.2-28a 5'-28b 5'-29 5'-30 5.2-31 5.2-32 5.2-32a 5-2-32b 5'-33 5.2-33a 5.2-33b 5.2-34 5-2-35 5'-36 5 2-37 5.2-37a 5.2-37b 5'-38 5.2-39 5.2-40 5.2-41 5.2-42 ROO A07'24 A24 R03 A07 AOO AOO AOO AOO R04 AOO ROO A05 A19~R01 A05 AOO AOO AOO AOO AOO AOO R01 A22 A11 R02 R02 R02 A23 A23 A05 R03 R03 A05 ROO ROO ROO A23 ROO A23 A10 ROO R01 AOO AOO 5.2-43 5.2-44 5.2-45 5.2-45a 5.2-45b 5.2-46 T 5.2-1 Sh T T T 5.2-1 5.2-1 5.2-1 Sh Sh Sh 5.2-1 Sh T T T T T 5.2-1 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh Sh T T T T 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh 5.2-1 5.2-1 Sh Sh T T T T 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh 5.2-2 T 5.2-3 T 5.2-4 T 5.2-5 Sh T T T T T T 5.2>>5 5.2-5 5.2-5 5.2-5 5.2-5 5.2-5 Sh Sh Sh Sh Sh Sh 5.2-6 5.2-7 T T T 5.2-8 5.2-9 5.2-10 F F F F F 5.2-1 5.2-2 5.2-3 5.2-4 5.2-4 Sh Sh 1 2 3 3a 3b 5 5a 6 6a 6b 6b1 6ba 7 8 8a 8a1 8b 8c 8d 1 2 3 3a 4 5 6 1 2 AOO R01 A05 A05 A05 ROO ROO A23 ROO A23 R02 A21 A25 ROO A28 A23 A28 A21 A19 A11 A19 A21 ROO A26 A28 A28 R03 R03 R03 A24 A23 A28 A28 R01 A24 A23 A23 R04 R02 ROO ROO R03 AOO AOO A23 R03 USAR Revision 4 EP 5-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER5PageT=TableF=FicFure Amendment NumberPageT=TableAmendment g~FiureNumberPageT=TableAmendment
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 5 Page T=Table F=FicFure Amendment Number Page T=Table Amendment g~Fi ure Number Page T=Table Amendment~F~q~ure Number F 5'-5 F 5.2-5a F 5.2-6 F 5.2-7 F 5.2-8 F 5.2-9 5.3-1 5.3-2 5'-3 5.3-4 5.3-5 5.3-6 5.3-7 5.3-7a 5.3-7b 5.3-8 5.3-9 5.3-10 5.3-11 5.3-11a 5.3-11b 5.3-12 5.3-13 5.3-14 5.3-15 5.3-16 5.3-17 5.3-18 5.3-19 5.3-20 5'-21 5.3-22 T 5.3-1 S11 1 T 5.3-1 S?1 2 T 5.3-2a T 5.3-2b F 5.3-1 F 5.3-2 F 5.3-2a F 5.3-2b F 5.3-2c F 5'-2d F 5.3-2e F 5.3-3 F 5.3-4 AOO A07 AOO AOO AOO AOO A24 A23 A24 All A24 R03 R03 A24 A24 AOO All R02 R03 R03 R03 R03 AOO All A24 AOO ROO A24 A23 A24 A27 AOO AOO AOO R03 R03 AOO A24 R03 R03 R03 R03 R03 R03 AOO F 5.3-5 5.4-1 5.4-2 5.4-3 5.4-4 5.4-4a 5.4-4b 5.4-5 5.4-5a 5.4-5b 5.4-6 5.4-7 5.4-8 5.4-9 5.4-9a 5.4-9b 5.4-10 5.4-11 5.4-12 5.4-13 5'-14 5.4-15 5.4-16 5.4-17 5.4-17a 5.4-17b 5.4-18 5'-19 5.4-20 5.4-21 5.4-21a 5.4-21b 5.4-22 5.4-23 5.4-23a 5.4-23b 5.4-24 5.4-25 5.4-26 5.4-27 5.4-28 5.4-28a 5.4-28b 5.4-29 5.4-30 A24 ROO A24 A24 A23 A23 A23 A24 A24 A24 A24 A24 A24 Rol A28 A28 Rol Rol A28 ROO A28 A28 ROO R02 ROO ROO AOO Rol AOO A05 A24 A07 A24 ROO ROO ROO A09 A24 A24 A27 A05 A24 A05 A24 A24 5'-31 5.4-32 5.4-33 5'-34 5'-34a 5'-34b 5.4-34c 5.4-34d 5.4-35 5.4-36 5.4-37 5.4-37a 5.4-37b 5.4-38 5.4-38a 5.4-38b 5'-39 5.4-40 5.4-41 5.4-42 5.4-42a 5.4-42b 5.4-43 5.4-43a 5.4-43b 5.4-44 5'-45 5.4-45a 5.4-45b 5.4-46 5.4-47 5.4-48 5.4-49 5.4-50 5.4-50a 5'-50b 5.4-51 5.4-51a 5.4-51b 5.4-52 5.4-53 5.4-54 T 5'-1 T 5.4-1 T 5.4-1 T 5'-2 S11 1 S11 2 Sh 3.A24 A24 A24 R03 A28 A28 A28 A28 AOO ROO R04 R03 A13 R04 R04 A13 ROO A05 A27 A05 ROO A05 Rol Alo A05 AOO ROO A05 A05 ROO ROO ROO A24 ROO ROO ROO Rol A13 A13 AOO AOO A28 A24 A24 AOO A28 USAR Revision 4 EP 5-2 October 1992
~F~q~ureNumberF5'-5F5.2-5aF5.2-6F5.2-7F5.2-8F5.2-95.3-15.3-25'-35.3-45.3-55.3-65.3-75.3-7a5.3-7b5.3-85.3-95.3-105.3-115.3-11a5.3-11b5.3-125.3-135.3-145.3-155.3-165.3-175.3-185.3-195.3-205'-215.3-22T5.3-1S111T5.3-1S?12T5.3-2aT5.3-2bF5.3-1F5.3-2F5.3-2aF5.3-2bF5.3-2cF5'-2dF5.3-2eF5.3-3F5.3-4AOOA07AOOAOOAOOAOOA24A23A24AllA24R03R03A24A24AOOAllR02R03R03R03R03AOOAllA24AOOROOA24A23A24A27AOOAOOAOOR03R03AOOA24R03R03R03R03R03R03AOOF5.3-55.4-15.4-25.4-35.4-45.4-4a5.4-4b5.4-55.4-5a5.4-5b5.4-65.4-75.4-85.4-95.4-9a5.4-9b5.4-105.4-115.4-125.4-135'-145.4-155.4-165.4-175.4-17a5.4-17b5.4-185'-195.4-205.4-215.4-21a5.4-21b5.4-225.4-235.4-23a5.4-23b5.4-245.4-255.4-265.4-275.4-285.4-28a5.4-28b5.4-295.4-30A24ROOA24A24A23A23A23A24A24A24A24A24A24RolA28A28RolRolA28ROOA28A28ROOR02ROOROOAOORolAOOA05A24A07A24ROOROOROOA09A24A24A27A05A24A05A24A245'-315.4-325.4-335'-345'-34a5'-34b5.4-34c5.4-34d5.4-355.4-365.4-375.4-37a5.4-37b5.4-385.4-38a5.4-38b5'-395.4-405.4-415.4-425.4-42a5.4-42b5.4-435.4-43a5.4-43b5.4-445'-455.4-45a5.4-45b5.4-465.4-475.4-485.4-495.4-505.4-50a5'-50b5.4-515.4-51a5.4-51b5.4-525.4-535.4-54T5'-1T5.4-1T5.4-1T5'-2S111S112Sh3.A24A24A24R03A28A28A28A28AOOROOR04R03A13R04R04A13ROOA05A27A05ROOA05RolAloA05AOOROOA05A05ROOROOROOA24ROOROOROORolA13A13AOOAOOA28A24A24AOOA28USARRevision4EP5-2October1992


NineMilePointUnit2FSARLIST'OFEFFECTIVE PAGESCHAPTER5PageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFureNumberF=FicFure NumberTFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF5.4-35.4-15.4-2a5.4-2b5.4-2c5.4-2d5.4-35.4-45.4-55.4-65.4-75.4-85.4-9a5.4-9b5.4-9c5.4-9d5.4-10S1115'-10S?125.4-10a5.4-10b5.4-115.4-125.4-13a5.4-13b5.4-13c54-13d5.4-13e5'-13f5.4-13g5.4-14Sh15.4-14Sh25.4-14S?135'-155.4-16a5.4-16b5.4-16c5.4-16d5.4-16e5.4-16f5.4-17Sh15.4-17Sh25.4-17S?135.4-185.4-19AOOAOOROOR03R03R04AOOAOOAOOAOOA28A28ROOR01ROOR01A23A23A24A07AOOAOOROOROOROOR03R03ROOR03A23A23R03AOOR04ROOR04R04R04R04R02A23AOOROOA23SA-i5A-15A-25A-2a5A-2b5A-3T5A-1Sh1T5A-1Sb2.T5A-2Sh1T5A-2S112T5A-3aT5A-3bT5A-4F5.A-1F5.A-2'tt5A-1App5B5B-15B-25B-3A24R03R03R03A28R03AOOAOOAOOAOOR03R03AOOAOOAOOAOOROOROOROOR03App5AUSARRevision4AOOEP5-3October1992
Nine Mile Point Unit 2 FSAR LIST'OF EFFECTIVE PAGES CHAPTER 5 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=F icF ure Number F=FicFure Number T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 5.4-3 5.4-1 5.4-2a 5.4-2b 5.4-2c 5.4-2d 5.4-3 5.4-4 5.4-5 5.4-6 5.4-7 5.4-8 5.4-9a 5.4-9b 5.4-9c 5.4-9d 5.4-10 S11 1 5'-10 S?1 2 5.4-10a 5.4-10b 5.4-11 5.4-12 5.4-13a 5.4-13b 5.4-13c 5 4-13d 5.4-13e 5'-13f 5.4-13g 5.4-14 Sh 1 5.4-14 Sh 2 5.4-14 S?1 3 5'-15 5.4-16a 5.4-16b 5.4-16c 5.4-16d 5.4-16e 5.4-16f 5.4-17 Sh 1 5.4-17 Sh 2 5.4-17 S?1 3 5.4-18 5.4-19 AOO AOO ROO R03 R03 R04 AOO AOO AOO AOO A28 A28 ROO R01 ROO R01 A23 A23 A24 A07 AOO AOO ROO ROO ROO R03 R03 ROO R03 A23 A23 R03 AOO R04 ROO R04 R04 R04 R04 R02 A23 AOO ROO A23 SA-i 5A-1 5A-2 5A-2a 5A-2b 5A-3 T 5A-1 Sh 1 T 5A-1 Sb 2.T 5A-2 Sh 1 T 5A-2 S11 2 T 5A-3a T 5A-3b T 5A-4 F 5.A-1 F 5.A-2'tt 5A-1 App 5B 5B-1 5B-2 5B-3 A24 R03 R03 R03 A28 R03 AOO AOO AOO AOO R03 R03 AOO AOO AOO AOO ROO ROO ROO R03 App 5A USAR Revision 4 AOO EP 5-3 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER6PageT=TableF=Ficture Amendment NumberPageT=TableF=Ficrure Amendment NumberPageT=TableAmendment FF=icFureNumber6-i6-ii6-iii6-iv6-v6-vi6-vii6-viii6-1x6-x6-xa6-xb6-xi6-xii6-xiii6x1v6-xiva6-xivb6-xv6-xvi6-xvii6-xviii6-xix6-xixa6-xixb6-xx6-xxi6-xxii6-xxiia6-xxiib6-xxiii6'-l6.1-26.1-36'-46.1-4a6.1-4b6.1-56.1-6T6.1-1T6.1-1T6'-2T6.1-2T6.1-3S111Sh2Sb1Sh2R04R03A24R03R04ROOROOA24A24ROOROOA11ROOA24A24A24A24A17A15R02A24A27R03R04R04A24A24A24A24A24R04A27A27R02R04A03A03A28A28A27A28ROOROOR046.2-16.2-26.2-2a6.2-2b6.2-36.2-46.2-56.2-6'6.2-6a6.2-6b6.2-76.2-86.2-96.2-106.2-116.2-126.2-136.2-146.2-156.2-15a6.2-15b6.2-166.2-176.2-186.2-196.2-206.2-216.2-226.2-236.2-246.2-24a6.2-24b6.2-24c6.2-24d6.2-256.2-25a6.2-25b6.2-266.2-276.2-286.2-296.2-306.2-30a6.2-30b6.2-316.2-32AOOA07ROOA07AOOAOOA23ROOA23ROOR03ROOA23AOOROOAOOAOOAOOROOROOROOROOAOOROOAOOAOOAOOAOOROOA20A18ROOROOA17ROOROOROOROOA05A05AOOAOOAllA11AOOAOO6.2-336.2-33a6.2-33b6.2-346.2-356.2-35a62-35b6.2-366.2-376.2-37a6.2-37b6.2-386.2-396.2-406.2-416.2-426.2-436.2-43a6.2-43b6.2-446.2-456.2-466.2-46a6.2-46b6.2-476.2-47a6.2-47b6.2-486.2-496.2-506.2-516.2-51a6.2-51b6.2-526.2-536.2-53a6.2-53b6.2-546.2-54a6.2-54b6.2-556.2-55a6.2-55b6.2-55c6.2-55d6.2-56ROOROOROOA11A23A05A05ROOA23ROOROOR02R03R03R04R03R03R01ROOA15ROOROOR04R04R04A05A05A15ROOROOA27A25A13A27R01A08A08ROOROOA27A21A27R01ROOROOA18USARRevision4EP6-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=Ficture Amendment Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F F=icFure Number 6-i 6-ii 6-iii 6-iv 6-v 6-vi 6-vii 6-viii 6-1x 6-x 6-xa 6-xb 6-xi 6-xii 6-xiii 6 x1v 6-xiva 6-xivb 6-xv 6-xvi 6-xvii 6-xviii 6-xix 6-xixa 6-xixb 6-xx 6-xxi 6-xxii 6-xxiia 6-xxiib 6-xxiii 6'-l 6.1-2 6.1-3 6'-4 6.1-4a 6.1-4b 6.1-5 6.1-6 T 6.1-1 T 6.1-1 T 6'-2 T 6.1-2 T 6.1-3 S11 1 Sh 2 Sb 1 Sh 2 R04 R03 A24 R03 R04 ROO ROO A24 A24 ROO ROO A11 ROO A24 A24 A24 A24 A17 A15 R02 A24 A27 R03 R04 R04 A24 A24 A24 A24 A24 R04 A27 A27 R02 R04 A03 A03 A28 A28 A27 A28 ROO ROO R04 6.2-1 6.2-2 6.2-2a 6.2-2b 6.2-3 6.2-4 6.2-5 6.2-6'6.2-6a 6.2-6b 6.2-7 6.2-8 6.2-9 6.2-10 6.2-11 6.2-12 6.2-13 6.2-14 6.2-15 6.2-15a 6.2-15b 6.2-16 6.2-17 6.2-18 6.2-19 6.2-20 6.2-21 6.2-22 6.2-23 6.2-24 6.2-24a 6.2-24b 6.2-24c 6.2-24d 6.2-25 6.2-25a 6.2-25b 6.2-26 6.2-27 6.2-28 6.2-29 6.2-30 6.2-30a 6.2-30b 6.2-31 6.2-32 AOO A07 ROO A07 AOO AOO A23 ROO A23 ROO R03 ROO A23 AOO ROO AOO AOO AOO ROO ROO ROO ROO AOO ROO AOO AOO AOO AOO ROO A20 A18 ROO ROO A17 ROO ROO ROO ROO A05 A05 AOO AOO All A11 AOO AOO 6.2-33 6.2-33a 6.2-33b 6.2-34 6.2-35 6.2-35a 6 2-35b 6.2-36 6.2-37 6.2-37a 6.2-37b 6.2-38 6.2-39 6.2-40 6.2-41 6.2-42 6.2-43 6.2-43a 6.2-43b 6.2-44 6.2-45 6.2-46 6.2-46a 6.2-46b 6.2-47 6.2-47a 6.2-47b 6.2-48 6.2-49 6.2-50 6.2-51 6.2-51a 6.2-51b 6.2-52 6.2-53 6.2-53a 6.2-53b 6.2-54 6.2-54a 6.2-54b 6.2-55 6.2-55a 6.2-55b 6.2-55c 6.2-55d 6.2-56 ROO ROO ROO A11 A23 A05 A05 ROO A23 ROO ROO R02 R03 R03 R04 R03 R03 R01 ROO A15 ROO ROO R04 R04 R04 A05 A05 A15 ROO ROO A27 A25 A13 A27 R01 A08 A08 ROO ROO A27 A21 A27 R01 ROO ROO A18 USAR Revision 4 EP 6-1 October 1992
.t NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER6PAGESPageT=TableFFicrureAmendment NumberPageT=Table.F=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number62-576.2-57a6.2-57b6.2-57c6.2-57d6.2-57e6.2-57f6.2-586.2-596.2-.59a6.2-59b6.2-606.2-60a6.2-60b6.2-616.2-61a6.2-61b6.2-626.2-62a6.2-62b6.2-636.2-63a6.2-63b6.2-646.2-656.2-65a6.2-65b6.2-666.2-676.2-67a6.2-67b6.2-686.2-68a6.2-68b6.2-696.2-69a6.2-69b6.2-706.2-716.2-71a6.2-71b6.2-726.2-72a6.2-72b6.2-736.2-74R04R04R03R04R04R03A26AOOROOROOROOA28A28A05A26ROOROOA07A23A07ROOROOROOA18A17A17A17AOOA26A21A21A26A25A05A11A05A05ROOA05A05A05R01ROOROOA28A276.2-756.2-75a6.2-75b6.2-766.2-76a6.2-76b6.2-776.2-77a6.2-77b6.2-786.2-796.2-79a6.2-79b6.2-806.2-80a6.2-80b62-816.2-826.2-836.2-83a6.2-83b6.2-846.2-84a6.2-84b6.2-856.2-85a6.2-85b6.2-866.2-86a6.2-86b6.2-876.2-87a6.2-87b6.2-886.2-88a6.2-88b6.2-89T6.2-1T6.2-2Sh1T6.2-2Sh2T6.2-3Sh1T6.2-3Sh2T6.2-3Sh3T6.2-4T6.2-4aT6.2-5ROOA27A05A15A28A05A27R04A15R03A15A15A15ROOA15A15ROOA15R01A27A23R03A23A23R03R03A17R03R03A17R03R01A17R03R01ROOA15AOOAOOAOOR03ROOROOAOOROOAOOT6.2-6Sh1T6.2-6Sh2T6.2-7T6.2-8T6.2-9T6.2-10T6.2-11T62-12T6.2-13T62-14T6.2-15Sh1T62-15Sh2T6.2-16T6'-17T6.2-18T6'-19T6.2-20T6.2-20aT6.2-21T6'-22T6'-23T6.2-24T6.2-25T6.2-26T6.2-27T6.2-27AT6.2-28T6.2-29T6.2-30T6.2-31T6.2-32T6.2-33T6.2-34T6.2-35T6.2-36T6.2-37T6.2-38Sh1T6.2-38Sh2T6.2-39Sh1T6.2-39Sh2T6.2-39Sh3T6.2-39Sh4T6.2-39Sh5T6.2-39Sh6T6.2-40T6.2-41ROOROOAOOAOOROOAOOAOOAOOAOOAOOA26AOOAOOAOOAOOAOOAOOA21AOOAOOAOOAOOAOOAOOAOOROOA11ROOROOROOROOROOROOA11A11A27A11A11A11A11A11A11A11A11A11A11USARRevision4EP6-2October1992
.t Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 6 PAGES Page T=Table F Ficrure Amendment Number Page T=Table.F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 6 2-57 6.2-57a 6.2-57b 6.2-57c 6.2-57d 6.2-57e 6.2-57f 6.2-58 6.2-59 6.2-.59a 6.2-59b 6.2-60 6.2-60a 6.2-60b 6.2-61 6.2-61a 6.2-61b 6.2-62 6.2-62a 6.2-62b 6.2-63 6.2-63a 6.2-63b 6.2-64 6.2-65 6.2-65a 6.2-65b 6.2-66 6.2-67 6.2-67a 6.2-67b 6.2-68 6.2-68a 6.2-68b 6.2-69 6.2-69a 6.2-69b 6.2-70 6.2-71 6.2-71a 6.2-71b 6.2-72 6.2-72a 6.2-72b 6.2-73 6.2-74 R04 R04 R03 R04 R04 R03 A26 AOO ROO ROO ROO A28 A28 A05 A26 ROO ROO A07 A23 A07 ROO ROO ROO A18 A17 A17 A17 AOO A26 A21 A21 A26 A25 A05 A11 A05 A05 ROO A05 A05 A05 R01 ROO ROO A28 A27 6.2-75 6.2-75a 6.2-75b 6.2-76 6.2-76a 6.2-76b 6.2-77 6.2-77a 6.2-77b 6.2-78 6.2-79 6.2-79a 6.2-79b 6.2-80 6.2-80a 6.2-80b 6 2-81 6.2-82 6.2-83 6.2-83a 6.2-83b 6.2-84 6.2-84a 6.2-84b 6.2-85 6.2-85a 6.2-85b 6.2-86 6.2-86a 6.2-86b 6.2-87 6.2-87a 6.2-87b 6.2-88 6.2-88a 6.2-88b 6.2-89 T 6.2-1 T 6.2-2 Sh 1 T 6.2-2 Sh 2 T 6.2-3 Sh 1 T 6.2-3 Sh 2 T 6.2-3 Sh 3 T 6.2-4 T 6.2-4a T 6.2-5 ROO A27 A05 A15 A28 A05 A27 R04 A15 R03 A15 A15 A15 ROO A15 A15 ROO A15 R01 A27 A23 R03 A23 A23 R03 R03 A17 R03 R03 A17 R03 R01 A17 R03 R01 ROO A15 AOO AOO AOO R03 ROO ROO AOO ROO AOO T 6.2-6 Sh 1 T 6.2-6 Sh 2 T 6.2-7 T 6.2-8 T 6.2-9 T 6.2-10 T 6.2-11 T 6 2-12 T 6.2-13 T 6 2-14 T 6.2-15 Sh 1 T 6 2-15 Sh 2 T 6.2-16 T 6'-17 T 6.2-18 T 6'-19 T 6.2-20 T 6.2-20a T 6.2-21 T 6'-22 T 6'-23 T 6.2-24 T 6.2-25 T 6.2-26 T 6.2-27 T 6.2-27A T 6.2-28 T 6.2-29 T 6.2-30 T 6.2-31 T 6.2-32 T 6.2-33 T 6.2-34 T 6.2-35 T 6.2-36 T 6.2-37 T 6.2-38 Sh 1 T 6.2-38 Sh 2 T 6.2-39 Sh 1 T 6.2-39 Sh 2 T 6.2-39 Sh 3 T 6.2-39 Sh 4 T 6.2-39 Sh 5 T 6.2-39 Sh 6 T 6.2-40 T 6.2-41 ROO ROO AOO AOO ROO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO A21 AOO AOO AOO AOO AOO AOO AOO ROO A11 ROO ROO ROO ROO ROO ROO A11 A11 A27 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 USAR Revision 4 EP 6-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER6PAGESPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberT6'-42T6.2-43T6.2-43AT6.2-43BT6.2-44T6.2-44AT6.2-44BT6.2-45T6.2-45AT6.2-45BT6.2-46T6'-47T6.2-48T6.2-49T6'-50T6'-51T6.2-52T6.2-53T6.2-54T6.2-55T6.2-55aSh1T6.2-55aSh2T6.2-55aSh3T6.2-55bSh1T6.2-55bSh2T62-55bSh3T6.2-55cSh1T6.2-55cSh2T6.2-55cSh3T6.2-55dSh1T6.2-55dSh2T6.2-55dSh3T6.2-56Sh1T6'-56Sh2T6.2-56Sh2aT6.2-56Sh3T62-56Sh4T6.2-56Sh5T6.2-56Sh6T62-56Sh7T6.2-56Sh8T6.2-56Sh9T6.2-56Sh10T6.2-56Sh11T6.2-56Sh12T6.2-56Sh13A11A11A11ROOA11A11A11A11A11A28A11A11A28A28AOOROOROOROOR04A21ROOROOROOROOROOROOR01ROOROOROOROOROOROOR01A28A28A28A21A28ROOR03R03A27A28R03A28TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTFFFFFFFFFFF6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-576.2-586.2-59Sh6.2-59Sh6.2-59ASh6.2-59ASh6.2-59B6.2-59C6.2-59D6.2-606.2-616.2-626.2-63Sh6.2-63Sh6.2-646.2-65Sh6..2-65Sh6.2-16.2-26.2-36.2-46.2-56.2-66.2-76.2-86.2-96.2-106.2-111415161717a181919a2020a212222a2323a2424a24b1212A27A28A28A28A28ROOR03A17ROOROOA26A27A26R03ROOA28R04R04A28AOOROOR03A18A18A18A15ROOR03A27A25A24A24ROOROOROOROOAOOAOOAOOAOOAOOAOOAOOAOOA27AOOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF6.2-126.2-136.2-146.2-156.2-166.2-176.2-186.2-196.2-206.2-216.2-226.2-236.2-246.2-256.2-266.2-276.2-286.2-28A6.2-28B6.2-28C6.2-296.2-29A6.2-29B6.2-29C6.2-29D6.2-29E6.2-29F6.2-29G6.2-29H6.2-29I6.2-29J6.2-306.2-30A6.2-316.2-31A6.2-31B6.2-326.2-33Sh6.2-33Sh6.2-33Sh6.2-33Sh6'-33Sh6.2-33Sh6.2-33Sh6.2-33Sh6.2-33AAOOAOOAOOAOOAOOAOOAOOAOOA18A18AOOA18AOOAOOAOOAOOROOROOROOROOAOO-A11A11A11A11A11A11A11A11A11A11A11A11A11ROOROOA11A23A23A23A23A23A23A23A23ROOUSARRevision4EP6-3October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 6 PAGES Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number T 6'-42 T 6.2-43 T 6.2-43A T 6.2-43B T 6.2-44 T 6.2-44A T 6.2-44B T 6.2-45 T 6.2-45A T 6.2-45B T 6.2-46 T 6'-47 T 6.2-48 T 6.2-49 T 6'-50 T 6'-51 T 6.2-52 T 6.2-53 T 6.2-54 T 6.2-55 T 6.2-55a Sh 1 T 6.2-55a Sh 2 T 6.2-55a Sh 3 T 6.2-55b Sh 1 T 6.2-55b Sh 2 T 6 2-55b Sh 3 T 6.2-55c Sh 1 T 6.2-55c Sh 2 T 6.2-55c Sh 3 T 6.2-55d Sh 1 T 6.2-55d Sh 2 T 6.2-55d Sh 3 T 6.2-56 Sh 1 T 6'-56 Sh 2 T 6.2-56 Sh 2a T 6.2-56 Sh 3 T 6 2-56 Sh 4 T 6.2-56 Sh 5 T 6.2-56 Sh 6 T 6 2-56 Sh 7 T 6.2-56 Sh 8 T 6.2-56 Sh 9 T 6.2-56 Sh 10 T 6.2-56 Sh 11 T 6.2-56 Sh 12 T 6.2-56 Sh 13 A11 A11 A11 ROO A11 A11 A11 A11 A11 A28 A11 A11 A28 A28 AOO ROO ROO ROO R04 A21 ROO ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO R01 A28 A28 A28 A21 A28 ROO R03 R03 A27 A28 R03 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-57 6.2-58 6.2-59 Sh 6.2-59 Sh 6.2-59A Sh 6.2-59A Sh 6.2-59B 6.2-59C 6.2-59D 6.2-60 6.2-61 6.2-62 6.2-63 Sh 6.2-63 Sh 6.2-64 6.2-65 Sh 6..2-65 Sh 6.2-1 6.2-2 6.2-3 6.2-4 6.2-5 6.2-6 6.2-7 6.2-8 6.2-9 6.2-10 6.2-11 14 15 16 17 17a 18 19 19a 20 20a 21 22 22a 23 23a 24 24a 24b 1 2 1 2 A27 A28 A28 A28 A28 ROO R03 A17 ROO ROO A26 A27 A26 R03 ROO A28 R04 R04 A28 AOO ROO R03 A18 A18 A18 A15 ROO R03 A27 A25 A24 A24 ROO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO A27 AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-12 6.2-13 6.2-14 6.2-15 6.2-16 6.2-17 6.2-18 6.2-19 6.2-20 6.2-21 6.2-22 6.2-23 6.2-24 6.2-25 6.2-26 6.2-27 6.2-28 6.2-28A 6.2-28B 6.2-28C 6.2-29 6.2-29A 6.2-29B 6.2-29C 6.2-29D 6.2-29E 6.2-29F 6.2-29G 6.2-29H 6.2-29I 6.2-29J 6.2-30 6.2-30A 6.2-31 6.2-31A 6.2-31B 6.2-32 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6'-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33A AOO AOO AOO AOO AOO AOO AOO AOO A18 A18 AOO A18 AOO AOO AOO AOO ROO ROO ROO ROO AOO-A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 ROO ROO A11 A23 A23 A23 A23 A23 A23 A23 A23 ROO USAR Revision 4 EP 6-3 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER6PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=Ficpure NumberFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF6.2-33B6.2-346.2-356'-366.2-376.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-386.2-396.2-39A6.2-406.2-416.2-426.2-436.2-446.2-456.2-466.2-46A6.2-476.2-486.2-496.2-506.2-516.2-526.2-536.2-536.2-536.2-536.2>>536.2-536.2-546.2-556.2-566.2-566.2-566.2-566.2-56Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh1Sh2Sh3Sh4Sh5Sh6Sh1Sh2Sh3Sh4Sh5ROOAOOAOOAOOAOOR03ROOR03R03R03R03ROOROOROOR03R03ROOAOOA09A27A27A28A27ROOROOROOROOAOOAOOAOOA27ROOAllAllAllAllAllAllAllA23AllAllA23A23A23A23F'FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-56Sh6.2-576.2-586'-59Sh6.2-59Sh6.2-59Sh6.2-59Sh6.2-59Sh6.2-606.2-616.2-62Sh6.2-62Sh6.2-62Sh62-62Sh6.2-62Sh6'-62A6'-636.2-64Sh6.2-64Sh6.2-64Sh6.2-64Sh6.2-64Sh6.2-64A6.2-656.2-66Sh6.2-66Sh6.2-66Sh6.2-66Sh6.2-66Sh,6.2-66Sh6.2-66A6.2-676.2-686.2-68A6.2-696.2-69A6'-70Sh6.2-70Sh6'-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6789101..2345A23A23A23A23A23AllAllAllAllAllAllAllA23AllAll2All3All4All5AllAllAllAllAllAllAllAllAllAllAllAllAllAllAllAllAllAllAllA27A27AllRolROOROOROOROOROOFFFFFFFFFFFFFFFFFFFFFFF6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6'-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh62-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6'-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-70Sh6.2-71a6.2-71b6.2-72a6.2-72b6.2-'72c6.2-72d7891011121314151617181920212223242526272829303131A32333435363738394041424343a43bROOROOROOROOROOROOROOROORolROOROOROOROOROOR02ROOROOROOROOR03RolROORolR02ROOROOR03ROORolROOROORolROOROOROORolROOR03ROOROOR03R03ROOROOA07ROOUSARRevision4EP6-4October1992 1
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-33B 6.2-34 6.2-35 6'-36 6.2-37 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-39 6.2-39A 6.2-40 6.2-41 6.2-42 6.2-43 6.2-44 6.2-45 6.2-46 6.2-46A 6.2-47 6.2-48 6.2-49 6.2-50 6.2-51 6.2-52 6.2-53 6.2-53 6.2-53 6.2-53 6.2>>53 6.2-53 6.2-54 6.2-55 6.2-56 6.2-56 6.2-56 6.2-56 6.2-56 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 ROO AOO AOO AOO AOO R03 ROO R03 R03 R03 R03 ROO ROO ROO R03 R03 ROO AOO A09 A27 A27 A28 A27 ROO ROO ROO ROO AOO AOO AOO A27 ROO All All All All All All All A23 All All A23 A23 A23 A23 F'F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-57 6.2-58 6'-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-60 6.2-61 6.2-62 Sh 6.2-62 Sh 6.2-62 Sh 6 2-62 Sh 6.2-62 Sh 6'-62A 6'-63 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64A 6.2-65 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh, 6.2-66 Sh 6.2-66A 6.2-67 6.2-68 6.2-68A 6.2-69 6.2-69A 6'-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6 7 8 9 10 1..2 3 4 5 A23 A23 A23 A23 A23 All All All All All All All A23 All All 2 All 3 All 4 All 5 All All All All All All All All All All All All All All All All All All All A27 A27 All Rol ROO ROO ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6 2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-71a 6.2-71b 6.2-72a 6.2-72b 6.2-'72c 6.2-72d 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 31A 32 33 34 35 36 37 38 39 40 41 42 43 43a 43b ROO ROO ROO ROO ROO ROO ROO ROO Rol ROO ROO ROO ROO ROO R02 ROO ROO ROO ROO R03 Rol ROO Rol R02 ROO ROO R03 ROO Rol ROO ROO Rol ROO ROO ROO Rol ROO R03 ROO ROO R03 R03 ROO ROO A07 ROO USAR Revision 4 EP 6-4 October 1992 1
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER6PageT=Table~FiureAmendment NumberPageT=TableAmendment F=FicFFre NumberPageT=TableAmendment
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table~Fi ure Amendment Number Page T=Table Amendment F=FicFFre Number Page T=Table Amendment~F=Fi ure Number F 6.2-72e F 6.2-72f F 6.2-72g F 6.2-72?1 F 6.2-72i F 6.2-72j F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-73A F 6.2-74 F 6.2-75 F 6.2-75a F 6.2-75b F 6.2-76 F 6.2-76A F 6'-77 F 6.2-77A F 6.2-78 F 6.2-79 F 6.2-80 F 6.2-81 F 6.2-82 F 6.2-83 F 6.2-84 F 6'-85 F 6.2-86 F 6.2-87 F 6.2-88 F 6.2-89 F 6.2-90 F 6.2-91 F 6.2-92 F 6.2-93 F 6.2-94 6.3-1 6.3-2 6.3-3 6.3-4 6.3-5 6.3-6 6.3-6a 6.3-6b S?1 1 Sh 2 S?1 3 Sh 4 Sh 5 A28 A15 A15 ROO ROO A15 R03 R03 R03 R03 R03 ROO A10 R03 R03 R03 R03 R03 R04 R03 A04 A18 A25 A18 A25 R01 ROO A18 A28 A13 A27 A27 A27 R04 R04 R04 R04 AOO ROO A28 AOO A23 A23 A06 A06 6.3-7 6.3-8 6.3-8a 6.3-8aa 6.3-8ab 6.3-8b 6.3-8c 6.3-8d 6.3-9 6.3-10 6.3-10a 6.3-10b 6.3-11 6.3-12 6.3-13 6.3-14 6.3-14a 6.3-14b 6.3-15 6.3-16 6.3-16a 6.3-16b 6.3-17 6.3-18 6.3-19 6.3-20 6.3-20a 6.3-20b 6.3-21 6.3-21a 6.3-2lb 6.3-22 6.3-23 6.3-23a 6.3-23b 6.3-24 6.3-24a 6.3-24b 6.3-24c 6.3-24d 6.3-25 6.3-26 6.3-27 6.3-28 6.3-29 6.3-30 A19 A26 A26 A20 A20 A25 A24 A19 AOO A05 A27 A05 A27 R03 A05 A23 A23 A05 ROO A27 A23 A23 A23 R03 AOO A05 A23 A05 R03 R03 R03 AOO A20 A20 A20 A20 A07 A07 A07 A07 R03 AOO A20 R03 AOO R01 6.3-31 6.3-32 6.3-33 T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.3-1 Sh 6.3-1 S11 6.3-1 S11 6~3-2 Sh 6.3-2 Sh 6.3-3 6.3-4 S11 6.3-4 S?1 6.3-5 6.3-6 S11 6.3-6 S?1 6.3-1 S?I 6.3-1 Sh 6.3-2 6.3-3a 6.3-3b 6.3-4a 6.3-4b 6.3-5a 6.3-5b 6.3-5c 6.3-6a 6.3-6b 6.3-7a 6.3-8 6.3-9 6.3-10 6.3-11 6.3-12 6.3-13 6.3-14 6.3-15 6.3-16 6.3-17 6.3-18 6.3-19 6'-20 6.3-21 6.3-22 6.3'-23 6.3-24 6.3-25 6.3-26 1 2 3 1 2 A27 A26 AOO R03 R03 R03 A20 A20 A20 R03 A20 A20 A20 A20 A27 A23 ROO A20 A05 A20 A05 A20 A07 A07 R04 ROO R04 A20 AOO A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 R03 A20 USAR Revision 4 EP 6-5 October 1992 II I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 6 3-27 F 6.3-28 F 6.3-29 F 6.3-30 F 6.3-31 F 6.3-32 F 6.3-33 F 6.3-34 F 6.3-35 F 6.3-36 F 6.3-37 F 6.3-38 F 6.3-39 F 6.3-40 F 6.3-41 F 6.3-42 F 6.3-43 F 6.3-44 F 6.3-45 F 6.3-46 F 6.3-47 F 6.3-48 F 6.3-49 F 6.3-50 F 6.3-51 F 6.3-52 F 6.3-53 F 6.3-54 F 6.3-55 F 6.3-56 6'-1 6'-2 6.4-3 6.4-4 6.4-5 6.4-6 6.4-7 F 6.4-1 6.5-1 6.5-2 6.5-2a 6.5-2b 6.5-3 6.5-4 A20 R03 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 AOO AOO R02 R04 A26 AOO R01 R04 AOO A28 A25 A25 ROO A28 6.5-4a 6.5-4b 6.5-5 6.5-6 6.5-7 6.5-7a 6'-7b 6.5-8 6.5-8a 6.5-8b 6.5-9 6.5-10 6.5-11 T 6.5-1 F 6.5-1 Sh 1 F 6.5-1 Sh 2 F 6.5-1 Sh 3 F 6.5-1 Sh 4 F 6.5-1 Sh 5 F 6.5-1 Sh 6 F 6 5-1 Sh 7 F 6.5-1 Sh 8 F 6.5-2 F 6.5-3 F 6.5-4 F 6.5-5 6.6-1 6.6-1a 6.6-1b 6.6-2 6.6-3 App 6A 6A-1 App 6B 6B-i 6B-1 6B-2 6B-3 6B-4 6B-5 6B-6 6B-7 6B-8 A25 A25 ROO A28 R04 A23 A23 A26 A20 A20 R04 R04 AOO AOO R03 R01 R04 R03 R01 R03 R04 R03 R04 R04 R04 R04 R03 A11 A11 AOO AOO AOO AOO AOO AOO AOO AOO A23 A23 AOO A23 A23 AOO 6B-9 F 6B-1 F 6B-2 App 6C 6C-1 6C-2 6C-3 6C-4 6C-5 6C-6 6C-7 6C-8 6C-9 6C-10 6C-10a 6C-10b 6C-11 6C-12 6C-13 6C-14 6C-15 6C-16 6C-17 6C-18 6C-19 6C-20 6C-21 6C-22 6C-23/24 (T HC-1)6C-25/26 (T HC-2)6C-27/28 (F HC-1)AOO AOO AOO ROO ROO ROO ROO ROO ROO R02 ROO ROO R02 R03 R03 R03 ROO ROO ROO ROO ROO ROO R02 ROO ROO R03 ROO R03 ROO R03 ROO USAR Revision 4 EP 6-6 October 1992 4
~F=FiureNumberF6.2-72eF6.2-72fF6.2-72gF6.2-72?1F6.2-72iF6.2-72jF6.2-72kF6.2-72kF6.2-72kF6.2-72kF6.2-72kF6.2-73AF6.2-74F6.2-75F6.2-75aF6.2-75bF6.2-76F6.2-76AF6'-77F6.2-77AF6.2-78F6.2-79F6.2-80F6.2-81F6.2-82F6.2-83F6.2-84F6'-85F6.2-86F6.2-87F6.2-88F6.2-89F6.2-90F6.2-91F6.2-92F6.2-93F6.2-946.3-16.3-26.3-36.3-46.3-56.3-66.3-6a6.3-6bS?11Sh2S?13Sh4Sh5A28A15A15ROOROOA15R03R03R03R03R03ROOA10R03R03R03R03R03R04R03A04A18A25A18A25R01ROOA18A28A13A27A27A27R04R04R04R04AOOROOA28AOOA23A23A06A066.3-76.3-86.3-8a6.3-8aa6.3-8ab6.3-8b6.3-8c6.3-8d6.3-96.3-106.3-10a6.3-10b6.3-116.3-126.3-136.3-146.3-14a6.3-14b6.3-156.3-166.3-16a6.3-16b6.3-176.3-186.3-196.3-206.3-20a6.3-20b6.3-216.3-21a6.3-2lb6.3-226.3-236.3-23a6.3-23b6.3-246.3-24a6.3-24b6.3-24c6.3-24d6.3-256.3-266.3-276.3-286.3-296.3-30A19A26A26A20A20A25A24A19AOOA05A27A05A27R03A05A23A23A05ROOA27A23A23A23R03AOOA05A23A05R03R03R03AOOA20A20A20A20A07A07A07A07R03AOOA20R03AOOR016.3-316.3-326.3-33TTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFFFFFFF6.3-1Sh6.3-1S116.3-1S116~3-2Sh6.3-2Sh6.3-36.3-4S116.3-4S?16.3-56.3-6S116.3-6S?16.3-1S?I6.3-1Sh6.3-26.3-3a6.3-3b6.3-4a6.3-4b6.3-5a6.3-5b6.3-5c6.3-6a6.3-6b6.3-7a6.3-86.3-96.3-106.3-116.3-126.3-136.3-146.3-156.3-166.3-176.3-186.3-196'-206.3-216.3-226.3'-236.3-246.3-256.3-2612312A27A26AOOR03R03R03A20A20A20R03A20A20A20A20A27A23ROOA20A05A20A05A20A07A07R04ROOR04A20AOOA20A20A20A20A20A20A20A20A20A20A20A20A20A20A20R03A20USARRevision4EP6-5October1992 III NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER6PageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberF63-27F6.3-28F6.3-29F6.3-30F6.3-31F6.3-32F6.3-33F6.3-34F6.3-35F6.3-36F6.3-37F6.3-38F6.3-39F6.3-40F6.3-41F6.3-42F6.3-43F6.3-44F6.3-45F6.3-46F6.3-47F6.3-48F6.3-49F6.3-50F6.3-51F6.3-52F6.3-53F6.3-54F6.3-55F6.3-566'-16'-26.4-36.4-46.4-56.4-66.4-7F6.4-16.5-16.5-26.5-2a6.5-2b6.5-36.5-4A20R03A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20A20AOOAOOR02R04A26AOOR01R04AOOA28A25A25ROOA286.5-4a6.5-4b6.5-56.5-66.5-76.5-7a6'-7b6.5-86.5-8a6.5-8b6.5-96.5-106.5-11T6.5-1F6.5-1Sh1F6.5-1Sh2F6.5-1Sh3F6.5-1Sh4F6.5-1Sh5F6.5-1Sh6F65-1Sh7F6.5-1Sh8F6.5-2F6.5-3F6.5-4F6.5-56.6-16.6-1a6.6-1b6.6-26.6-3App6A6A-1App6B6B-i6B-16B-26B-36B-46B-56B-66B-76B-8A25A25ROOA28R04A23A23A26A20A20R04R04AOOAOOR03R01R04R03R01R03R04R03R04R04R04R04R03A11A11AOOAOOAOOAOOAOOAOOAOOAOOA23A23AOOA23A23AOO6B-9F6B-1F6B-2App6C6C-16C-26C-36C-46C-56C-66C-76C-86C-96C-106C-10a6C-10b6C-116C-126C-136C-146C-156C-166C-176C-186C-196C-206C-216C-226C-23/24(THC-1)6C-25/26(THC-2)6C-27/28(FHC-1)AOOAOOAOOROOROOROOROOROOROOR02ROOROOR02R03R03R03ROOROOROOROOROOROOR02ROOROOR03ROOR03ROOR03ROOUSARRevision4EP6-6October1992 4
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 7 PAGES Page T=Table F FicFure Amendment Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number 7 i 7-ii 7-iii 7-iV 7-V 7-Vi 7-Vii 7-viia 7-viib 7-Viii 7 1X 7 X 7-Xi 7-Xii 7'-1 7 e 1 1 a 7.1-1b 7~1 2 7~1 3 7~1-4 7.1-5 7.1-5a 7.1-5b 7.1-6 7.1-6a 7.1-6b 7.1-6c 7.1-6d 7~1 7 7~1 7a 7.1-7b 7'-8 T 7~1 1 T 7.1-1 T 7.1-1 T 7.1-2 T 7.1-2 T 7~1 2 T 7~1 3 T 7~1 3 T 7~1-3 T 7.1-3 T 7~1 3 T 7.1-4 T 7.1-4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 ROO A24 R04 ROO ROO ROO R03 ROO A24 ROO R04 A24 R03 R03 R04 ROO ROO ROO A18 AOO ROO ROO ROO ROO ROO ROO ROO ROO R04 R02 R02 R02 AOO A09 A18 A28 A18 A28 A24 A24 ROO R02 ROO R04 ROO 7 e 2 1 7~2 2 7~2 3 7~2 3a 7.2-3b 7.2-4 7'-5 7'-6 7~2 7 7.2-8 7.2-9 7.2-10 7~2 1 1 7'-12 7e2 13 7~2 13a 7.2-13b 7'13c 7~2 13d 7.2-14 7'-15 7.2-16 7~2 17 7.2-18 7.2-19 7.2-20 7.2-21 7~2 22 T 7.2-1 T 7.2-2 T 7'-2 T 7.2-2 T 7~2 2 T 7.2-2 T 7.2-2 T 7~2 2 T 7~2 2 T 7.2-2 T 7~2 2 T 7.2-2 T 7~2 2 T 7~2 2 T 7~2 2 T 7.2-2 T 7~2 2 T 7~2 2 Sh 1 Sh2-Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 A23 ROO ROO ROO A26 A09 AOO R04 AOO A09 AOO R01 R03 R01 R01 ROO ROO ROO ROO R01 AOO AOO AOO A09 A09 AOO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO T 7'-2 F 7.2-1 F 7.2-1 F 7.2-1 F 7.2-1 F 7.2-1 7~3 1 7~3 2 7~3 3 7.3-4 7.3-5 7.3-6 7~3 7 7~3 7a 7.3-7b 7.3-8 7.3-9 7.3-9a 7.3-9b 7.3-10 7~3 1 1 7~3 12 7~3 13 7~3 13a 7.3-13b 7.3-14 7.3-15 7.3-16 7.3-16a 7.3-16b 7~3 1 7 7;3-18 7.3-19 7.3-19a 7.3-19b 7.3-20 7~3 2 1 7~3 22 7 e 3 22a 7.3-22b 7~3 23 7.3-24 7.3-25 7.3-26 7.3-26a Sh Sh Sh Sh Sh Sh 18 1 2 3 4 5 ROO A23 A23 ROO R01 A23 AOO A23 R01 R02 R01 A26 A25 A25 A09 R01 A23 A13 A13 AOO ROO A23 A09 A09 A09 ROO A09 A28 A18 A18 A28 A28 R04 ROO A09 R01 R04 R01 ROO ROO R04 R03 A26 R04 R01 USAR Revision 4 EP 7-1 October 1992
NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER7PAGESPageT=TableFFicFureAmendment NumberPageT=TableF=Ficrure Amendment NumberPageT=TableAmendment F=FicFure Number7i7-ii7-iii7-iV7-V7-Vi7-Vii7-viia7-viib7-Viii71X7X7-Xi7-Xii7'-17e11a7.1-1b7~127~137~1-47.1-57.1-5a7.1-5b7.1-67.1-6a7.1-6b7.1-6c7.1-6d7~177~17a7.1-7b7'-8T7~11T7.1-1T7.1-1T7.1-2T7.1-2T7~12T7~13T7~13T7~1-3T7.1-3T7~13T7.1-4T7.1-4Sh1Sh2Sh3Sh1Sh2Sh3Sh1Sh2Sh3Sh4Sh5Sh1Sh2ROOA24R04ROOROOROOR03ROOA24ROOR04A24R03R03R04ROOROOROOA18AOOROOROOROOROOROOROOROOROOR04R02R02R02AOOA09A18A28A18A28A24A24ROOR02ROOR04ROO7e217~227~237~23a7.2-3b7.2-47'-57'-67~277.2-87.2-97.2-107~2117'-127e2137~213a7.2-13b7'13c7~213d7.2-147'-157.2-167~2177.2-187.2-197.2-207.2-217~222T7.2-1T7.2-2T7'-2T7.2-2T7~22T7.2-2T7.2-2T7~22T7~22T7.2-2T7~22T7.2-2T7~22T7~22T7~22T7.2-2T7~22T7~22Sh1Sh2-Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17A23ROOROOROOA26A09AOOR04AOOA09AOOR01R03R01R01ROOROOROOROOR01AOOAOOAOOA09A09AOOROOROOR01ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOT7'-2F7.2-1F7.2-1F7.2-1F7.2-1F7.2-17~317~327~337.3-47.3-57.3-67~377~37a7.3-7b7.3-87.3-97.3-9a7.3-9b7.3-107~3117~3127~3137~313a7.3-13b7.3-147.3-157.3-167.3-16a7.3-16b7~3177;3-187.3-197.3-19a7.3-19b7.3-207~3217~3227e322a7.3-22b7~3237.3-247.3-257.3-267.3-26aShShShShShSh1812345ROOA23A23ROOR01A23AOOA23R01R02R01A26A25A25A09R01A23A13A13AOOROOA23A09A09A09ROOA09A28A18A18A28A28R04ROOA09R01R04R01ROOROOR04R03A26R04R01USARRevision4EP7-1October1992
~I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 7 PAGES Page T=Table F=FicFur e Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 7.3-26b 7~3 27 7.3-28 7.3-29 7.3-30 7.3-31 7~3 3 la 7.3-31b 7~3 32 7~3 33 7~3 33a 7.3-33b 7.3-34 7.3-35 T 7~3 1 T 7.3-2 T 7~3 3 T 7.3-4 T 7'-5 T 7.3-5 T 7.3-6 T 7'-7 T 7.3-8 T 7'-9 T 7.3-10 T 7~3 1 1 T 7'-11 T 7.3-12 T 7~3 13 T 7~3-14 T 7.3-15 T 7.3-16 T 7.3-16 T 7~3 17 T 7~3 17 T 7.3-17 T 7~3 17 T 7.3-17 T 7.3-17 T 7'-17 T 7.3-17 T 7~3 17 T 7~3 17 T 7e3 17 T 7.3-17 T 7.3-17 ROO AOO Rol A23 Alo A23 Alo Alo AOO ROO R01 Rol ROO ROO Rol Rol Rol Rol A23 Rol Rol Rol ROl Rol Rol ROO Rol Rol Rol Rol Rol ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO T 7.3-17 Sh 14 T 7.3-17 Sh 15 T 7.3-17 Sh 16 F 7.3-1 F 7.3-2 Sh 1 F 7.3-2 Sh 2 F 7 3-2 Sh 3 F 7.3-3 Sh 1 F 7.3-3 Sh 2 F 7.3-3 Sh 3 F 7.3-4 Sh 1 F 7.3-4 Sh 2 F 7.3-4 Sh 3 F 7.3-4 Sh 4 F 7.3-4 Sh 5 F 7.3-5 Sh 1 F 7.3-5 Sh 2 F 7.3-6 Sh 1 F 7.3-6 Sh 2 F 7.3-6 Sh 3 F 7.3-6 Sh 4 F 7.3-6 Sh 5 F 7.3-7 F 7.3-8 F 7.3-9 F 7.3-10 Sh 1 F 7.3-10 Sh 2 7.4-1 7~4-2 7.4-3 7.4-3a 7.4-3b 7.4-4 7.4-4a 7'-4b 7.4-5 7.4-6 7.4-6a 7'-6b 7'-7 7'-8 7.4-8a 7.4-8b 7'-9 7.4-10 ROO R01 R04 A09 R03 A23 A23 ROO ROO ROO ROO A23 ROO ROO A23 ROO A23 ROO A23 ROO ROO ROO ROO A09 A09 R03 ROO A21 AOO R04 ROO ROO ROO ROO A18 A20 A24 A24 A24 ROO ROO ROO ROO ROO ROO 7.4-11 7.4-lla 7.4-11b 7.4-12 7.4-12a 7.4-12b 7.4-13 7.4-13a 7.4-13b 7.4-14 7.4-15 7.4-16 7.4-17 7.4-18 7.4-19 7.4-19a 7.4-19b 7.4-20 7'-21 7.4-22 7.4-22a 7.4-22b 7.4-23 7.4-23a 7.4-23b 7.4-23c 7.4-23d 7.4-24 T 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-2 7.5-1 7.5-1a 7.5-1b 7.5-2 7.5-3 7.5-4 7.5-5 7.5-6 7.5-7 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 ROO ROO A23 ROO ROO ROO R03 A18 A18 R01 Rol AOO AOO AOO ROO ROO ROO A18 A23 A18 A23 A23 Rol ROO ROO ROO ROO AOO ROO ROO A23 A23 ROO ROO ROO ROO ROO ROO ROO A27 AOO ROO A27 A23 R04 USAR Revision 4 EP 7-2 October 1992 fi Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T-Zable F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 7.5-8 7.5-9 7.5-10 7.5-11 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7'-1 T 7.5-1 T 7'-1 T 7 5-1 T 7.5-1 T 7 5-1 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7'-2 T 7'-2 T 7'-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 R04 R04 R04 R04 R01 ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 T 7~5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7'-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 7.6-1 7.6-2 7.6-2a 7.6-2b 7.6-3 7.6-3a 7.6-3b 7.6-4 7.6-4a 7.6-4b 7.6-5 7.6-6 7.6-6a 7.6-6b 7.6-7 7.6-8 7.6-8a 7.6-8b 7.6-8c 7.6-8d 7.6-9 7.6-9a 7.6-9b 7.6-10 7.6-10a Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 A18 R04 R04 A10 ROO A10 A10 R01 A10 A10 A26 R01 A18 A10 A27 A24 R01 ROO R03 ROO ROO A10 A10 R01 R01 7.6-10b 7.6-11 7.6-12 7.6-13 7.6-14 7.6-15 7.6-16 7.6-17 7.6-18 7.6-19 7.6-20 7.6-21 7.6-22 7.6-22a 7 6-22b 7.6-23 7.6-23a 7.6-23b 7.6-24 7.6-25 7.6-26 7.6-26a 7.6-26b 7.6-26c 7.6-26d 7.6-26e 7.6-26f 7.6-26g 7.6-26h 7.6-27 T 7'-1 T 7.6-2 T 7.6-3 T 7.6-3 T 7.6-4 T 7.6-5 T 7.6-6 F 7.6-1 F 7'-1 F 7.6-2 F 7.6-3 F 7.6-3 F 7.6-4 F 7.6-5 F 7.6-6 F 7.6-6 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 A18 R01 R03 R01 A10 , AOO AOO A27 A27 AOO A27 AOO R01 ROO ROO A13 A10 A10 A10 A10 A18 A18 A24 A18 A18 R03 R01 R01 A18 AOO R01 R04 ROO R01 A10 A27 A27 ROO ROO AOO A23 A23 AOO AOO A23 A23 USAR Revision 4 EP 7-3 October 1992
~I NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER7PAGESPageT=TableF=FicFureAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberSh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh137.3-26b7~3277.3-287.3-297.3-307.3-317~33la7.3-31b7~3327~3337~333a7.3-33b7.3-347.3-35T7~31T7.3-2T7~33T7.3-4T7'-5T7.3-5T7.3-6T7'-7T7.3-8T7'-9T7.3-10T7~311T7'-11T7.3-12T7~313T7~3-14T7.3-15T7.3-16T7.3-16T7~317T7~317T7.3-17T7~317T7.3-17T7.3-17T7'-17T7.3-17T7~317T7~317T7e317T7.3-17T7.3-17ROOAOORolA23AloA23AloAloAOOROOR01RolROOROORolRolRolRolA23RolRolRolROlRolRolROORolRolRolRolRolROOR01ROOROOROOROOROOROOROOROOROOROOROOROOROOT7.3-17Sh14T7.3-17Sh15T7.3-17Sh16F7.3-1F7.3-2Sh1F7.3-2Sh2F73-2Sh3F7.3-3Sh1F7.3-3Sh2F7.3-3Sh3F7.3-4Sh1F7.3-4Sh2F7.3-4Sh3F7.3-4Sh4F7.3-4Sh5F7.3-5Sh1F7.3-5Sh2F7.3-6Sh1F7.3-6Sh2F7.3-6Sh3F7.3-6Sh4F7.3-6Sh5F7.3-7F7.3-8F7.3-9F7.3-10Sh1F7.3-10Sh27.4-17~4-27.4-37.4-3a7.4-3b7.4-47.4-4a7'-4b7.4-57.4-67.4-6a7'-6b7'-77'-87.4-8a7.4-8b7'-97.4-10ROOR01R04A09R03A23A23ROOROOROOROOA23ROOROOA23ROOA23ROOA23ROOROOROOROOA09A09R03ROOA21AOOR04ROOROOROOROOA18A20A24A24A24ROOROOROOROOROOROO7.4-117.4-lla7.4-11b7.4-127.4-12a7.4-12b7.4-137.4-13a7.4-13b7.4-147.4-157.4-167.4-177.4-187.4-197.4-19a7.4-19b7.4-207'-217.4-227.4-22a7.4-22b7.4-237.4-23a7.4-23b7.4-23c7.4-23d7.4-24T7.4-1F7.4-1F7.4-1F7.4-1F7.4-1F7.4-1F7.4-1F7.4-27.5-17.5-1a7.5-1b7.5-27.5-37.5-47.5-57.5-67.5-7Sh1Sh2Sh3Sh4Sh5Sh6ROOROOA23ROOROOROOR03A18A18R01RolAOOAOOAOOROOROOROOA18A23A18A23A23RolROOROOROOROOAOOROOROOA23A23ROOROOROOROOROOROOROOA27AOOROOA27A23R04USARRevision4EP7-2October1992 fi NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER7PageT-ZableF=Ficpure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number7.5-87.5-97.5-107.5-11T7.5-1T7.5-1T7.5-1T7.5-1T7.5-1T7.5-1T7.5-1T7.5-1T7'-1T7.5-1T7'-1T75-1T7.5-1T75-1T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7'-2T7'-2T7'-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28R04R04R04R04R01ROOROOROOROOR01ROOROOROOROOROOROOROOROOR04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04T7~5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7'-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-2T7.5-27.6-17.6-27.6-2a7.6-2b7.6-37.6-3a7.6-3b7.6-47.6-4a7.6-4b7.6-57.6-67.6-6a7.6-6b7.6-77.6-87.6-8a7.6-8b7.6-8c7.6-8d7.6-97.6-9a7.6-9b7.6-107.6-10aSh29Sh30Sh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04A18R04R04A10ROOA10A10R01A10A10A26R01A18A10A27A24R01ROOR03ROOROOA10A10R01R017.6-10b7.6-117.6-127.6-137.6-147.6-157.6-167.6-177.6-187.6-197.6-207.6-217.6-227.6-22a76-22b7.6-237.6-23a7.6-23b7.6-247.6-257.6-267.6-26a7.6-26b7.6-26c7.6-26d7.6-26e7.6-26f7.6-26g7.6-26h7.6-27T7'-1T7.6-2T7.6-3T7.6-3T7.6-4T7.6-5T7.6-6F7.6-1F7'-1F7.6-2F7.6-3F7.6-3F7.6-4F7.6-5F7.6-6F7.6-6Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2A18R01R03R01A10,AOOAOOA27A27AOOA27AOOR01ROOROOA13A10A10A10A10A18A18A24A18A18R03R01R01A18AOOR01R04ROOR01A10A27A27ROOROOAOOA23A23AOOAOOA23A23USARRevision4EP7-3October1992
-~z Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T=Table Amendment F=F icFure Number Page T=Table Amendment F=FicFur e Number Page T=Table F=FicFure Amendment Number F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-7 F 7.6-8 F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7'-9 Sh F 7'-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh 7~7 1 7~7 1a 7.7-1b 7'7 2 7~7 3 7.7-4 7.7-5 7'-6 7~7 7 7.7-8 7.7-9 7'-10 7~7 1 1 7~7 1 2 7~7 1 3 7.7-14 7.7-15 7'-16 7~7 17 7~7 17a 7.7-17b 7.7-18 7.7-19 7.7-20 7~7 2 1 7e721a 7.7-2lb 7~7 22 A23 A23 A23 A23 A23 A27 A27 A23 A23 A23 A23 A23 R01 A23 A23 A23 ROO R04 A10 A10 AOO A10 AOO R03 AOO R03 A27 R01 R03 AOO R03 A27 AOO AOO R01 R03 R03 R03 AOO ROO ROO ROO A18 A18 A18 7~7 22a 7.7-22b 7~7 23 7.7-24 7.7-24a 7.7-24b 7.7-25 7.7-26 7~7 27 7~7 27a 7.7-27b 7.7-28 7.7-29 7.7-30 7~7 3 1 7~7 32 7~7 33 7.7-34 7.7-35 7.7-36 7~7 37 7~7 3 7 a 7.7-37b 7.7-38 7.7-39 7.7-39a 7.7-39b 7;7-40 7.7-41 7.7-42 T 7~7 1 T 7~7 2 T 7.7-3 Sh 1 T 7.7-3 Sh 2 F 7.7-1 Sh 1 F 7.7-1 Sh 2 F 7.7-1 Sh 3 F 7.7-1 Sh 4 F 7.7-1 Sh 5 F 7.7-1 Sh 6 F 7.7-1 Sh 7 F 7.7-2 Sh 1 F 7.7-2 Sh 2 F 7.7-2 Sh 3 F 7.7-2 Sh 4 F 7.7-2 Sh 5 A27 A10 ROO R01 R01 A14 A10 R03 A23 A23 A23 AOO A23 ROO ROO A14 AOO AOO A09 R03 R04 R03 R03 A10 A26 A26 A26 A10 A10 R03 A10 A10 A10 AOO ROO R03 A23 R03 A23 ROO R03 R03 R03 R03 R03 A23 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7'-2 F 7.7-3 F 7.7-4 F 7.7-5 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-7 F 7.7-8 F 7'-9 F 7.7-10 App 7A Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 sh Sh Sh Sh Sh Sh Sh R03 A23 R03 R03 A23 A23 A23 R04 R04 A23 A23 A23 A23 A23 A23 A23 A23 R03 R04 R03 R03 A23 R03 A23 A23 R03 A23 A23 A23 R03 AOO A10 AOO A23 A23 ROO ROO A23 ROO ROO ROO R03 AOO ROO ROO USAR Revision 4 EP 7-4 October 1992 H
-~z NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER7PageT=TableAmendment F=FicFureNumberPageT=TableAmendment F=FicFureNumberPageT=TableF=FicFure Amendment NumberF7.6-6ShF7.6-6ShF7.6-6ShF7.6-6ShF7.6-6ShF7.6-7F7.6-8F7.6-9ShF7.6-9ShF7.6-9ShF7.6-9ShF7'-9ShF7'-9ShF7.6-9ShF7.6-9ShF7.6-9ShF7.6-9Sh7~717~71a7.7-1b7'727~737.7-47.7-57'-67~777.7-87.7-97'-107~7117~7127~7137.7-147.7-157'-167~7177~717a7.7-17b7.7-187.7-197.7-207~7217e721a7.7-2lb7~722A23A23A23A23A23A27A27A23A23A23A23A23R01A23A23A23ROOR04A10A10AOOA10AOOR03AOOR03A27R01R03AOOR03A27AOOAOOR01R03R03R03AOOROOROOROOA18A18A187~722a7.7-22b7~7237.7-247.7-24a7.7-24b7.7-257.7-267~7277~727a7.7-27b7.7-287.7-297.7-307~7317~7327~7337.7-347.7-357.7-367~7377~737a7.7-37b7.7-387.7-397.7-39a7.7-39b7;7-407.7-417.7-42T7~71T7~72T7.7-3Sh1T7.7-3Sh2F7.7-1Sh1F7.7-1Sh2F7.7-1Sh3F7.7-1Sh4F7.7-1Sh5F7.7-1Sh6F7.7-1Sh7F7.7-2Sh1F7.7-2Sh2F7.7-2Sh3F7.7-2Sh4F7.7-2Sh5A27A10ROOR01R01A14A10R03A23A23A23AOOA23ROOROOA14AOOAOOA09R03R04R03R03A10A26A26A26A10A10R03A10A10A10AOOROOR03A23R03A23ROOR03R03R03R03R03A23F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7'-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7'-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7.7-2F7'-2F7.7-2F7'-2F7.7-3F7.7-4F7.7-5F7.7-6F7.7-6F7.7-6F7.7-6F7.7-6F7.7-6F7.7-6F7.7-7F7.7-8F7'-9F7.7-10App7ASh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh31Sh32Sh33Sh34Sh35shShShShShShShR03A23R03R03A23A23A23R04R04A23A23A23A23A23A23A23A23R03R04R03R03A23R03A23A23R03A23A23A23R03AOOA10AOOA23A23ROOROOA23ROOROOROOR03AOOROOROOUSARRevision4EP7-4October1992 H
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 7A.1-1 7A.1-2 7A.1-3 7A.1-4 7A.1-5 7A.1-6 7A.1-7 7A.1-8 7A.1-9 7A.1-10 7A.1-11 7A.1-12 7A.1-13 7A.1-14 7A.1-15 7A.1-16 T 7A.1-1 F 7A.1-1 F 7A.1-2 F 7A.1-3 F 7A.1-4 F 7A.1-5 F 7A.1-6 F 7A.1-7 F 7A.1-8 F 7A.1-9 7A.2-1 7A.2-2 7A.2-3 7A.3-1 7A.3-2 7A.3-3 7A.4-1 7A.4-2 7A.4-3 7A.5-1 7A.5-2 7A.5-3 7A.5-4 7A.5-5 7A;6-1 7A.6-2 7A.6-3 7A.6-4 F 7A.6-1 R02 R02 R02 R02 ROO ROO R02 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO App 7B 7B-1 T 7B-1 T 7B-1 T 7B-1.T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 7-5 October 1992
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER7PageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure Number7A.1-17A.1-27A.1-37A.1-47A.1-57A.1-67A.1-77A.1-87A.1-97A.1-107A.1-117A.1-127A.1-137A.1-147A.1-157A.1-16T7A.1-1F7A.1-1F7A.1-2F7A.1-3F7A.1-4F7A.1-5F7A.1-6F7A.1-7F7A.1-8F7A.1-97A.2-17A.2-27A.2-37A.3-17A.3-27A.3-37A.4-17A.4-27A.4-37A.5-17A.5-27A.5-37A.5-47A.5-57A;6-17A.6-27A.6-37A.6-4F7A.6-1R02R02R02R02ROOROOR02ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOApp7B7B-1T7B-1T7B-1T7B-1.T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1T7B-1Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOUSARRevision4EP7-5October1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER8PageT=TableAmendment F=Ficrure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number8-i8-ii8-iii8-iv8-v8-va8-vb8-vi8.1-18.1-28.1-38.1-3a8.1-3b8.1-48.1-58.1-68.1-78.1-8F8.1-18.2-18.2-1a8.2-1b8.2-28.2-2a8.2-2b8.2-38.2-48.2-58.2-5a8.2-5b8'-68.2-6a8.2-6b8.2-78.2-7a8.2-7b8.2-88.2-98.2-108.2-1182-128.2-138.2-148.2-15ROOROOROOR04ROOR02A26R04A07A27A27A27A27AOOAOOROOAOOAOOA27R04R04A07ROOROOR04R04A21A26A14A14A23A14A07A13A13A13AOOA04A23ROOA23A21ROOA268.2-15a8.2-15b82-168.2-16a8.2-16b8.2-178.2-188.2-198'-208.2-218'-228.2-238.2-23a8.2-23b8.2-248.2-24a8.2-24b8.2-24c8.2-24d8.2-258.2-26T8.2-1S111T8.2-1S?12T8.2-1Sh3T8.2-1Sjl4F8.2-1F8.2-1aF8.2-1bF8.2-1cF8.2-2F8.2-3F8.2-4F8.2-4aF8.2-5F8.2-5aF8.2-6F8.2-6aF8.2-6bF8.2-6cF8.2-7F8.2-8F8.2-98.3-18.3-28.3-3A26A26A26A26A26A07ROOROOA23ROOR01.A23A07A07A15A23ROOA28A28ROOROOROO'OOR03A28A26ROOROOROOA26A07AOOA26A26A26A26A26A26A26ROOROOA26AOOAOOAOO8.3-48.3-4a8'-4b8.3-58'-68'-783-7a8.3-7b8.3-88'-8a8'-8b8'-98.3-9a8.3-9b8'-108.3-118.3-11a8.3-11b8'-128.3-12a8'-12b8'-138'-148.3-1583-1683-1783-188.3-18a8'-18b8.3-18c8'-18d8'-1983-19a8'-19b8.3-208.3-20a8.3-20b8'-218.3-228'-238'-248-3-24a8'-24b8'-258'-25a8-3-25bR02A24A06R04A23ROOA07A07R01A07A07R01A23A13A23ROOA19A07R04A23A23R04R04R04A19ROOROOROOA28ROOA07ROOROOROOR04ROOA23R04ROOR04ROOA27A27ROOROOA20USARRevision4EP8-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 8-i 8-ii 8-iii 8-iv 8-v 8-va 8-vb 8-vi 8.1-1 8.1-2 8.1-3 8.1-3a 8.1-3b 8.1-4 8.1-5 8.1-6 8.1-7 8.1-8 F 8.1-1 8.2-1 8.2-1a 8.2-1b 8.2-2 8.2-2a 8.2-2b 8.2-3 8.2-4 8.2-5 8.2-5a 8.2-5b 8'-6 8.2-6a 8.2-6b 8.2-7 8.2-7a 8.2-7b 8.2-8 8.2-9 8.2-10 8.2-11 8 2-12 8.2-13 8.2-14 8.2-15 ROO ROO ROO R04 ROO R02 A26 R04 A07 A27 A27 A27 A27 AOO AOO ROO AOO AOO A27 R04 R04 A07 ROO ROO R04 R04 A21 A26 A14 A14 A23 A14 A07 A13 A13 A13 AOO A04 A23 ROO A23 A21 ROO A26 8.2-15a 8.2-15b 8 2-16 8.2-16a 8.2-16b 8.2-17 8.2-18 8.2-19 8'-20 8.2-21 8'-22 8.2-23 8.2-23a 8.2-23b 8.2-24 8.2-24a 8.2-24b 8.2-24c 8.2-24d 8.2-25 8.2-26 T 8.2-1 S11 1 T 8.2-1 S?1 2 T 8.2-1 Sh 3 T 8.2-1 Sjl 4 F 8.2-1 F 8.2-1a F 8.2-1b F 8.2-1c F 8.2-2 F 8.2-3 F 8.2-4 F 8.2-4a F 8.2-5 F 8.2-5a F 8.2-6 F 8.2-6a F 8.2-6b F 8.2-6c F 8.2-7 F 8.2-8 F 8.2-9 8.3-1 8.3-2 8.3-3 A26 A26 A26 A26 A26 A07 ROO ROO A23 ROO R01.A23 A07 A07 A15 A23 ROO A28 A28 ROO ROO ROO'OO R03 A28 A26 ROO ROO ROO A26 A07 AOO A26 A26 A26 A26 A26 A26 A26 ROO ROO A26 AOO AOO AOO 8.3-4 8.3-4a 8'-4b 8.3-5 8'-6 8'-7 8 3-7a 8.3-7b 8.3-8 8'-8a 8'-8b 8'-9 8.3-9a 8.3-9b 8'-10 8.3-11 8.3-11a 8.3-11b 8'-12 8.3-12a 8'-12b 8'-13 8'-14 8.3-15 8 3-16 8 3-17 8 3-18 8.3-18a 8'-18b 8.3-18c 8'-18d 8'-19 8 3-19a 8'-19b 8.3-20 8.3-20a 8.3-20b 8'-21 8.3-22 8'-23 8'-24 8-3-24a 8'-24b 8'-25 8'-25a 8-3-25b R02 A24 A06 R04 A23 ROO A07 A07 R01 A07 A07 R01 A23 A13 A23 ROO A19 A07 R04 A23 A23 R04 R04 R04 A19 ROO ROO ROO A28 ROO A07 ROO ROO ROO R04 ROO A23 R04 ROO R04 ROO A27 A27 ROO ROO A20 USAR Revision 4 EP 8-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER8PageT=TableAmendment F=Ficpure NumberPageT=TableAmendment FFicFureNumberPageT=TableF=FicFure Amendment Number8.3-268.3-26a8.3-26b8.3-278.3-27a8.3-27b8.3-27c8.3-27d8.3-288.3-298.3-308'-318'-328.3-338'-348.3-358.3-368.3-378.3-37a8.3-37b8.3-388.3-398.3-408.3-40a8.3-40b8.3-418.3-428.3-42a8.3-42b8.3-438.3;448.3-458.3-45a8.3-45b8.3-468.3-46a8'-46b8.3-478'-488.3-48a8.3-48b8.3-498.3-49a8'-49b8.3-508.3-50aROOROOA07A07ROOROOROOROOR04A23A23A23ROOROOR03ROOROOROOROOA21R04AOOROOA15A15ROOR04ROOA07ROOAOOA19A19A19ROOA13A13AOOROOA07A07A23ROOA20R04A238.3-50b8.3-518.3-51a8.3-51b8.3-528.3-52a8.3-52b8.3-538.3-53a8.3-53b8.3-548'-54a8.3-54b8.3-558'-568.3-578.3-57a8.3-57b8.3-588.3-58a8.3-58b8'-598.3-608.3-618.3-628.3-62a8.3-62b8.3-638.3-648.3-64a8.3-64b8.3-658.3-668.3-678.3-688.3-698.3-708.3-718.3-72T8.3-1T8.3-1T8.3-1T8.3-1T8.3-1T8.3-1T8.3-1Sh1Sh1aSh2Sh3Sh4Sh5Sh6A15A26A25A23ROOROOA23A07A07A07A28A28A07A23A19R03R03A07A'23A19A07A27ROOA14R01R01A18A23A23A19A19ROOA19AOOAOOR02R01AOOROOROOROOROOR01ROOROOROOTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT8.3-18.3-18.3-18.3-18.3-18.3-18.3-18.3-28.3-28.3-28.3-28.3-28.3-28.3-28.3-28.3-28.3-28'-28.3-38.3-3ShShShShShShShShshShShShShShShShShshShSh8.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-48.3-4shShShShShShShShShshShShShShShShShShShShShShShshsh8'-3A7891011121312345678910111212345678910111213141516171819202122232425ROOROO'OOROOROOROOROOROOROOR01ROOROOROOROOROOROOROOROOROOA27A27R01ROOROOA28A28R01ROOA28ROOROOROOROOA28ROOA28A28A28R01ROOROOA28ROOA28A28ROOUSARRevision4EP8-2October1992 F
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F FicFure Number Page T=Table F=FicFure Amendment Number 8.3-26 8.3-26a 8.3-26b 8.3-27 8.3-27a 8.3-27b 8.3-27c 8.3-27d 8.3-28 8.3-29 8.3-30 8'-31 8'-32 8.3-33 8'-34 8.3-35 8.3-36 8.3-37 8.3-37a 8.3-37b 8.3-38 8.3-39 8.3-40 8.3-40a 8.3-40b 8.3-41 8.3-42 8.3-42a 8.3-42b 8.3-43 8.3;44 8.3-45 8.3-45a 8.3-45b 8.3-46 8.3-46a 8'-46b 8.3-47 8'-48 8.3-48a 8.3-48b 8.3-49 8.3-49a 8'-49b 8.3-50 8.3-50a ROO ROO A07 A07 ROO ROO ROO ROO R04 A23 A23 A23 ROO ROO R03 ROO ROO ROO ROO A21 R04 AOO ROO A15 A15 ROO R04 ROO A07 ROO AOO A19 A19 A19 ROO A13 A13 AOO ROO A07 A07 A23 ROO A20 R04 A23 8.3-50b 8.3-51 8.3-51a 8.3-51b 8.3-52 8.3-52a 8.3-52b 8.3-53 8.3-53a 8.3-53b 8.3-54 8'-54a 8.3-54b 8.3-55 8'-56 8.3-57 8.3-57a 8.3-57b 8.3-58 8.3-58a 8.3-58b 8'-59 8.3-60 8.3-61 8.3-62 8.3-62a 8.3-62b 8.3-63 8.3-64 8.3-64a 8.3-64b 8.3-65 8.3-66 8.3-67 8.3-68 8.3-69 8.3-70 8.3-71 8.3-72 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 Sh 1 Sh 1a Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 A15 A26 A25 A23 ROO ROO A23 A07 A07 A07 A28 A28 A07 A23 A19 R03 R03 A07 A'23 A19 A07 A27 ROO A14 R01 R01 A18 A23 A23 A19 A19 ROO A19 AOO AOO R02 R01 AOO ROO ROO ROO ROO R01 ROO ROO ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8'-2 8.3-3 8.3-3 Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh sh 8'-3A 7 8 9 10 11 12 13 1 2 3 4 5 6 7 8 9 10 11 1 2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 ROO ROO'OO ROO ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO A27 A27 R01 ROO ROO A28 A28 R01 ROO A28 ROO ROO ROO ROO A28 ROO A28 A28 A28 R01 ROO ROO A28 ROO A28 A28 ROO USAR Revision 4 EP 8-2 October 1992 F
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER8PageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberT8.3-4Sh26T8.3-4Sh27T8.3-4Sh28T8.3-4Sh29T8.3-4Sh30T8.3-4Sh31T8.3-4Sh32T8'-4Sh33T8.3-4Sh34T8.3-4Sh35T8.3-4Sh36T8.3-4Sh37T8.3-4Sh38T8.3-4Sh39T8.3-4Sh40T8.3-5T8.3-6T8.3-6aSh1T8.3-6aSh2T8.3-7T8.3-8T8.3-9T8.3-10T8.3-11T8.3-12T8.3-13T8.3-14T8.3-15T8.3-16Sh1T8.3-16Sh2T8.3-17F8.3-1F8.3-2F8.3-3Sh1F8.3-3Sh2F8.3-4F8.3-5F8.3-6Sh1F8'-6Sh2F8.3-6Sh3F8.3-6Sh4F8.3-6Sh5F8.3-6Sh6F8'-6Sh7F8.3-6Sh8F8.3-6Sh9ROOROOROOROOR01.A28ROOROOA28ROOROOROOROOA28ROOROOROOROOR03ROOROOROOR03ROOROOA23AOOAOOR04R04R04ROOROOR04R04ROOROOROOROOROOROOR03ROOROOR03ROOF8.3-6Sh10F8.3-6Sh11F8.3-6Sh12F8.3-6Sh13F8.3-6Sh14F8'-6Sh15F8'-6Sh16F8.3-6Sh17..F8.3-6Sh18F8.3-6Sh19F8.3-6Sh20F8.3-6Sh21F8.3-6Sh22F8.3-6Sh23F8.3-6Sh24F8.3-6Sh25F8.3-6Sh26F8.3-6Sh27F8.3-6Sh28F8.3-6Sh29F8.3-6Sh30F8.3-6Sh31F8.3-7F8.3-8Sh1F8.3-8Sh2F8.3-8AF8.3-8BSh1F8.3-8BSh2F8.3-8BSh3F8.3-8BSh4F8.3-8BSh5F8.3-8BSh6F8.3-8BSh7F8.3-8BSh8F8.3-8BSh9F8.3-8BSh10F8.3-8BSh11F8.3-8BSh12F8.3-8BSh13F8.3-8BSh13aF8.3-8BSh13bF8.3-8BSh13cF8.3-8BSh13dF8.3-8BSh13eF8.3-8BSh13eF8.3-8BSh13fR03ROOROOR03ROOR03R03R03ROOROOR03R03R03ROOROOROOROOR03R03R03ROOROOR01ROOROOROOA15A15A15A15A15A15A15A15A15A15A15ROOA23A28A28A28A28A28A28A28F8.3-9F8.3-10F8.3-11App8A8A-18A-28A-38A-4R04ROOR01ROOROOROOROOROOUSARRevision4EP8-3October1992 g1 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number9-i9-ii9-iii9-iv9-iva9-ivb9-v9-vi9-vii9-viia9-viib9-viii9-ix9-x9-xi9-xii9-xiii9-xiiia9-xiiib9-xiv9-xv9-xvi9-xvii9-xvlii9-xix9-xx9-xxi9-xxii9.1-19~1-29'-2a9.1-2b9.1-39.1-3a9.1-3b9'-49.1-59.1-69.1-6a9.1-6b9.1-79.1-7a9.1-7b9.1-89.1-8aR04R03A24A12A12A12ROOR03A24A24A23AOOROOR03R04ROOA24'26A26R03R04R04R04R03R03R02R03R04AOOA05A20A05A05A22A05AOOA05A20A20A20R04R03A05ROOA239.1-8b9.1-99.1-9a9.1-9b9.1-109.1-10a9.1-10b9.1-119.1-11a9.1-11b9'-129.1-139.1-149.1-14a9.1-14b9.1-159.1-15a9.1-15b9.1-169.1-179.1-189.1-199.1-209.1-219.1-229.1-239.1-249.1-259.1-269.1-279.1-289.1-299.1-29a9.1-29b9.1-309.1-319.1-329.1-32a9.1-32b9.1-339.1-349.1-359.1-369.1-379.1-389.1-39A20A14A14-A14R04R04A14R04A23A23R04R04R04R04A05R04R04A05AOOAOOA24A21AOOA09AOOR03AOOAOOA21AOOAOOROOROOA28AOOR04R02R02R02AOOAOOAOOAOOAOOAOOAOO9.1-409.1-419.1-429.1-42a9.1-42b9.1-439.1-449.1-459.1-46T9.1-1T9'-2T9.1-3T9.1-4S?1T9.1-4S?1T9.1-5T9.1-6F9'-1F9.1-1AF9.1-2F9.1-3F9.1-3AF9.1-4F9.1-5aF9.1-5bF9.1-5cF9.1-5dF9.1-6ShF9.1-6ShF9.1-6S11F9.1-6ShF9.1-6ShF91-6S11,F9.1-6S11F9.1-6ShF9'-7F9'-8F9.1-9FF1-10F9.1-11F9.1-12F9.1-13F9.1-14F9.1-15F9.1-16F9.1-17F9.1-181212345678AOOR04R04A09A09A23A20A20A20AOOAOOA'00AOOAOOA05A19AOOA05A04R02A05A23R04R04R03R04R03R03R03R03ROOR04R03R03R04AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOUSARRevision4EP9-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T 8.3-4 Sh 26 T 8.3-4 Sh 27 T 8.3-4 Sh 28 T 8.3-4 Sh 29 T 8.3-4 Sh 30 T 8.3-4 Sh 31 T 8.3-4 Sh 32 T 8'-4 Sh 33 T 8.3-4 Sh 34 T 8.3-4 Sh 35 T 8.3-4 Sh 36 T 8.3-4 Sh 37 T 8.3-4 Sh 38 T 8.3-4 Sh 39 T 8.3-4 Sh 40 T 8.3-5 T 8.3-6 T 8.3-6a Sh 1 T 8.3-6a Sh 2 T 8.3-7 T 8.3-8 T 8.3-9 T 8.3-10 T 8.3-11 T 8.3-12 T 8.3-13 T 8.3-14 T 8.3-15 T 8.3-16 Sh 1 T 8.3-16 Sh 2 T 8.3-17 F 8.3-1 F 8.3-2 F 8.3-3 Sh 1 F 8.3-3 Sh 2 F 8.3-4 F 8.3-5 F 8.3-6 Sh 1 F 8'-6 Sh 2 F 8.3-6 Sh 3 F 8.3-6 Sh 4 F 8.3-6 Sh 5 F 8.3-6 Sh 6 F 8'-6 Sh 7 F 8.3-6 Sh 8 F 8.3-6 Sh 9 ROO ROO ROO ROO R01.A28 ROO ROO A28 ROO ROO ROO ROO A28 ROO ROO ROO ROO R03 ROO ROO ROO R03 ROO ROO A23 AOO AOO R04 R04 R04 ROO ROO R04 R04 ROO ROO ROO ROO ROO ROO R03 ROO ROO R03 ROO F 8.3-6 Sh 10 F 8.3-6 Sh 11 F 8.3-6 Sh 12 F 8.3-6 Sh 13 F 8.3-6 Sh 14 F 8'-6 Sh 15 F 8'-6 Sh 16 F 8.3-6 Sh 17..F 8.3-6 Sh 18 F 8.3-6 Sh 19 F 8.3-6 Sh 20 F 8.3-6 Sh 21 F 8.3-6 Sh 22 F 8.3-6 Sh 23 F 8.3-6 Sh 24 F 8.3-6 Sh 25 F 8.3-6 Sh 26 F 8.3-6 Sh 27 F 8.3-6 Sh 28 F 8.3-6 Sh 29 F 8.3-6 Sh 30 F 8.3-6 Sh 31 F 8.3-7 F 8.3-8 Sh 1 F 8.3-8 Sh 2 F 8.3-8A F 8.3-8B Sh 1 F 8.3-8B Sh 2 F 8.3-8B Sh 3 F 8.3-8B Sh 4 F 8.3-8B Sh 5 F 8.3-8B Sh 6 F 8.3-8B Sh 7 F 8.3-8B Sh 8 F 8.3-8B Sh 9 F 8.3-8B Sh 10 F 8.3-8B Sh 11 F 8.3-8B Sh 12 F 8.3-8B Sh 13 F 8.3-8B Sh 13a F 8.3-8B Sh 13b F 8.3-8B Sh 13c F 8.3-8B Sh 13d F 8.3-8B Sh 13e F 8.3-8B Sh 13e F 8.3-8B Sh 13f R03 ROO ROO R03 ROO R03 R03 R03 ROO ROO R03 R03 R03 ROO ROO ROO ROO R03 R03 R03 ROO ROO R01 ROO ROO ROO A15 A15 A15 A15 A15 A15 A15 A15 A15 A15 A15 ROO A23 A28 A28 A28 A28 A28 A28 A28 F 8.3-9 F 8.3-10 F 8.3-11 App 8A 8A-1 8A-2 8A-3 8A-4 R04 ROO R01 ROO ROO ROO ROO ROO USAR Revision 4 EP 8-3 October 1992 g 1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 9-i 9-ii 9-iii 9-iv 9-iva 9-ivb 9-v 9-vi 9-vii 9-viia 9-viib 9-viii 9-ix 9-x 9-xi 9-xii 9-xiii 9-xiiia 9-xiiib 9-xiv 9-xv 9-xvi 9-xvii 9-xvlii 9-xix 9-xx 9-xxi 9-xxii 9.1-1 9~1-2 9'-2a 9.1-2b 9.1-3 9.1-3a 9.1-3b 9'-4 9.1-5 9.1-6 9.1-6a 9.1-6b 9.1-7 9.1-7a 9.1-7b 9.1-8 9.1-8a R04 R03 A24 A12 A12 A12 ROO R03 A24 A24 A23 AOO ROO R03 R04 ROO A24'26 A26 R03 R04 R04 R04 R03 R03 R02 R03 R04 AOO A05 A20 A05 A05 A22 A05 AOO A05 A20 A20 A20 R04 R03 A05 ROO A23 9.1-8b 9.1-9 9.1-9a 9.1-9b 9.1-10 9.1-10a 9.1-10b 9.1-11 9.1-11a 9.1-11b 9'-12 9.1-13 9.1-14 9.1-14a 9.1-14b 9.1-15 9.1-15a 9.1-15b 9.1-16 9.1-17 9.1-18 9.1-19 9.1-20 9.1-21 9.1-22 9.1-23 9.1-24 9.1-25 9.1-26 9.1-27 9.1-28 9.1-29 9.1-29a 9.1-29b 9.1-30 9.1-31 9.1-32 9.1-32a 9.1-32b 9.1-33 9.1-34 9.1-35 9.1-36 9.1-37 9.1-38 9.1-39 A20 A14 A14-A14 R04 R04 A14 R04 A23 A23 R04 R04 R04 R04 A05 R04 R04 A05 AOO AOO A24 A21 AOO A09 AOO R03 AOO AOO A21 AOO AOO ROO ROO A28 AOO R04 R02 R02 R02 AOO AOO AOO AOO AOO AOO AOO 9.1-40 9.1-41 9.1-42 9.1-42a 9.1-42b 9.1-43 9.1-44 9.1-45 9.1-46 T 9.1-1 T 9'-2 T 9.1-3 T 9.1-4 S?1 T 9.1-4 S?1 T 9.1-5 T 9.1-6 F 9'-1 F 9.1-1A F 9.1-2 F 9.1-3 F 9.1-3A F 9.1-4 F 9.1-5a F 9.1-5b F 9.1-5c F 9.1-5d F 9.1-6 Sh F 9.1-6 Sh F 9.1-6 S11 F 9.1-6 Sh F 9.1-6 Sh F 9 1-6 S11, F 9.1-6 S11 F 9.1-6 Sh F 9'-7 F 9'-8 F 9.1-9 F F 1-10 F 9.1-11 F 9.1-12 F 9.1-13 F 9.1-14 F 9.1-15 F 9.1-16 F 9.1-17 F 9.1-18 1 2 1 2 3 4 5 6 7 8 AOO R04 R04 A09 A09 A23 A20 A20 A20 AOO AOO A'00 AOO AOO A05 A19 AOO A05 A04 R02 A05 A23 R04 R04 R03 R04 R03 R03 R03 R03 ROO R04 R03 R03 R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 9-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberF9'-19F9.1-19aF9.1-20F9.1-20aF9'-21F9.1-22F9.1-23F9'-24F9.1-25F9.1-26a9'-19.2-29.2-39'-49.2-4a9.2-4b9.2-59.2-5a9.2-5b9.2-69.2-79.2-7a9.2-7b9.2-89.2-99.2-109.2-10a9.2-10b9.2-119.2-11a9.2-11b9.2-129.2-139.2-149.2-159.2-169'-179.2-189.2-18a9.2-18b9.2-199.2-209.2-219.2-229.2-22aA28ROOA28ROOAOOAOOR03AOOR02ROOAOOR03A25R03R03.R03A11A25A05A24R01A25A23R03R03R03A22A22A27A23A23A27'27ROOR03A27ROOROOROOA25A25A25ROOROOROO9.2-22b9.2-239.2-23a9.2-23b9.2-249.2-259.2-25a9.2-25b9.2-269.2-26a9.2-26b9.2-279.2-289.2-28a9.2-28b9'-299.2-309.2-319.2-329.2-339.2-349.2-359.2-369.2-379.2-389.2-399.2-39a9.2-39b9.2-409.2-419.2-429.2-439.2-449.2-459.2-469.2-46a9.2-46b9.2-479.2-489.2-48a9.2-48b9.2-499'-509.2-51T9.2-1ASh1T9.2-1ASh2ROOA23'23A23A23R04A23A18A23A23A18ROOR04R04A25R04R04R04AOOAOOAOOR04R04AOOR04A26A26A26R04R04A22R04R04A23A05A24A05A24ROOA20A20R03A23AOOR01A28T9.2-1ASh3T9.2-1ASh4T9.2-1ASh5T92-1ASh6T9.2-1BSh1T9.2-1BSh2T9'-1BSh3T9.2-1BSh4T9.2-1BSh5T9.2-2Sh1T9.2-2Sh2T9.2-2Sh3T9.2-2Sh4T9.2-2Sh5T9.2-2Sh6T9.2-2Sh7T9.2-2Sh8T9.2-2Sh9T9.2-3Sh1T92-3Sh2T9.2-4Sh1T9'-4Sh2T9.2-4Sh3T9.2-5T9.2-6T9.2-7T9'-8T9.2-9F9.2-1aF9.2-1bF9.2-1cF9.2-1dF9.2-1eF9.2-1fF9.2-1gF9.2-1hF9.2-1jF92-1jcF9.2-1LF9.2-1mF9.2-1nF9.2-1pF9.2-1qF9.2-2Sh1F9.2-2Sh2F9.2-2Sh3A28A28R01R01R01A28A28A28R01R01A28A28A28'01A28A28A28R01ROOA23A23A23A23AOOAOOAOOAOOAOOR04R04R04R04R04R04R04R03R04ROOR04R04ROOR04R02R03R03R03USARRevision4EP9-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 9'-19 F 9.1-19a F 9.1-20 F 9.1-20a F 9'-21 F 9.1-22 F 9.1-23 F 9'-24 F 9.1-25 F 9.1-26a 9'-1 9.2-2 9.2-3 9'-4 9.2-4a 9.2-4b 9.2-5 9.2-5a 9.2-5b 9.2-6 9.2-7 9.2-7a 9.2-7b 9.2-8 9.2-9 9.2-10 9.2-10a 9.2-10b 9.2-11 9.2-11a 9.2-11b 9.2-12 9.2-13 9.2-14 9.2-15 9.2-16 9'-17 9.2-18 9.2-18a 9.2-18b 9.2-19 9.2-20 9.2-21 9.2-22 9.2-22a A28 ROO A28 ROO AOO AOO R03 AOO R02 ROO AOO R03 A25 R03 R03.R03 A11 A25 A05 A24 R01 A25 A23 R03 R03 R03 A22 A22 A27 A23 A23 A27'27 ROO R03 A27 ROO ROO ROO A25 A25 A25 ROO ROO ROO 9.2-22b 9.2-23 9.2-23a 9.2-23b 9.2-24 9.2-25 9.2-25a 9.2-25b 9.2-26 9.2-26a 9.2-26b 9.2-27 9.2-28 9.2-28a 9.2-28b 9'-29 9.2-30 9.2-31 9.2-32 9.2-33 9.2-34 9.2-35 9.2-36 9.2-37 9.2-38 9.2-39 9.2-39a 9.2-39b 9.2-40 9.2-41 9.2-42 9.2-43 9.2-44 9.2-45 9.2-46 9.2-46a 9.2-46b 9.2-47 9.2-48 9.2-48a 9.2-48b 9.2-49 9'-50 9.2-51 T 9.2-1A Sh 1 T 9.2-1A Sh 2 ROO A23'23 A23 A23 R04 A23 A18 A23 A23 A18 ROO R04 R04 A25 R04 R04 R04 AOO AOO AOO R04 R04 AOO R04 A26 A26 A26 R04 R04 A22 R04 R04 A23 A05 A24 A05 A24 ROO A20 A20 R03 A23 AOO R01 A28 T 9.2-1A Sh 3 T 9.2-1A Sh 4 T 9.2-1A Sh 5 T 9 2-1A Sh 6 T 9.2-1B Sh 1 T 9.2-1B Sh 2 T 9'-1B Sh 3 T 9.2-1B Sh 4 T 9.2-1B Sh 5 T 9.2-2 Sh 1 T 9.2-2 Sh 2 T 9.2-2 Sh 3 T 9.2-2 Sh 4 T 9.2-2 Sh 5 T 9.2-2 Sh 6 T 9.2-2 Sh 7 T 9.2-2 Sh 8 T 9.2-2 Sh 9 T 9.2-3 Sh 1 T 9 2-3 Sh 2 T 9.2-4 Sh 1 T 9'-4 Sh 2 T 9.2-4 Sh 3 T 9.2-5 T 9.2-6 T 9.2-7 T 9'-8 T 9.2-9 F 9.2-1a F 9.2-1b F 9.2-1c F 9.2-1d F 9.2-1e F 9.2-1f F 9.2-1g F 9.2-1h F 9.2-1j F 9 2-1jc F 9.2-1L F 9.2-1m F 9.2-1n F 9.2-1p F 9.2-1q F 9.2-2 Sh 1 F 9.2-2 Sh 2 F 9.2-2 Sh 3 A28 A28 R01 R01 R01 A28 A28 A28 R01 R01 A28 A28 A28'01 A28 A28 A28 R01 ROO A23 A23 A23 A23 AOO AOO AOO AOO AOO R04 R04 R04 R04 R04 R04 R04 R03 R04 ROO R04 R04 ROO R04 R02 R03 R03 R03 USAR Revision 4 EP 9-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableF=Picpure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=Picpure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment~Fi ure Number F 9~2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-3a F 9.2-3b F 9.2-3c F 9.2-3d F 9.2-3e F 9'-3f F 9.2-3g F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9'-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-5a F 9.2-5b F 9.2-5c 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 1 2 3 4 5 6 7 8 9 10 11 12 R03 R04 R03 R03 R03 R03 R03 R01 R03 R03 R03 R01 R01 R03 R03 R03 R03 R03 R01 R01 R03 R01 R01 R01 R03 R04 ROO R03 ROO ROO ROO R03 R03 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R01 ROO ROO F 9.2-5d F 9.2-5e F 9.2-6a F 9.2-7 Sh 1 F 9.2-7 Sh 2 F 9'-7 Sh 3 F 9.2-7 Sh 4 F 9.2-7 Sh 5 F 9.2-7 Sh 6 F 9'-7 Sh 7 F 9.2-7 Sh 8 F 9'-7 Sh 9 F 9.2-7 Sh 10 F 9.2-7 Sh 11 F 9.2-7 Sh 12 F 9.2-8a F 9'-8b F 9.2-9a F 9.2-9b F 9.2-10 F 9.2-11 F 9.2-12 F 9.2-13 F 9.2-14 F 9.2-15 F 9.2-16 F 9.2-17a F 9.2-17b F 9.2-17c F 9.2-18 Sh 1 F 9.2-18 Sh 2 F 9.2-18 Sh 3 F 9.2-18 Sh 4 F 9.2-19a F 9.2-19b F 9.2-19c F 9.2-19d F 9.2-19e F 9.2-19f F 9.2-20 Sh 1 F 9'-20 Sh 2 F 9.2-20 Sh 3 F 9.2-20 Sh 4 F 9.2-20 Sh 5 F 9.2-21 ROO R01 R02 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R04 ROO R03 R04 R04 R04 AOO R04 AOO AOO R03 R04 ROO R03 R03 R03 R03 R03 ROO ROO ROO ROO R04 R03 R03 R03 R03 R03 A18 9'-1 9.3-1a 9.3-1b 9.3-2 9.3-3 9.3-4 9.3-4a 9.3-4b 9.3-5 9.3-6 9.3-7 9.3-8 9.3-9 9.3-10 9.3-11 9.3-11a 9.3-11b 9.3-11c 9.3-11d 9.3-11e 9.3-11f 9.3-11g 9.3-11h 9.3-11i 9.3-11j 9.3-12 9.3-13 9.3-14 9.3-15 9.3-16 9.3-17 9.3-17a 9.3-17b 9.3-18 9.3-19 9.3-20 9.3-21 9.3-22 9.3-22a 9.3-22b 9.3-23 9'-23a 9.3-23b 9.3-24 9.3-25 9'-26'.ROO ROO A28 A25 ROO ROO ROO ROO R03 A12 R04 A23 R04 A24 ROO R02 A12 A26 R03 ROO ROO A28 ROO ROO A12 A25 A23 AOO ROO A23 A24 A24 A24 AOO AOO AOO AOO A22 A22 A22 R04 R04 A22 A27 A27 A22 USAR Revision 4 EP 9-3 October 1992 4
~FiureNumberF9~2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9'-2ShF9.2-2ShF9.2-2ShF9'-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9.2-2ShF9'-2ShF9.2-3aF9.2-3bF9.2-3cF9.2-3dF9.2-3eF9'-3fF9.2-3gF9.2-4ShF9.2-4ShF9.2-4ShF9'-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-4ShF9.2-5aF9.2-5bF9.2-5c456789101112131415161718192021222324252627123456789101112R03R04R03R03R03R03R03R01R03R03R03R01R01R03R03R03R03R03R01R01R03R01R01R01R03R04ROOR03ROOROOROOR03R03R03R03R03R03ROOROOR03R03R03R03R01ROOROOF9.2-5dF9.2-5eF9.2-6aF9.2-7Sh1F9.2-7Sh2F9'-7Sh3F9.2-7Sh4F9.2-7Sh5F9.2-7Sh6F9'-7Sh7F9.2-7Sh8F9'-7Sh9F9.2-7Sh10F9.2-7Sh11F9.2-7Sh12F9.2-8aF9'-8bF9.2-9aF9.2-9bF9.2-10F9.2-11F9.2-12F9.2-13F9.2-14F9.2-15F9.2-16F9.2-17aF9.2-17bF9.2-17cF9.2-18Sh1F9.2-18Sh2F9.2-18Sh3F9.2-18Sh4F9.2-19aF9.2-19bF9.2-19cF9.2-19dF9.2-19eF9.2-19fF9.2-20Sh1F9'-20Sh2F9.2-20Sh3F9.2-20Sh4F9.2-20Sh5F9.2-21ROOR01R02R03R03R03R03R03R03R03R03R03R03R03R03R04R04ROOR03R04R04R04AOOR04AOOAOOR03R04ROOR03R03R03R03R03ROOROOROOROOR04R03R03R03R03R03A189'-19.3-1a9.3-1b9.3-29.3-39.3-49.3-4a9.3-4b9.3-59.3-69.3-79.3-89.3-99.3-109.3-119.3-11a9.3-11b9.3-11c9.3-11d9.3-11e9.3-11f9.3-11g9.3-11h9.3-11i9.3-11j9.3-129.3-139.3-149.3-159.3-169.3-179.3-17a9.3-17b9.3-189.3-199.3-209.3-219.3-229.3-22a9.3-22b9.3-239'-23a9.3-23b9.3-249.3-259'-26'.ROOROOA28A25ROOROOROOROOR03A12R04A23R04A24ROOR02A12A26R03ROOROOA28ROOROOA12A25A23AOOROOA23A24A24A24AOOAOOAOOAOOA22A22A22R04R04A22A27A27A22USARRevision4EP9-3October1992 4
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=F icFFre Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 9.3-26a 9.3-26b 9.3-27 9.3-28 9.3-28a 9.3-28b 9.3-29 9.3-29a 9.3-29b 9.3-30 9.3-31 9.3-32 9.3-33 9.3-33a 9.3-33b 9.3-34 9.3-35 9.3-35a 9.3-35b 9'-36 T 9.3-1 Sh 1 T 9'-1 Sh 2 T 9.3-1 Sh 3 T 9.3-1 Sh 4 T 9'-1 Sh 5 T 9.3-1 Sh 5a T 9'-1 Sh 6 T 9.3-1 Sh 7 T 9'3-1 Sh 8 T 9.3-1 Sh 9 T 9.3-1 Sh 9a T 9.3-1 Sh 10 T 9.3-2 Sh 1 T 9'-2 Sh 2 T 9.3-3 F 9'-la F 9.3-lb F 9.3-1c F 9.3-1d F 9.3-1e F 9.3-1f F 9.3-1g F 9'-lh F 9.3-lj F 9.3-lk F 9.3-1L A27 A22 ROO ROO A24 A22 A24 A18 A18 A18 A27 ROO A26 A26 A18 ROO A28 A28 A28 Rol AOO AOO AOO AOO A23 A23 AOO R03 A23 A23 A23 A23 A21 A23 ROO R04 R04 R04 R02 R04 R04 R03 R02 R02 R02 ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F'F F F 9.3-1m 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-3a 9.3-3b 9.3-3c 9.3-3d 9.3-3e 9.3-4 Sh 9.3-4 Sh 9.3-5a 9.3-5b 9.3-5c 9.3-5d 9.3-5e 9.3-5f 9.3-5g 9.3-,5h 9'-5j 9'-5k 9'-6 Sh 9'-6 Sh 9'-6 Sh 9 3-6 Sh 9-3-7 Sh 9'-7 Sh 9.3-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-8 Sh 9'-8 Sh 9'-8 Sh 9.3-9a 9'-9b 1 2 3 4 5 6 7 8 9 10 11 1 2 1 2 3 4 1 2 3 4 5 6 7 8 1 2 3 ROO R03 R03 R03 ROO R03 R03 R03 R03 R03 ROO ROO ROO ROO ROO ROO ROO R03 R03 ROO ROO ROO ROO R01 Rol ROO ROO R04 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 9.3-9c 9.3-9d 9.3-9e 9.3-9f 9.3-10a 9.3-10b 9.3-10c 9.3-10d 9.3-10e 9.3-10f 9.3-10g 9.3-10h 9.3-10j 9.3-11a 9.3-11b 9.3-11c 9.3-11d 9.3-11e 9.3-12a 9.3-12b 9.3-12c 9.3-12d 9.3-12e 9.3-12f 9.3-12g 9.3-12h 9.3-12j 9.3-12k 9.3-12L 9.3-13 Sh 1 9.3-13 Sh 2 9.3-13 Sh 3 9.3-13 Sh 4 9.3-13 Sh 5 9.3-13 Sh 6 9.3-13 Sh 7 9.3-13 Sh 8 9.3-13 Sh 9 9.3-13 Sh 10 9.3-14 Sh 1 9.3-14 Sh 2 9.3-14 Sh 3 9.3-14 Sh 4 9.3-15 9.3-16 Sh 1 9.3-16 Sh 2 R03 ROO ROO R04 R03 R03 R03 ROO R03 ROO R03 R03 R04 ROO ROO ROO R03 R03 ROO R01 R03 R03 ROO ROO R03 ROO R02 ROO ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 USAR Revision 4 EP 9-4 October 1992
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableF=FicFFreAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number9.3-26a9.3-26b9.3-279.3-289.3-28a9.3-28b9.3-299.3-29a9.3-29b9.3-309.3-319.3-329.3-339.3-33a9.3-33b9.3-349.3-359.3-35a9.3-35b9'-36T9.3-1Sh1T9'-1Sh2T9.3-1Sh3T9.3-1Sh4T9'-1Sh5T9.3-1Sh5aT9'-1Sh6T9.3-1Sh7T9'3-1Sh8T9.3-1Sh9T9.3-1Sh9aT9.3-1Sh10T9.3-2Sh1T9'-2Sh2T9.3-3F9'-laF9.3-lbF9.3-1cF9.3-1dF9.3-1eF9.3-1fF9.3-1gF9'-lhF9.3-ljF9.3-lkF9.3-1LA27A22ROOROOA24A22A24A18A18A18A27ROOA26A26A18ROOA28A28A28RolAOOAOOAOOAOOA23A23AOOR03A23A23A23A23A21A23ROOR04R04R04R02R04R04R03R02R02R02ROOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF'FFF9.3-1m9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-2Sh9.3-3a9.3-3b9.3-3c9.3-3d9.3-3e9.3-4Sh9.3-4Sh9.3-5a9.3-5b9.3-5c9.3-5d9.3-5e9.3-5f9.3-5g9.3-,5h9'-5j9'-5k9'-6Sh9'-6Sh9'-6Sh93-6Sh9-3-7Sh9'-7Sh9.3-7Sh9'-7Sh9'-7Sh9'-7Sh9'-7Sh9'-7Sh9'-8Sh9'-8Sh9'-8Sh9.3-9a9'-9b123456789101112123412345678123ROOR03R03R03ROOR03R03R03R03R03ROOROOROOROOROOROOROOR03R03ROOROOROOROOR01RolROOROOR04ROOR03R03R03R03R03R03R03R03R03R03R03R03ROOR03ROOROOROOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF9.3-9c9.3-9d9.3-9e9.3-9f9.3-10a9.3-10b9.3-10c9.3-10d9.3-10e9.3-10f9.3-10g9.3-10h9.3-10j9.3-11a9.3-11b9.3-11c9.3-11d9.3-11e9.3-12a9.3-12b9.3-12c9.3-12d9.3-12e9.3-12f9.3-12g9.3-12h9.3-12j9.3-12k9.3-12L9.3-13Sh19.3-13Sh29.3-13Sh39.3-13Sh49.3-13Sh59.3-13Sh69.3-13Sh79.3-13Sh89.3-13Sh99.3-13Sh109.3-14Sh19.3-14Sh29.3-14Sh39.3-14Sh49.3-159.3-16Sh19.3-16Sh2R03ROOROOR04R03R03R03ROOR03ROOR03R03R04ROOROOROOR03R03ROOR01R03R03ROOROOR03ROOR02ROOROOR03R03R03R03R03R03R03R03R03ROOR03R03R03R03R03R03R03USARRevision4EP9-4October1992


NineMilePointUnit,2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberF9.3-16S?13F9.3-16Sh4F9'-16S?15F9.3-16Sh6F9.3-16Sb7F9.3-16S?18F9.3-16S?19F9.3-17aF9.3-18F9'-19F9.3-20aF9.3-20b9.4-19'-29.4-2a9'-2b94-39.4-49'-59.4-69'-79'-89.4-99'-109'-119.4-129.4-139.4-149.4-159.4-169.4-179.4-189.4-199'-209.4-219'-21a9.4-21b9.4-229.4-239.4-23a9.4-23b9'-249.4-259.4-269.4-26aR03R03.R03R03R03R03R03R04A26AOOR03R03A26A26A26A05R03ROOA26A26A23A25A22A26A25R03ROOROOA25AOOROOA25A25A25A25A25A15ROOROOR03A15R03ROOA15A159.4-26b9.4-279.4-289.4-299.4-309.4-319.4-329.4-32a9.4-32b9.4-339.4-33a9.4-33b9.4-349.4-34a9.4-34b9.4-359.4-369.4-379.4-37a9.4-37b9.4-37c9.4-37d9.4-389.4-399'-409~4-419.4-429'-4394-449.4-44a9.4-44b9.4-459.4-469.4-46a9.4-46b9.4-479.4-47a9.4-47b9.4-489.4-499.4-509.4-519.4-529.4-539.4-549.4-54aA05R04A28A24A25A25R01R01R01R03R03A22A22A22A22A22A26R01R03R03R03A22A25A23R02A23R02R02R02R02R01R02R02R02R02R02R02R02AOOR01A25A23A23A23A23A239.4-54b9.4-559.4-569.4-56a9.4-56b9.4-579.4-57a9.4-57b9.4-589.4-58a9.4-58b9.4-599.4-59a9.4-59b9.4-609.4-619.4-629.4-639.4-649.4-659.4-669.4-679.4-67a9.4-67b9.4-689.4-699.4-709.4-719.4-729.4-72a9.4-72b9.4-73T9.4-1T9.4-1T9.4-1T94-2T9'-2T9'-2T9.4-2T9.4-2T9'-2T9'-2T9.4-2T9.4-2T9'-2T9'-2S111S112Sh3Sh1S112S113S114S?15S?16S?17S?18Sh9Sh10Sh11A23ROOROOA24A23ROOA23A23A09A24ROOA25A23A23A24A26A25A23A05R03R01R04A20A20AOOA23A25AOOA23A23A23A24R03ROOR01A26'03A26A26A26A26A26ROOR03A26R03USARRevision4EP9-5October1992 t
Nine Mile Point Unit, 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number F 9.3-16 S?1 3 F 9.3-16 Sh 4 F 9'-16 S?1 5 F 9.3-16 Sh 6 F 9.3-16 Sb 7 F 9.3-16 S?1 8 F 9.3-16 S?1 9 F 9.3-17a F 9.3-18 F 9'-19 F 9.3-20a F 9.3-20b 9.4-1 9'-2 9.4-2a 9'-2b 9 4-3 9.4-4 9'-5 9.4-6 9'-7 9'-8 9.4-9 9'-10 9'-11 9.4-12 9.4-13 9.4-14 9.4-15 9.4-16 9.4-17 9.4-18 9.4-19 9'-20 9.4-21 9'-21a 9.4-21b 9.4-22 9.4-23 9.4-23a 9.4-23b 9'-24 9.4-25 9.4-26 9.4-26a R03 R03.R03 R03 R03 R03 R03 R04 A26 AOO R03 R03 A26 A26 A26 A05 R03 ROO A26 A26 A23 A25 A22 A26 A25 R03 ROO ROO A25 AOO ROO A25 A25 A25 A25 A25 A15 ROO ROO R03 A15 R03 ROO A15 A15 9.4-26b 9.4-27 9.4-28 9.4-29 9.4-30 9.4-31 9.4-32 9.4-32a 9.4-32b 9.4-33 9.4-33a 9.4-33b 9.4-34 9.4-34a 9.4-34b 9.4-35 9.4-36 9.4-37 9.4-37a 9.4-37b 9.4-37c 9.4-37d 9.4-38 9.4-39 9'-40 9~4-41 9.4-42 9'-43 9 4-44 9.4-44a 9.4-44b 9.4-45 9.4-46 9.4-46a 9.4-46b 9.4-47 9.4-47a 9.4-47b 9.4-48 9.4-49 9.4-50 9.4-51 9.4-52 9.4-53 9.4-54 9.4-54a A05 R04 A28 A24 A25 A25 R01 R01 R01 R03 R03 A22 A22 A22 A22 A22 A26 R01 R03 R03 R03 A22 A25 A23 R02 A23 R02 R02 R02 R02 R01 R02 R02 R02 R02 R02 R02 R02 AOO R01 A25 A23 A23 A23 A23 A23 9.4-54b 9.4-55 9.4-56 9.4-56a 9.4-56b 9.4-57 9.4-57a 9.4-57b 9.4-58 9.4-58a 9.4-58b 9.4-59 9.4-59a 9.4-59b 9.4-60 9.4-61 9.4-62 9.4-63 9.4-64 9.4-65 9.4-66 9.4-67 9.4-67a 9.4-67b 9.4-68 9.4-69 9.4-70 9.4-71 9.4-72 9.4-72a 9.4-72b 9.4-73 T 9.4-1 T 9.4-1 T 9.4-1 T 9 4-2 T 9'-2 T 9'-2 T 9.4-2 T 9.4-2 T 9'-2 T 9'-2 T 9.4-2 T 9.4-2 T 9'-2 T 9'-2 S11 1 S11 2 Sh 3 Sh 1 S11 2 S11 3 S11 4 S?1 5 S?1 6 S?1 7 S?1 8 Sh 9 Sh 10 Sh 11 A23 ROO ROO A24 A23 ROO A23 A23 A09 A24 ROO A25 A23 A23 A24 A26 A25 A23 A05 R03 R01 R04 A20 A20 AOO A23 A25 AOO A23 A23 A23 A24 R03 ROO R01 A26'03 A26 A26 A26 A26 A26 ROO R03 A26 R03 USAR Revision 4 EP 9-5 October 1992 t
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableF=FicFureAmendment NumberPageT=TableFF=icrureAmendment NumberPageT=TableF=FicFure Amendment NumberTTTTTTTTTTTTTTTTTTTTTTT9.4-29.4-29.4-29.4-39.4-39~4-39~4-39~4-39.4-39.4-39.4-39.4-39'-39.4-39.4-39'-49.4-49.4-49.4-49.4-49'-49.4-49.4-4ShShShShShShShShshShShShShShShShShShShShShShShTTTTTTTTTTTTTTTTTT9.4-59.4-59~4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59.4-59~4-59~4-59~4-59~4-59~4-59.4-59.4-6ShShShShShShShShShShShShShShShShShShShShShSh9.4-4Sh121314123456789101112123455a66a1234567891011121314151617181920211A26A26A26ROOROOROOA26ROOROOROOROOROOROOROOA26A26A26A26R01R01R01R03R03A26A26A26ROOA26ROOA26A26A26A26A26A26A26A26A26A26A26A26A26A26A26A26R02TTTTTTTTTTTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFFFF94-6Sh29'-6Sh394-7Sh19-4-7Sh29-4-8Sh19'-8Sh29'-8Sh39'-8Sh49'-8Sh59'-8Sh69'-994-10Sh19.4-10Sh29'-11Sh19'-11Sh29-4-12Sh19'-12Sh29'-12Sh39.4-12Sh49.4-12Sh59.4-1a9.4-1b9.4-1c9.4-1d9.4-1e9.4-1f9.4-2a9.4-2b9.4-2c9.4-2d9.4-2e9.4-3a9.4-3b9.4-3c9.4-3d9.4-3e9.4-3f9.4-4Sh194-4Sh29.4-4Sh39.4-4Sh49.4-4Sh59.'4-4Sh69'.4-4Sh79.4-4Sh89'-4Sh9R02R02A26A26A26A26A26ROOA26A26A26A26A26A28A28A28A28A28A28A28R04R04R03ROOR04ROOROOR01R02ROOROOROOROOROOR01ROOROOR03R03R03R03R03R03ROOR03R039.4-5Sh9.4-5Sh9.4-5Sh9.4-5Sh9.4-5Sh9.4-5Sh9.4-5Sh9'-5Sh9.4-6Sh9'-6Sh9.4-6Sh9.4-6Sh9.4-6Sh9.4-6Sh9.4-6Sh9.4-7Sh9.4-7Sh9.4-7Sh9'-7Sh94-7Sh9'-7Sh9-4-7Sh9-4-7Sh9'-7Sh9'-7Sh9-4-7Sh9-4-7Sh9.4-7Sh9'-7Sh9'-8a9.4-8b9.4-8c9'-8d9.4-8e9.4-8f9.4-8g9.4-8h9.4-8j94-8k9.4-8L94-9Sh9'-9Sh9.4-9Sh9'-9Sh9'-9Sh9'-9ShFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF1234567812345671234567891011121314123456R03ROOR03R03ROOR03ROOR01R03R03R03R03R03R03R03R03R03R03R03R03ROOROOROOR03R03R03ROOROOR03R04ROOROOROOROOROOR03R03R04R03R04R03R03R03R03R03R04USARRevision4EP9-6October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=FicFur e Amendment Number Page T=Table F F=icru re Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T T T T T T T T T T T T 9.4-2 9.4-2 9.4-2 9.4-3 9.4-3 9~4-3 9~4-3 9~4-3 9.4-3 9.4-3 9.4-3 9.4-3 9'-3 9.4-3 9.4-3 9'-4 9.4-4 9.4-4 9.4-4 9.4-4 9'-4 9.4-4 9.4-4 Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh T T T T T T T T T T T T T T T T T T 9.4-5 9.4-5 9~4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9~4-5 9~4-5 9~4-5 9~4-5 9~4-5 9.4-5 9.4-6 Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 9.4-4 Sh 12 13 14 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 5a 6 6a 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 A26 A26 A26 ROO ROO ROO A26 ROO ROO ROO ROO ROO ROO ROO A26 A26 A26 A26 R01 R01 R01 R03 R03 A26 A26 A26 ROO A26 ROO A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 R02 T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F 9 4-6 Sh 2 9'-6 Sh 3 9 4-7 Sh 1 9-4-7 Sh 2 9-4-8 Sh 1 9'-8 Sh 2 9'-8 Sh 3 9'-8 Sh 4 9'-8 Sh 5 9'-8 Sh 6 9'-9 9 4-10 Sh 1 9.4-10 Sh 2 9'-11 Sh 1 9'-11 Sh 2 9-4-12 Sh 1 9'-12 Sh 2 9'-12 Sh 3 9.4-12 Sh 4 9.4-12 Sh 5 9.4-1a 9.4-1b 9.4-1c 9.4-1d 9.4-1e 9.4-1f 9.4-2a 9.4-2b 9.4-2c 9.4-2d 9.4-2e 9.4-3a 9.4-3b 9.4-3c 9.4-3d 9.4-3e 9.4-3f 9.4-4 Sh 1 9 4-4 Sh 2 9.4-4 Sh 3 9.4-4 Sh 4 9.4-4 Sh 5 9.'4-4 Sh 6 9'.4-4 Sh 7 9.4-4 Sh 8 9'-4 Sh 9 R02 R02 A26 A26 A26 A26 A26 ROO A26 A26 A26 A26 A26 A28 A28 A28 A28 A28 A28 A28 R04 R04 R03 ROO R04 ROO ROO R01 R02 ROO ROO ROO ROO ROO R01 ROO ROO R03 R03 R03 R03 R03 R03 ROO R03 R03 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9'-5 Sh 9.4-6 Sh 9'-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-7 Sh 9.4-7 Sh 9.4-7 Sh 9'-7 Sh 9 4-7 Sh 9'-7 Sh 9-4-7 Sh 9-4-7 Sh 9'-7 Sh 9'-7 Sh 9-4-7 Sh 9-4-7 Sh 9.4-7 Sh 9'-7 Sh 9'-8a 9.4-8b 9.4-8c 9'-8d 9.4-8e 9.4-8f 9.4-8g 9.4-8h 9.4-8j 9 4-8k 9.4-8L 9 4-9 Sh 9'-9 Sh 9.4-9 Sh 9'-9 Sh 9'-9 Sh 9'-9 Sh F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 2 3 4 5 6 R03 ROO R03 R03 ROO R03 ROO R01 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO ROO ROO R03 R03 R03 ROO ROO R03 R04 ROO ROO ROO ROO ROO R03 R03 R04 R03 R04 R03 R03 R03 R03 R03 R04 USAR Revision 4 EP 9-6 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF9.4-9Sh79.4-9Sh89.4-9Sh99.4-9Sh109.4-9Sh119.4-9Sh129.4-9Sh139.4-9Sh149'-9Sh15'.4-9Sh169.4-9Sh179'-9Sh189'-9Sh199'-9Sh209.4-9Sh219.4-9Sh229'-9Sh239'-9Sh249'-9Sh259.4-10a9.4-10b9'-10c9'-10d9.4-10e9.4-11Sh19.4-11Sh29.4-11Sh39.4-11Sh49.4-11Sh59.4-11Sh69.4-11Sh79.4-11Sh89.4-11Sh99.4-11Sh109.4-11Sh119.4-11Sh129.4-11Sh13F9.4-11Sh14F9.4-11.sh 15F9.4-11Sh169.4-11Sh179.4-12a,9'-12b9.4-12c9'-12d9.4-13Sh1R03R03R03R03R03R03R03R03R03R03R03R03R03R01R04R03ROOROOROOR04ROOROOROOR04R03R03R03R03R01R03R03R03R03ROOROOR03R03R03R03R03R03R03R02ROOROOR03FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9-Sh10Sh11Sh12Sh1Sh2Sh3aSh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh1Sh2Sh3Sh4Sh1Sh2Sh3Sh1Sh29.4-139.4-139.4-139'-139.4-139.4-139.4-139.4-139'-139.4-139'-139.4-149~4-149.4-149.4-159.4-169.4-169.4-169.4-169.4-169.4-169.4-169.4-169.4-169.4-179.4-179.4-179.4-179.4-179.4-179.4-179.4-179.4-179.4-179.4-179'-179.4-179.4-189'-189.4-189.4-189.4-199.4-199.4-199.4-209.4-20R03R03R03R03R03ROOROOR03R03R03R03R03R03R03ROOR03R03R03R03ROOR03R03R03R03R03R03R03ROOR03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03F9.4-20ShF9.4-20ShF9'-20ShF9.4-21ShF9.4-21ShF9'-21ShF9'-21ShF9.4-22aF9.4-22bF9.4-22cF9.4-22dF9.4-22eF9'-23ShF9.4-23ShF9'-23ShF9.4-23ShF9.4-23ShF9'-23ShF9.4-23Sh9.5-19.5-1a9.5-1b9.5-29.5-39.5-49.5-4a9.5-4b,9.5-59.5-5a9.5-5b9.5-69.5-6a9.5-6b9.5-79.5-89.5-99.5-109.5-119.5-129.5-12a9.5-12b9.5-139.5-149.5-159.5-16R03R03R03R03R03ROOR03R04ROOROOROOROOR03R03R03R03ROOR03R03ROOROOROOR04R04R04ROOA09R02R02R02R02R02A26R04R04R04A28AOOR01A23A23AOOR04AOOROOUSARRevision4EP9-7October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 9.4-9 Sh 7 9.4-9 Sh 8 9.4-9 Sh 9 9.4-9 Sh 10 9.4-9 Sh 11 9.4-9 Sh 12 9.4-9 Sh 13 9.4-9 Sh 14 9'-9 Sh 15'.4-9 Sh 16 9.4-9 Sh 17 9'-9 Sh 18 9'-9 Sh 19 9'-9 Sh 20 9.4-9 Sh 21 9.4-9 Sh 22 9'-9 Sh 23 9'-9 Sh 24 9'-9 Sh 25 9.4-10a 9.4-10b 9'-10c 9'-10d 9.4-10e 9.4-11 Sh 1 9.4-11 Sh 2 9.4-11 Sh 3 9.4-11 Sh 4 9.4-11 Sh 5 9.4-11 Sh 6 9.4-11 Sh 7 9.4-11 Sh 8 9.4-11 Sh 9 9.4-11 Sh 10 9.4-11 Sh 11 9.4-11 Sh 12 9.4-11 Sh 13 F 9.4-11 Sh 14 F 9.4-11.sh 15 F 9.4-11 Sh 16 9.4-11 Sh 17 9.4-12a, 9'-12b 9.4-12c 9'-12d 9.4-13 Sh 1 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R01 R04 R03 ROO ROO ROO R04 ROO ROO ROO R04 R03 R03 R03 R03 R01 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R03 R03 R03 R02 ROO ROO R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9-Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 a Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 9.4-13 9.4-13 9.4-13 9'-13 9.4-13 9.4-13 9.4-13 9.4-13 9'-13 9.4-13 9'-13 9.4-14 9~4-14 9.4-14 9.4-15 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9'-17 9.4-17 9.4-18 9'-18 9.4-18 9.4-18 9.4-19 9.4-19 9.4-19 9.4-20 9.4-20 R03 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 F 9.4-20 Sh F 9.4-20 Sh F 9'-20 Sh F 9.4-21 Sh F 9.4-21 Sh F 9'-21 Sh F 9'-21 Sh F 9.4-22a F 9.4-22b F 9.4-22c F 9.4-22d F 9.4-22e F 9'-23 Sh F 9.4-23 Sh F 9'-23 Sh F 9.4-23 Sh F 9.4-23 Sh F 9'-23 Sh F 9.4-23 Sh 9.5-1 9.5-1a 9.5-1b 9.5-2 9.5-3 9.5-4 9.5-4a 9.5-4b, 9.5-5 9.5-5a 9.5-5b 9.5-6 9.5-6a 9.5-6b 9.5-7 9.5-8 9.5-9 9.5-10 9.5-11 9.5-12 9.5-12a 9.5-12b 9.5-13 9.5-14 9.5-15 9.5-16 R03 R03 R03 R03 R03 ROO R03 R04 ROO ROO ROO ROO R03 R03 R03 R03 ROO R03 R03 ROO ROO ROO R04 R04 R04 ROO A09 R02 R02 R02 R02 R02 A26 R04 R04 R04 A28 AOO R01 A23 A23 AOO R04 AOO ROO USAR Revision 4 EP 9-7 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableAmendment F=Ficrure NumberPageT=TableAmendment F=FicpureNumberPageT=TableAmendment F=Ficrure Number9.5-179.5-17a9'-17b9.5-189.5-18a9'-18b9'-199.5-19a9'-19b9'-209.5-20a9.5-20b9.5-219.5-229.5-22a9.5-22a19.5-22a29.5-22b9.5-22c9'-22d9.5-22e9.5-22f9.5-239.5-23a9.5-23b9.5-249.5-24.19.5-24.29.5-24a9'-24b9.5-24c9.5-24d9.5-259.5-25a9.5-25b9.5-269'-26a9.5-26b9.5-279.5-27a9.5-27b9.5-289.5-299.5-309.5-319.5-31aA24A13A07ROOA23A23ROOROOROOROOROOA15ROOA25A23R02A21R03A26A26A18A17ROOROOROOA28A28A25A13A13A13A13ROOROOROOR02A20A20R01ROOA20ROOA21ROOROOA269.5-31b9.5-329.5-339.5-33a9.5-33b9.5-349.5-359.5-35a9.5-35b9.5-.369.5-36a9.5<<36b9.5-379.5-37a9.5-37b9.5-389.5-38a9.5-38b9.5-399.5-409.5-40a9.5-40b9.5-419.5-41a9.5-41b9.5-429.5-42a9.5-42b9.5-439.5-43a9.5-43b9.5-449.5-44a9.5-44b9.5-459.5-45a9.5-45b9.5-469.5-479.5-47a9.5-47b9.5-489.5-499.5-49a9.5-49b9.5-50A13AOOR02R02A07A24A09A09A09A09A09A09R02R04R03R01ROOA20R04A23A17A07A26A09A09ROOROOR02R01ROOROOR03A21A08ROOR01A07AOOROOA07A07R02R03A19A07A139.5-50a9.5-50b9.5-519.5-51a9.5-51b9.5-51c9.5-51d9.5-529.5-52a9.5-52b9.5-539.5-549.5-559.5-55a9.5-55b9.5-569.5-579.5-57a9.5-57b9.5-589.5-58a9.5-58b9.5-599.5-609.5-619.5-61a9.5-61b9.5-629.5-639.5-649.5-659.5-669.5-679.5-67a9.5-67b9.5-68T9.5-1T9.5-1T9.5-1T9.5-1T9.5-1T9.5-1T9.5-1T9.5-1T9.5-1T9.5-2Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh1ROOA07ROOROOROOROOROOA20R02A11A23A20R04A20A07AOOROOR04A07ROOROOA07R04ROOROOROOROOR04A18A26A27ROOR04R04ROOROOA08A08A08A26A23R03A26R02ROOAOOUSARRevision4EP9-8October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=Fi cpu re Number Page T=Table Amendment F=Ficrure Number 9.5-17 9.5-17a 9'-17b 9.5-18 9.5-18a 9'-18b 9'-19 9.5-19a 9'-19b 9'-20 9.5-20a 9.5-20b 9.5-21 9.5-22 9.5-22a 9.5-22a1 9.5-22a2 9.5-22b 9.5-22c 9'-22d 9.5-22e 9.5-22f 9.5-23 9.5-23a 9.5-23b 9.5-24 9.5-24.1 9.5-24.2 9.5-24a 9'-24b 9.5-24c 9.5-24d 9.5-25 9.5-25a 9.5-25b 9.5-26 9'-26a 9.5-26b 9.5-27 9.5-27a 9.5-27b 9.5-28 9.5-29 9.5-30 9.5-31 9.5-31a A24 A13 A07 ROO A23 A23 ROO ROO ROO ROO ROO A15 ROO A25 A23 R02 A21 R03 A26 A26 A18 A17 ROO ROO ROO A28 A28 A25 A13 A13 A13 A13 ROO ROO ROO R02 A20 A20 R01 ROO A20 ROO A21 ROO ROO A26 9.5-31b 9.5-32 9.5-33 9.5-33a 9.5-33b 9.5-34 9.5-35 9.5-35a 9.5-35b 9.5-.36 9.5-36a 9.5<<36b 9.5-37 9.5-37a 9.5-37b 9.5-38 9.5-38a 9.5-38b 9.5-39 9.5-40 9.5-40a 9.5-40b 9.5-41 9.5-41a 9.5-41b 9.5-42 9.5-42a 9.5-42b 9.5-43 9.5-43a 9.5-43b 9.5-44 9.5-44a 9.5-44b 9.5-45 9.5-45a 9.5-45b 9.5-46 9.5-47 9.5-47a 9.5-47b 9.5-48 9.5-49 9.5-49a 9.5-49b 9.5-50 A13 AOO R02 R02 A07 A24 A09 A09 A09 A09 A09 A09 R02 R04 R03 R01 ROO A20 R04 A23 A17 A07 A26 A09 A09 ROO ROO R02 R01 ROO ROO R03 A21 A08 ROO R01 A07 AOO ROO A07 A07 R02 R03 A19 A07 A13 9.5-50a 9.5-50b 9.5-51 9.5-51a 9.5-51b 9.5-51c 9.5-51d 9.5-52 9.5-52a 9.5-52b 9.5-53 9.5-54 9.5-55 9.5-55a 9.5-55b 9.5-56 9.5-57 9.5-57a 9.5-57b 9.5-58 9.5-58a 9.5-58b 9.5-59 9.5-60 9.5-61 9.5-61a 9.5-61b 9.5-62 9.5-63 9.5-64 9.5-65 9.5-66 9.5-67 9.5-67a 9.5-67b 9.5-68 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 ROO A07 ROO ROO ROO ROO ROO A20 R02 A11 A23 A20 R04 A20 A07 AOO ROO R04 A07 ROO ROO A07 R04 ROO ROO ROO ROO R04 A18 A26 A27 ROO R04 R04 ROO ROO A08 A08 A08 A26 A23 R03 A26 R02 ROO AOO USAR Revision 4 EP 9-8 October 1992
~,>>
~,>>
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9PageT=TableF=Ficrure Amendment NumberPageT=TableF=FicFureAmendment NumberPageT=TableAmendment F=FicFure NumberTTTTTTTTTTTTTTTTTTTTTTFFFFFFFFFFFFFFFFFFFFFFFF9.5-2Sh29.5-2Sh39.5-2Sh49'-2Sh59.5-2Sh69.5-2Sh79'-2Sh89.5-3Sh19.5-3Sh29.5-3Sh39'-3Sh49'-3Sh4a9.5-3Sh59.5-3Sh69'-3Sh79.5-3Sh89'-3Sh99.5-3Sh9a9.5-3Sh9b95-3Sh109'-3Sh119.5-3a9.5-1a9.5-1b9.5<<1c9.5-1d9.5-1e9.5-1f9.5-1g9'-1h9.5-2a9'-2b9.5-3a9.5-3b9.5-3c9.5-4a9.5-5Sh19.5-5Sh29'-69'-79.5-8Sh19.5-8Sh29.5-9Sh19.5-9Sh29.5-10Sh19'-10Sh2AOOA23R02R03A26AOOAOOA26A26R03R03R03A26A26A26A26R04R04R04A26A26R03ROOROOR02R03R03R03R03R02R03ROOR04R04R02ROOR02R02R02R04R02R02R02R02R02R02FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSh1Sh2Sh1Sh2Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh129.5-119.5-129.5-139.5-149.5-159.5-169.5-179.5-189'-199.5-209.5-209.5-219.5-229.5-239.5-249.5-259.5-269.5-269.5-279.5-289.5-299.5-309.5-319.5-329.5-339.5-349.5-359.5-369.5-379.5-389.5-399.5-40a9.5-40b9.5-40c9.5-419.5-419.5-419.5-419.5-419.5-419.5-419'-419'-419.5-419.5-419'-41R02R02R02R02R02R02R02R02R02R02R02R02R02R02R02R02R03R03R02R02R04R02R02R04R02R02R03R02R02R02R02R02R04R04R04R03R03R03R03R03R03R03R03R03R03R02Sh1Sh2Sh1Sh2abcSh1Sh2Sh3Sh4Sh5Sh6Sh7App9A9A-i9A-ii9A-iii9A-iv9A-v9A-vi9A-vii9A-viii9A.1-19A.2-19A.2-1a9A.2-lb9A.2-29A.2-39A.2-49A.2-59A.2-69A.3-19A.3-1a9A.3-1b9A.3-29A.3-3F9.5-42F9.5-43F9.5-44F9.5-44F9.5-45F9.5-46F9.5-47F9.5-48F9.5-48F9.5-49F9'-50F9.5-51F9'-52F9.5-52F9.5-52F9.5-53F9.5-53F9.5-53F9.5-53F9.5-53F9.5-53F9.5-53A23A07A28A28A08A28A07R01R01R04R04R04R04R04R04R03R03R03R03R03R03ROOA06R03ROOR01ROOROOR01R03R03A06ROOA24A24R02R02R04A25ROOR03R04A28R04R04USARRevision4EP9-9October1992 AI' NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER9pageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment Number9A.3-49A.3-59A.3-69A.3-79A.3-7a9A.3-7b9A.3-89A.3-99A.3-109A.3-10a9A.3-10b9A.3-119A.3-129A.3-12a9A.3-12b9A.3-139A.3-149A.3-14a9A.3-14b9A.3-159A.3-169A.3-16a9A.3-16b9A.3-179A.3-17a9A.3-17b9A.3-189A.3-199A.3-209A.3-20a9A.3-20b9A.3-219A.3-229A.3-239A.3-249A.3-259A.3-269A.3-279A.3-289A.3-299A.3-29a9A.3-29b9A.3-309A.3-30a9A.3-30b9A.3-31R03ROOROOR04R02A26R01ROOR01A24A24ROOR02A10A10ROOROO'ROOROOROOR01A24A24R01ROOA23ROOROOA23A23A23ROOA06ROOROOROOA26R04A23ROOA26A26A26ROOA13R049A.3-31a9A.3-31b9A.3-329A.3-339A.3-349A.3-359A.3-369A.3-379A.3-389A.3-399A.3-409A.3-40a9A.3-40b9A.3-419A.3-41a9A.3-41b9A.3-429A.3-42a9A.3-42b9A.3-439A.3-449A.3-44a9A.3-44b9A.3-459A.3-45a9A.3-45b9A.3-469A.3-479A.3-489A.3-48a9A.3-48b9A.3-499A.3-49a9A.3-49b9A.3-509A.3-50a9A.3-50b9A.3-50c9A.3-50d9A.3-50e9A.3-50f9A.3-519A.3-51a9A.3-51b9A.3-529A.3-52aR04A14R04ROOROOROOROOROOROOROOR01ROOROOR01R01R01R03R04A13ROOROOROOA13R04A09A09ROOROOA28R04.A28R02R04A13A28A28A28R04A28ROOA28ROOA10A10R01ROO9A.3-52b9A.3-52c9A.3-52d9A.3-539A.3-53a9A.3-53b9A.3-53c9A.3-53d9A.3-549A.3-559A.3-55a9A.3-55b9A.3-569A.3-579A.3-57a9A.3-57b9A.3-589A.3-599A.3-60T9A.3-1T9A.3-1T9A.3-1T9A.3-1T9A.3-2T9A.3-2T9A.3-2T9A.3-3T9A.3-4T9A.3-4T9A.3-4T9A.3-4T9A.3-4T9A.3-4T9A.3-5T9A.3-6T9A.3-6T9A.3-6T9A.3-6T9A.3-6T9A.3-7T9A.3-7T9A.3-8T9A.3-8T9A.3-9T9A.3-9T9A.3-9Sh1Sh2Sh3Sh4Sh1Sh2Sh3Sh1Sh2Sh3Sh4Sh5Sh6Sh1Sh2Sh3Sh4Sh5Sh1Sh2Sh1Sh2Sh1Sh2Sh3ROOR04ROOA28R04R04R04A28R04R04ROOA18R03ROOA17A13ROOR03ROOROOR02R02R02ROOR02ROOR01ROOR01R01R01R01R04R01ROOR02R01R02R02ROOROOROOR02R04R02R03USARRevision4EP9-10October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=Ficrure Amendment Number Page T=Table F=FicFur e Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F 9.5-2 Sh 2 9.5-2 Sh 3 9.5-2 Sh 4 9'-2 Sh 5 9.5-2 Sh 6 9.5-2 Sh 7 9'-2 Sh 8 9.5-3 Sh 1 9.5-3 Sh 2 9.5-3 Sh 3 9'-3 Sh 4 9'-3 Sh 4a 9.5-3 Sh 5 9.5-3 Sh 6 9'-3 Sh 7 9.5-3 Sh 8 9'-3 Sh 9 9.5-3 Sh 9a 9.5-3 Sh 9b 9 5-3 Sh 10 9'-3 Sh 11 9.5-3a 9.5-1a 9.5-1b 9.5<<1c 9.5-1d 9.5-1e 9.5-1f 9.5-1g 9'-1h 9.5-2a 9'-2b 9.5-3a 9.5-3b 9.5-3c 9.5-4a 9.5-5 Sh 1 9.5-5 Sh 2 9'-6 9'-7 9.5-8 Sh 1 9.5-8 Sh 2 9.5-9 Sh 1 9.5-9 Sh 2 9.5-10 Sh 1 9'-10 Sh 2 AOO A23R02 R03 A26 AOO AOO A26 A26 R03 R03 R03 A26 A26 A26 A26 R04 R04 R04 A26 A26 R03 ROO ROO R02 R03 R03 R03 R03 R02 R03 ROO R04 R04 R02 ROO R02 R02 R02 R04 R02 R02 R02 R02 R02 R02 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 9.5-11 9.5-12 9.5-13 9.5-14 9.5-15 9.5-16 9.5-17 9.5-18 9'-19 9.5-20 9.5-20 9.5-21 9.5-22 9.5-23 9.5-24 9.5-25 9.5-26 9.5-26 9.5-27 9.5-28 9.5-29 9.5-30 9.5-31 9.5-32 9.5-33 9.5-34 9.5-35 9.5-36 9.5-37 9.5-38 9.5-39 9.5-40a 9.5-40b 9.5-40c 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9'-41 9'-41 9.5-41 9.5-41 9'-41 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R03 R03 R02 R02 R04 R02 R02 R04 R02 R02 R03 R02 R02 R02 R02 R02 R04 R04 R04 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R02 Sh 1 Sh 2 Sh 1 Sh 2 a b c Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 App 9A 9A-i 9A-ii 9A-iii 9A-iv 9A-v 9A-vi 9A-vii 9A-viii 9A.1-1 9A.2-1 9A.2-1a 9A.2-lb 9A.2-2 9A.2-3 9A.2-4 9A.2-5 9A.2-6 9A.3-1 9A.3-1a 9A.3-1b 9A.3-2 9A.3-3 F 9.5-42 F 9.5-43 F 9.5-44 F 9.5-44 F 9.5-45 F 9.5-46 F 9.5-47 F 9.5-48 F 9.5-48 F 9.5-49 F 9'-50 F 9.5-51 F 9'-52 F 9.5-52 F 9.5-52 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 A23 A07 A28 A28 A08 A28 A07 R01 R01 R04 R04 R04 R04 R04 R04 R03 R03 R03 R03 R03 R03 ROO A06 R03 ROO R01 ROO ROO R01 R03 R03 A06 ROO A24 A24 R02 R02 R04 A25 ROO R03 R04 A28 R04 R04 USAR Revision 4 EP 9-9 October 1992 A I' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number 9A.3-4 9A.3-5 9A.3-6 9A.3-7 9A.3-7a 9A.3-7b 9A.3-8 9A.3-9 9A.3-10 9A.3-10a 9A.3-10b 9A.3-11 9A.3-12 9A.3-12a 9A.3-12b 9A.3-13 9A.3-14 9A.3-14a 9A.3-14b 9A.3-15 9A.3-16 9A.3-16a 9A.3-16b 9A.3-17 9A.3-17a 9A.3-17b 9A.3-18 9A.3-19 9A.3-20 9A.3-20a 9A.3-20b 9A.3-21 9A.3-22 9A.3-23 9A.3-24 9A.3-25 9A.3-26 9A.3-27 9A.3-28 9A.3-29 9A.3-29a 9A.3-29b 9A.3-30 9A.3-30a 9A.3-30b 9A.3-31 R03 ROO ROO R04 R02 A26 R01 ROO R01 A24 A24 ROO R02 A10 A10 ROO ROO'ROO ROO ROO R01 A24 A24 R01 ROO A23 ROO ROO A23 A23 A23 ROO A06 ROO ROO ROO A26 R04 A23 ROO A26 A26 A26 ROO A13 R04 9A.3-3 1a 9A.3-31b 9A.3-32 9A.3-33 9A.3-34 9A.3-35 9A.3-36 9A.3-37 9A.3-38 9A.3-39 9A.3-40 9A.3-40a 9A.3-40b 9A.3-41 9A.3-41a 9A.3-41b 9A.3-42 9A.3-42a 9A.3-42b 9A.3-43 9A.3-44 9A.3-44a 9A.3-44b 9A.3-45 9A.3-45a 9A.3-45b 9A.3-46 9A.3-47 9A.3-48 9A.3-48a 9A.3-48b 9A.3-49 9A.3-49a 9A.3-49b 9A.3-50 9A.3-50a 9A.3-50b 9A.3-50c 9A.3-50d 9A.3-50e 9A.3-50f 9A.3-51 9A.3-51a 9A.3-51b 9A.3-52 9A.3-52a R04 A14 R04 ROO ROO ROO ROO ROO ROO ROO R01 ROO ROO R01 R01 R01 R03 R04 A13 ROO ROO ROO A13 R04 A09 A09 ROO ROO A28 R04.A28 R02 R04 A13 A28 A28 A28 R04 A28 ROO A28 ROO A10 A10 R01 ROO 9A.3-52b 9A.3-52c 9A.3-52d 9A.3-53 9A.3-53a 9A.3-53b 9A.3-53c 9A.3-53d 9A.3-54 9A.3-55 9A.3-55a 9A.3-55b 9A.3-56 9A.3-57 9A.3-57a 9A.3-57b 9A.3-58 9A.3-59 9A.3-60 T 9A.3-1 T 9A.3-1 T 9A.3-1 T 9A.3-1 T 9A.3-2 T 9A.3-2 T 9A.3-2 T 9A.3-3 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-5 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-7 T 9A.3-7 T 9A.3-8 T 9A.3-8 T 9A.3-9 T 9A.3-9 T 9A.3-9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 ROO R04 ROO A28 R04 R04 R04 A28 R04 R04 ROO A18 R03 ROO A17 A13 ROO R03 ROO ROO R02 R02 R02 ROO R02 ROO R01 ROO R01 R01 R01 R01 R04 R01 ROO R02 R01 R02 R02 ROO ROO ROO R02 R04 R02 R03 USAR Revision 4 EP 9-10 October 1992
-4~P NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER9PAGESPageT=TableF=FicFure Amendment NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberSh1Sh2TTTTTTTTTTTTTTTTTTTTTTTTTTTFFFFFFFFFFFFFFFFFFF9A.3-109A.3-109A.3-119A.3-129A.3-139A.3-149A3-159A.3-159A.3-159A.3-159A.3-159A.3-159A.3-169A.3-179A.3-179A.3-179A.3-189A.3-189A.3-189A.3-189A.3-189A-3-189A.3-189A.3-199A.3-209A.3-209A.3-219A.3-19A.3-29A.3-39A.3-49A.3-59A.3-69A.3-79A.3-89A.3-99A.3-109A.3-119A.3-129A.3-13.9A.3-149A.3-149A.3-159A3-159A.3-169A3-16Sh1Sh2Sh3Sh4Sh5Sh6Sh1Sh2Sh3Sh1Sh2Sh3Sh4Sh5Sh6Sh7Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2R01ROOROOR01ROOA06A26A12A26A26A26A26R03A28A28R03A28R04A28A28R03A28A28R01A28A28ROOR03ROOR01R04R04R04R04ROOA23A23A23ROOROOROOA28A28A28A28A28F9A.3-17ShF9A.3-17ShF9A.3-18F9A.3-19F9A.3-20F9A.3-21F9A.3-22F9A.3-239B-1App9C9C-i9C-ii9C-iii9C.1-19C.2-19C-3-19C.3-29C.3-39C.3-49C.3-59C.3-69C.3-79C.3-89C.3-99C.3-109C.3-119C.3-12T3-1Sh1T3-1Sh2T3-2Sh1T3-2Sh2T3-2Sh3T3-2Sh4T3-3Sh1T3-3Sh2T3-3Sh3T3-4T3-59C.4-1T4-1Sh1T4-1Sh2T4-1Sh3T4-1Sh4-T4-1Sh5R03A28ROOA28A28A28A28R03A04ROOROOROOR03ROOROOROOROOROOROOROOROOR03ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOR04ROOROOROOROOROOROOT4-1Sh6T4-1Sh7T4-1Sh7aT4-1Sh8T4-1Sh9T4-1Sh109C.5-1F5-1F5-2F5-3F5-4Sh1F5-4Sh29C.6-19C.7-19C.8-19C.8-29C.8-39C.8-49C.8-59C.9-19C.10-19C.10-29C.10-39C.10-49C.10-5ROOROOROOROOR04ROOROOR02R02ROOR03R03ROOROOR03ROOROOROOROOROOROOROOROOROOROOUSARRevision4EP9-11October1992
-4~P Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 9 PAGES Page T=Table F=FicFure Amendment Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number Sh 1 Sh 2 T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F 9A.3-10 9A.3-10 9A.3-11 9A.3-12 9A.3-13 9A.3-14 9A 3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-16 9A.3-17 9A.3-17 9A.3-17 9A.3-18 9A.3-18 9A.3-18 9A.3-18 9A.3-18 9A-3-18 9A.3-18 9A.3-19 9A.3-20 9A.3-20 9A.3-21 9A.3-1 9A.3-2 9A.3-3 9A.3-4 9A.3-5 9A.3-6 9A.3-7 9A.3-8 9A.3-9 9A.3-10 9A.3-11 9A.3-12 9A.3-13.9A.3-14 9A.3-14 9A.3-15 9A 3-15 9A.3-16 9A 3-16 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 R01 ROO ROO R01 ROO A06 A26 A12 A26 A26 A26 A26 R03 A28 A28 R03 A28 R04 A28 A28 R03 A28 A28 R01 A28 A28 ROO R03 ROO R01 R04 R04 R04 R04 ROO A23 A23 A23 ROO ROO ROO A28 A28 A28 A28 A28 F 9A.3-17 Sh F 9A.3-17 Sh F 9A.3-18 F 9A.3-19 F 9A.3-20 F 9A.3-21 F 9A.3-22 F 9A.3-23 9B-1 App 9C 9C-i 9C-ii 9C-iii 9C.1-1 9C.2-1 9C-3-1 9C.3-2 9C.3-3 9C.3-4 9C.3-5 9C.3-6 9C.3-7 9C.3-8 9C.3-9 9C.3-10 9C.3-11 9C.3-12 T 3-1 Sh 1 T 3-1 Sh 2 T 3-2 Sh 1 T 3-2 Sh 2 T 3-2 Sh 3 T 3-2 Sh 4 T 3-3 Sh 1 T 3-3 Sh 2 T 3-3 Sh 3 T 3-4 T 3-5 9C.4-1 T 4-1 Sh 1 T 4-1 Sh 2 T 4-1 Sh 3 T 4-1 Sh 4-T 4-1 Sh 5 R03 A28 ROO A28 A28 A28 A28 R03 A04 ROO ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R04 ROO ROO ROO ROO ROO ROO T 4-1 Sh 6 T 4-1 Sh 7 T 4-1 Sh 7a T 4-1 Sh 8 T 4-1 Sh 9 T 4-1 Sh 10 9C.5-1 F 5-1 F 5-2 F 5-3 F 5-4 Sh 1 F 5-4 Sh 2 9C.6-1 9C.7-1 9C.8-1 9C.8-2 9C.8-3 9C.8-4 9C.8-5 9C.9-1 9C.10-1 9C.10-2 9C.10-3 9C.10-4 9C.10-5 ROO ROO ROO ROO R04 ROO ROO R02 R02 ROO R03 R03 ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 9-11 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER10PageT=TableAmendment F=Ficrure NumberPageT=TableFF=icFureAmendment NumberPageT=TableAmendment FFicrureNumber10-i10-ii10-iii10-iv10-v10-va10-vb10-vi10.1-110'-210.1-3T10'-1F10.1-1F10.1-2F10.1-3aF10.1-3bF10.1-3cF10.1-3dF10.1-3eF10.1-3fF10.1-3gF10.1-321F10.1-3jF10.1-3kF10.1-4aF10.1-4bF10.1-4cF10.1-4dF10.1-5aF10.1-5bF10.1-5cF10.1-5dF10.1-5eF10.1-6aF10.1-6bF10.1-6cF10.1-6dF10.1-6eF10.1-7aF10.1-7bF10.1-7cF10.1-7dF10.1-7eF10.1-7fF10.1-7gR04A24A24R04R03ROOA24R03R03AOOAOOR03AOOR03ROOROOROOROOROOR03R03R04ROOR04ROOROOROOROOR03R01R04R04R03R03R04R02ROOROOR01R01R01ROOROOR03R03F10.1-7hF10.1-7jF10'-7kF10.1-7LF10.1-7mF10.1-7nF10.1-7pF10.1-7qF10.1-7rF10.1-7sF10.1-7tF10.1-7uF10.1-7wF10.1-8aF10.1-8bF10.1-8cF10.1-8dF10.1-8eF10.1-8fF10.1-8gF10.1-9aF10.1-9bF10.1-9cF10.1-9dF10.1-9eF10.1-9fF10.1-9gF10.1-9?110.2-110.2-210.2-310.2-3a10.2-3b10.2-410.2-510.2-5a10.2-5b10'-610.2-710.2-7a10.2-7b10.2-7c10.2-7d10.2-810.2-9ROOROOROOROOR04ROOR03R03R03ROOROOROOROOR03ROOR03ROOROOROOROOROOROOROOR04ROOROOROOROOR03R04R04R04A07R03R04R04ROOR04R04R04R04R04R04A23AOO10.2-1010.2-1110.2-12T10.2-1T10.2-1T10.2-1F10.2-1F10.2-2F10.2-3F10.2-3F10'-310.3-110.3-1a10.3-1b10.3-210.3-310.3-3a10.3-3b10'-410.3-510.4-110.4-210'-310.4-3a10.4-3b10.4-410.4-4a10.4-4b10.4-510.4-610.4710.4-7a10.4-7b10'-810'-910.4-1010.4-1110.4-1210~4-1310.4-1410.4-1510.4-1610.4-1710.4-17aS?11Sh2S113S?11Sh2Sh3R02R02AOOR04R04R04AOOAOOR03A07A07A05A05A05A27R04ROOA05AOOA23AOOROOA21A06A06A28R03A06AOOAOOR01A21A21ROOA27A21A21AOOAOOR03ROOAOOROOROOUSARRevision4EP10-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 10 Page T=Table Amendment F=Ficrure Number Page T=Table F F=icFure Amendment Number Page T=Table Amendment F Ficrure Number 10-i 10-ii 10-iii 10-iv 10-v 10-va 10-vb 10-vi 10.1-1 10'-2 10.1-3 T 10'-1 F 10.1-1 F 10.1-2 F 10.1-3a F 10.1-3b F 10.1-3c F 10.1-3d F 10.1-3e F 10.1-3f F 10.1-3g F 10.1-321 F 10.1-3j F 10.1-3k F 10.1-4a F 10.1-4b F 10.1-4c F 10.1-4d F 10.1-5a F 10.1-5b F 10.1-5c F 10.1-5d F 10.1-5e F 10.1-6a F 10.1-6b F 10.1-6c F 10.1-6d F 10.1-6e F 10.1-7a F 10.1-7b F 10.1-7c F 10.1-7d F 10.1-7e F 10.1-7f F 10.1-7g R04 A24 A24 R04 R03 ROO A24 R03 R03 AOO AOO R03 AOO R03 ROO ROO ROO ROO ROO R03 R03 R04 ROO R04 ROO ROO ROO ROO R03 R01 R04 R04 R03 R03 R04 R02 ROO ROO R01 R01 R01 ROO ROO R03 R03 F 10.1-7h F 10.1-7j F 10'-7k F 10.1-7L F 10.1-7m F 10.1-7n F 10.1-7p F 10.1-7q F 10.1-7r F 10.1-7s F 10.1-7t F 10.1-7u F 10.1-7w F 10.1-8a F 10.1-8b F 10.1-8c F 10.1-8d F 10.1-8e F 10.1-8f F 10.1-8g F 10.1-9a F 10.1-9b F 10.1-9c F 10.1-9d F 10.1-9e F 10.1-9f F 10.1-9g F 10.1-9?1 10.2-1 10.2-2 10.2-3 10.2-3a 10.2-3b 10.2-4 10.2-5 10.2-5a 10.2-5b 10'-6 10.2-7 10.2-7a 10.2-7b 10.2-7c 10.2-7d 10.2-8 10.2-9 ROO ROO ROO ROO R04 ROO R03 R03 R03 ROO ROO ROO ROO R03 ROO R03 ROO ROO ROO ROO ROO ROO ROO R04 ROO ROO ROO ROO R03 R04 R04 R04 A07 R03 R04 R04 ROO R04 R04 R04 R04 R04 R04 A23 AOO 10.2-10 10.2-11 10.2-12 T 10.2-1 T 10.2-1 T 10.2-1 F 10.2-1 F 10.2-2 F 10.2-3 F 10.2-3 F 10'-3 10.3-1 10.3-1a 10.3-1b 10.3-2 10.3-3 10.3-3a 10.3-3b 10'-4 10.3-5 10.4-1 10.4-2 10'-3 10.4-3a 10.4-3b 10.4-4 10.4-4a 10.4-4b 10.4-5 10.4-6 10.4 7 10.4-7a 10.4-7b 10'-8 10'-9 10.4-10 10.4-11 10.4-12 10~4-13 10.4-14 10.4-15 10.4-16 10.4-17 10.4-17a S?1 1 Sh 2 S11 3 S?1 1 Sh 2 Sh 3 R02 R02 AOO R04 R04 R04 AOO AOO R03 A07 A07 A05 A05 A05 A27 R04 ROO A05 AOO A23 AOO ROO A21 A06 A06 A28 R03 A06 AOO AOO R01 A21 A21 ROO A27 A21 A21 AOO AOO R03 ROO AOO ROO ROO USAR Revision 4 EP 10-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER10PageT=TableF=Ficpure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment Number10.4-17b10.4-1810.4-1910.4-19a10.4-19b10.4-2010.4-2110.4-2210.4-2310.4-23a10.4-23b10.4-2410.4-2510.4-25a10.4-25b10.4-2610.4-26a10.4-26b10.4-2710.4-2810.4-28a10.4-28b10.4-2910.4-3010.4-3110.4-3210.4-3310.4-33a10.4-33b10.4-3410.4-34a10.4-34b10'-35104-3610.4-3710.4-3810.4-39T10.4-1T10.4-2F10.4-1F10.4-1F10.4-1F10.4-1F10.4-1F10.4-2aF10.4-3S11S11ShSbS11S?1ROOA18A28A28A18AOOAOOAOOA26A05A05R01A10A05A05A21A05A05ROOR03A14A07ROOAOOAOOR02R02A25A20ROOA20A20AOOAOOAOOA24AOOROOA27R03R03ROOR03R03R03R03FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF10.4-3S11210.4-3Sh310.4-3Sh410'-3Sh5104-410'-510.4-610.4-7a10.4-7b10.4-7c10.4-7d10.4-7e10.4-7f10.4-7g10.4-7410.4-8Sh110.4-8S11210.4-8S?1310.4-8S11410.4-8S11510.4-8S11610.4-8Sh710.4-8Sh810.4-8Sh910.4-8Sh1010.4-9Sh110.4-9Sh210.4-9S11310.4-9Sh410.4-9Sh510.4-9Sh610.4-9S11710.4-9Sh810.4-9Sh910.4-9Sh,:1010.4-10Sh110.4-10SN210.4-10Sh310.4-10Sh410.4-10Sh510.4-10Sh610.4-10S?1710.4-10S?1810.4-10Sh910.4-10Sh1010.4-10Sh11R03R03R03R03AOOAOOAOOROOROOROOR02ROOROOROOROOR03ROOR03R03R03R03ROOR03R01ROOR03R03R03R03R03ROOR03R03R03R03ROOROOROOROOROOROOROOROOR03R03R03FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF10.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1010.4-1110.4-1110.4-1110.4-1110.4-1110.4-1110.4-1110.4-1110.4-1110.4-1210.4-1210.4-1210.4-1210.4-1210.4-1210'-1210.4-1310.4-1310.4-1310.4-1310.4-1310.4-1310.4-1310.4-13Sh12Sh13Sh14S?115S?116Sh17Sh18Sh19Sh20S?121S1122S?123S?11S?I2S?13S?14S115S?16Sh7Sh8Sjl9S?11S?12S?13S?14S?15Sh6Sh7S?11S?12S113Sh4Sh5Sh6Sh7Sh8R03R03ROOROOROOR03ROOR03R03ROOR03R04R03R03R03R03R03R03ROOR03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03ROOUSARRevision4EP10-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 10 Page T=Table F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number 10.4-17b 10.4-18 10.4-19 10.4-19a 10.4-19b 10.4-20 10.4-21 10.4-22 10.4-23 10.4-23a 10.4-23b 10.4-24 10.4-25 10.4-25a 10.4-25b 10.4-26 10.4-26a 10.4-26b 10.4-27 10.4-28 10.4-28a 10.4-28b 10.4-29 10.4-30 10.4-31 10.4-32 10.4-33 10.4-33a 10.4-33b 10.4-34 10.4-34a 10.4-34b 10'-35 10 4-36 10.4-37 10.4-38 10.4-39 T 10.4-1 T 10.4-2 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-2a F 10.4-3 S11 S11 Sh Sb S11 S?1 ROO A18 A28 A28 A18 AOO AOO AOO A26 A05 A05 R01 A10 A05 A05 A21 A05 A05 ROO R03 A14 A07 ROO AOO AOO R02 R02 A25 A20 ROO A20 A20 AOO AOO AOO A24 AOO ROO A27 R03 R03 ROO R03 R03 R03 R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 10.4-3 S11 2 10.4-3 Sh 3 10.4-3 Sh 4 10'-3 Sh 5 10 4-4 10'-5 10.4-6 10.4-7a 10.4-7b 10.4-7c 10.4-7d 10.4-7e 10.4-7f 10.4-7g 10.4-74 10.4-8 Sh 1 10.4-8 S11 2 10.4-8 S?1 3 10.4-8 S11 4 10.4-8 S11 5 10.4-8 S11 6 10.4-8 Sh 7 10.4-8 Sh 8 10.4-8 Sh 9 10.4-8 Sh 10 10.4-9 Sh 1 10.4-9 Sh 2 10.4-9 S11 3 10.4-9 Sh 4 10.4-9 Sh 5 10.4-9 Sh 6 10.4-9 S11 7 10.4-9 Sh 8 10.4-9 Sh 9 10.4-9 Sh,:10 10.4-10 Sh 1 10.4-10 SN 2 10.4-10 Sh 3 10.4-10 Sh 4 10.4-10 Sh 5 10.4-10 Sh 6 10.4-10 S?1 7 10.4-10 S?1 8 10.4-10 Sh 9 10.4-10 Sh 10 10.4-10 Sh 11 R03 R03 R03 R03 AOO AOO AOO ROO ROO ROO R02 ROO ROO ROO ROO R03 ROO R03 R03 R03 R03 ROO R03 R01 ROO R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 ROO ROO ROO ROO ROO ROO ROO ROO R03 R03 R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-12 10.4-12 10.4-12 10.4-12 10.4-12 10.4-12 10'-12 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 Sh 12 Sh 13 Sh 14 S?1 15 S?1 16 Sh 17 Sh 18 Sh 19 Sh 20 S?1 21 S11 22 S?1 23 S?1 1 S?I 2 S?1 3 S?1 4 S11 5 S?1 6 Sh 7 Sh 8 Sjl 9 S?1 1 S?1 2 S?1 3 S?1 4 S?1 5 Sh 6 Sh 7 S?1 1 S?1 2 S11 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 R03 R03 ROO ROO ROO R03 ROO R03 R03 ROO R03 R04 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO USAR Revision 4 EP 10-2 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER11PageT=TableAmendment g"=Figure NumberPageT=TableAmendment PageT=TableAmendment F=FicFure Number11-i11ii11-iia11-iib11iil11-iv11-vll-vill.1-111.1-211~1-311.1-411.1-511.1-611~1711.1-811.1-911.1-1011.1-1111.1-1211.1-1311.1-1411.1-15T11.1-1T11.1-1T111-1T11.1-2T11.1-3T11.1-4T11.1-5T11.1-6T11F1-7T11.1-8F11F1-1F11.1-2F11.1-311.2-111.2-211'-311~23a11.2-3b11.2-411.2-4a11.2-4bSh1Sh2Sh3A24A24A23A23ROOAOOA08R04AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOROOAOOAOOAOOA23A19'19R01AOOAOOAOOAOOAOOAOOA23ROOA23A23A23ROOA05A0511.2-511.2-5a11.2-5b11'-611.2-6a11.2-6b11~2711.2-811.2-911.2-1011.2-1111.2-1211.2-1311.2-1411.2-14a11.2-14b11.2-1511.2-1611.2-1711.2-18T11.2-1ShT11.2-1ShT11.2-1ShT11.2-1ShT11.2-1ShT11.2-2T11.2-3T11.2-4T11.2-5ShT11.2-5ShT11.2-6ShT11.2-6ShF11.2-1aF11.2-1bF11.2-1cF11.2-ldF11.2-1eF11.2-1fF11.2-1gF11.2-1hF11.2-1jF11.2-lkF11.2-1LF11.2-1m11.3-1A05ROO"A05ROOA05A05ROOROOROOROOA23ROOROOROOROOA23A23AOOR04ROOROOR02ROOR02A25ROOROOAOOA27A27A27A27R03ROOROOROOROOR02ROOR02R01ROOROOR03A0311.3-1a11.3-1b11~3211.3-2a11.3-2b11%3311.3-411.3-511.3-5a11.3-5b11.3-611~3711.3-7a11.3-7b11.3-811.3-9T11.3-1ShT11.3-1ShT113-2ShT11.3-2ShT11.3-3ShT113-3ShF11.3-1aF113-lbF11.3-1cF11.3-211.4-111.4-1a11.4-1b11.4-211.4-2a11.4-2b11.4-311.4-3a11.4-3b11.4-411.4-4a-11.4-4b11.4-511.4-6T11.4-1T11.4-2T11.4-3ShT114-3ShT11.4-3ShA03A03ROOA23A05A23A23R02R04A05A24A09R04A09A12A12A12AOOROOROOA12A12R04R04ROOR04A03A03A03ROOROOA08ROORolROOROORolA23RolROORolROOA26A26AOOUSARRevision4EP11-1October1992 VII NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER11PAGESPageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberT114-3Sh4T11.4-3Sh5T11.4-4Sh1T11.4-4Sh2T11.4-5T11.4-6T11.4-7F11.4-1aF11.4-1bF11.4-1cF11.4-1dF11.4-1eF11.4-1fF11.4-1gF11.4-1h11.5-111.5-211.5-2a11.5-2b11.5-311.5-3a11.5-3b11.5411.5-511.5-5a11.5-5b11.5-611.5-711.5-811.5-911.5-1011.5-10a11.5-10b11.5.-1111.5-11a11.5-11b11.5-1211.5-12a11.5-12b11.5-1311.5-14T11.5-1Sh1T11.5-1Sh2T11.5-1Sh2aT11.5-2Sh1A26A26R04R04A08A08A08R01R03ROOROOROOROOROOROOA23A23ROOA23A23A23A23A23A23A23A23A23R04A23A23A23A23A23R01A25A23A23A07A07A28A23ROOROOROOAOOT115-2Sh2T11.5-2Sh3T11.5-2Sh4F11.5-1F11.5-2F11.5-3aF11.5-3bF11.5-3cF11.5-3dF11.5-4F11.5-5F11.5-6F11.5-7F11.5-8Sh1F11.5-8Sh2App11A11A-illA-ii11A.1-111A.1-2TllA.l-lT11A.1-2T11A.1-3T11A.1-4T11A.1-5TllA.1-6TllA.1-7T11A.1-8T11A.1-9T11A.1-10T11A.1-11T11A.1-12T11A.1-13T11A.1-14T11A.1-15T11A.1-16T11A.1-17T11A.1-18T11A.1-1911A.2-111A.2-2T11A.2-1T11A.2-2AOOROOAOOROOROOR03ROOROOR03A23AOOR04ROOAOOAOOAOOAOOAOOAOOROOROOROOROOROOAOOAOOROOAOOAOOAOOAOOAOOA25A25A25AOOROOROOROOROOAOOROOROOUSARRevision4EP11-2October1992 F4 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER12PageT=TableF=FBFureAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number12-i12ii12-lii12-iv12-iva12-ivb12-v12-vi12-vii12-viia12-viib12-viii12-ix12-x12-xi12-xii12.1-112'-212F1-312'-412.1-512.1-612'-712.1-812'-912.1-9a12.1-9b12.1-1012.1-1112.1-1212.1-1312.1-13a12.1-13b12.1-1412.1-14a12'-14b12.1-1512.2-112.2-1a12.2-1b12.2-212'-312.2-412.2-5R03A24ROOR03A24A12R03R01A24A24A24R02R02ROOROOROOR03R03AOOAOOR03ROOR03R03R03A09A09AOOAOOAOOA07A07A07A07A07A07AOOA11AllA11AOOA11A11ROO12.2-612~2712.2-812.2-8a12.2-8b12.2-912.2-1012.2-1112.2-1212.2-1312.2-1412.2-1512.2-16T12.2-1T12.2-2T12.2-3T12.2-4Sh1T12.2-4Sh2T12.2-4Sh3T12.2-5Sh1T12.2-5Sh2T12.2-6Sh1T12.2-6Sh2T12.2-6Sh3T12.2-7Sh1T12.2-7Sh2T12.2-8Sh1T12.2-8Sh2T12.2-9T12.2-10Sh1T12.2-10Sh2T12.2-10Sh3T12.2-11T12.-2-12Sh1T12.2-12Sh2T12.2-12Sh3T12.2-13Sh1T12.2-13Sh2T12.2-13Sh3T12.2-14T12.2-15aT12.2-15bT12.2-1612~3112~32AOOR02A09A09A09R03A25R04A07A07A09A09A11ROOROOROOROOROOR01A09A09R01ROOAOOROOR01AOOAOOR01R01R01R01AOOR01R01=R01R01R01ROOA07ROOROOA11AOOAOO12~3312.3-412.3-512.3-612~3712~37a12.3-7b12.3-812.3-912.3-1012.3-1112.3-11a1 12.3-11b1 12.3-11a12.3-11b12.3-11c12.3-11d12.3-11e12.3-11f12.3-1212.3-1312.3-1412.3-1512.3-15a12.3-15b12.3-1612.3-1712.3-1812.3-1912.3-2012.3-21123-2212e32312.3-23a12'-23b12.3-2412.3-2512.3-2612.3-2712.3-2812.3-2912.3-3012.3-30a12.3-30b12~3-3112.3-31aAOOROOAOOAOOROOROOROOAOOR02R04R03R02A20A13A13ROOROOROOA13ROOR02AOOR02A05A05AOOAOOA01AOOR01AOOA10A10A10A10ROOA10AOOAOOA10ROOROOROOROOROOROOUSARRevision4EP12-1'ctober1992 e~
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 11 Page T=Table Amendment g"=Figure Number Page T=Table Amendment Page T=Table Amendment F=FicFure Number 11-i 11 ii 11-iia 11-iib 11 iil 11-iv 11-v ll-vi ll.1-1 11.1-2 11~1-3 11.1-4 11.1-5 11.1-6 1 1~1 7 11.1-8 11.1-9 11.1-10 11.1-11 11.1-12 11.1-13 11.1-14 11.1-15 T 11.1-1 T 11.1-1 T 11 1-1 T 11.1-2 T 11.1-3 T 11.1-4 T 11.1-5 T 11.1-6 T 11 F 1-7 T 11.1-8 F 11 F 1-1 F 11.1-2 F 11.1-3 11.2-1 11.2-2 11'-3 1 1~2 3a 11.2-3b 11.2-4 11.2-4a 11.2-4b Sh 1 Sh 2 Sh 3 A24 A24 A23 A23 ROO AOO A08 R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO A23 A19'19 R01 AOO AOO AOO AOO AOO AOO A23 ROO A23 A23 A23 ROO A05 A05 11.2-5 11.2-5a 11.2-5b 11'-6 11.2-6a 11.2-6b 1 1~2 7 11.2-8 11.2-9 11.2-10 11.2-11 11.2-12 11.2-13 11.2-14 11.2-14a 11.2-14b 11.2-15 11.2-16 11.2-17 11.2-18 T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-2 T 11.2-3 T 11.2-4 T 11.2-5 Sh T 11.2-5 Sh T 11.2-6 Sh T 11.2-6 Sh F 11.2-1a F 11.2-1b F 11.2-1c F 11.2-ld F 11.2-1e F 11.2-1f F 11.2-1g F 11.2-1h F 11.2-1j F 11.2-lk F 11.2-1L F 11.2-1m 11.3-1 A05 ROO" A05 ROO A05 A05 ROO ROO ROO ROO A23 ROO ROO ROO ROO A23 A23 AOO R04 ROO ROO R02 ROO R02 A25 ROO ROO AOO A27 A27 A27 A27 R03 ROO ROO ROO ROO R02 ROO R02 R01 ROO ROO R03 A03 11.3-1a 11.3-1b 1 1~3 2 11.3-2a 11.3-2b 1 1%3 3 11.3-4 11.3-5 11.3-5a 11.3-5b 11.3-6 1 1~3 7 11.3-7a 11.3-7b 11.3-8 11.3-9 T 11.3-1 Sh T 11.3-1 Sh T 11 3-2 Sh T 11.3-2 Sh T 11.3-3 Sh T 11 3-3 Sh F 11.3-1a F 11 3-lb F 11.3-1c F 11.3-2 11.4-1 11.4-1a 11.4-1b 11.4-2 11.4-2a 11.4-2b 11.4-3 11.4-3a 11.4-3b 11.4-4 11.4-4a-11.4-4b 11.4-5 11.4-6 T 11.4-1 T 11.4-2 T 11.4-3 Sh T 11 4-3 Sh T 11.4-3 Sh A03 A03 ROO A23 A05 A23 A23 R02 R04 A05 A24 A09 R04 A09 A12 A12 A12 AOO ROO ROO A12 A12 R04 R04 ROO R04 A03 A03 A03 ROO ROO A08 ROO Rol ROO ROO Rol A23 Rol ROO Rol ROO A26 A26 AOO USAR Revision 4 EP 11-1 October 1992 V II Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 11 PAGES Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T 11 4-3 Sh 4 T 11.4-3 Sh 5 T 11.4-4 Sh 1 T 11.4-4 Sh 2 T 11.4-5 T 11.4-6 T 11.4-7 F 11.4-1a F 11.4-1b F 11.4-1c F 11.4-1d F 11.4-1e F 11.4-1f F 11.4-1g F 11.4-1h 11.5-1 11.5-2 11.5-2a 11.5-2b 11.5-3 11.5-3a 11.5-3b 11.5 4 11.5-5 11.5-5a 11.5-5b 11.5-6 11.5-7 11.5-8 11.5-9 11.5-10 11.5-10a 11.5-10b 11.5.-11 11.5-11a 11.5-11b 11.5-12 11.5-12a 11.5-12b 11.5-13 11.5-14 T 11.5-1 Sh 1 T 11.5-1 Sh 2 T 11.5-1 Sh 2a T 11.5-2 Sh 1 A26 A26 R04 R04 A08 A08 A08 R01 R03 ROO ROO ROO ROO ROO ROO A23 A23 ROO A23 A23 A23 A23 A23 A23 A23 A23 A23 R04 A23 A23 A23 A23 A23 R01 A25 A23 A23 A07 A07 A28 A23 ROO ROO ROO AOO T 11 5-2 Sh 2 T 11.5-2 Sh 3 T 11.5-2 Sh 4 F 11.5-1 F 11.5-2 F 11.5-3a F 11.5-3b F 11.5-3c F 11.5-3d F 11.5-4 F 11.5-5 F 11.5-6 F 11.5-7 F 11.5-8 Sh 1 F 11.5-8 Sh 2 App 11A 11A-i llA-ii 11A.1-1 11A.1-2 T llA.l-l T 11A.1-2 T 11A.1-3 T 11A.1-4 T 11A.1-5 T llA.1-6 T llA.1-7 T 11A.1-8 T 11A.1-9 T 11A.1-10 T 11A.1-11 T 11A.1-12 T 11A.1-13 T 11A.1-14 T 11A.1-15 T 11A.1-16 T 11A.1-17 T 11A.1-18 T 11A.1-19 11A.2-1 11A.2-2 T 11A.2-1 T 11A.2-2 AOO ROO AOO ROO ROO R03 ROO ROO R03 A23 AOO R04 ROO AOO AOO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO AOO ROO AOO AOO AOO AOO AOO A25 A25 A25 AOO ROO ROO ROO ROO AOO ROO ROO USAR Revision 4 EP 11-2 October 1992 F 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page T=Table F=FBFur e Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 12-i 12 ii 12-lii 12-iv 12-iva 12-ivb 12-v 12-vi 12-vii 12-viia 12-viib 12-viii 12-ix 12-x 12-xi 12-xii 12.1-1 12'-2 12 F 1-3 12'-4 12.1-5 12.1-6 12'-7 12.1-8 12'-9 12.1-9a 12.1-9b 12.1-10 12.1-11 12.1-12 12.1-13 12.1-13a 12.1-13b 12.1-14 12.1-14a 12'-14b 12.1-15 12.2-1 12.2-1a 12.2-1b 12.2-2 12'-3 12.2-4 12.2-5 R03 A24 ROO R03 A24 A12 R03 R01 A24 A24 A24 R02 R02 ROO ROO ROO R03 R03 AOO AOO R03 ROO R03 R03 R03 A09 A09 AOO AOO AOO A07 A07 A07 A07 A07 A07 AOO A11 All A11 AOO A11 A11 ROO 12.2-6 1 2~2 7 12.2-8 12.2-8a 12.2-8b 12.2-9 12.2-10 12.2-11 12.2-12 12.2-13 12.2-14 12.2-15 12.2-16 T 12.2-1 T 12.2-2 T 12.2-3 T 12.2-4 Sh 1 T 12.2-4 Sh 2 T 12.2-4 Sh 3 T 12.2-5 Sh 1 T 12.2-5 Sh 2 T 12.2-6 Sh 1 T 12.2-6 Sh 2 T 12.2-6 Sh 3 T 12.2-7 Sh 1 T 12.2-7 Sh 2 T 12.2-8 Sh 1 T 12.2-8 Sh 2 T 12.2-9 T 12.2-10 Sh 1 T 12.2-10 Sh 2 T 12.2-10 Sh 3 T 12.2-11 T 12.-2-12 Sh 1 T 12.2-12 Sh 2 T 12.2-12 Sh 3 T 12.2-13 Sh 1 T 12.2-13 Sh 2 T 12.2-13 Sh 3 T 12.2-14 T 12.2-15a T 12.2-15b T 12.2-16 1 2~3 1 1 2~3 2 AOO R02 A09 A09 A09 R03 A25 R04 A07 A07 A09 A09 A11 ROO ROO ROO ROO ROO R01 A09 A09 R01 ROO AOO ROO R01 AOO AOO R01 R01 R01 R01 AOO R01 R01=R01 R01 R01 ROO A07 ROO ROO A11 AOO AOO 1 2~3 3 12.3-4 12.3-5 12.3-6 12~3 7 12~3 7a 12.3-7b 12.3-8 12.3-9 12.3-10 12.3-11 12.3-11a1 12.3-11b1 12.3-11a 12.3-11b 12.3-11c 12.3-11d 12.3-11e 12.3-11f 12.3-12 12.3-13 12.3-14 12.3-15 12.3-15a 12.3-15b 12.3-16 12.3-17 12.3-18 12.3-19 12.3-20 12.3-21 12 3-22 12 e 3 23 12.3-23a 12'-23b 12.3-24 12.3-25 12.3-26 12.3-27 12.3-28 12.3-29 12.3-30 12.3-30a 12.3-30b 12~3-3 1 12.3-31a AOO ROO AOO AOO ROO ROO ROO AOO R02 R04 R03 R02 A20 A13 A13 ROO ROO ROO A13 ROO R02 AOO R02 A05 A05 AOO AOO A01 AOO R01 AOO A10 A10 A10 A10 ROO A10 AOO AOO A10 ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 12-1'ctober 1992 e~
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER12PageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number12.3-31b12~33212~333T12'-1Sh1T12.3-1Sh2T12'-1Sb3T12.3-1S114T12.3-2Sh1T12.3-2Sh2T12.3-2S113T12'-3Sb1T12'-3S112T12.3-4S?I1T123-4S?12T12'-4S?13T12.3-4S?14F12'-1F12.3-2F12.3-3F12.3-4F12.3-5F12.3-6F12.3-7F12.3-8F12.3-9F12.3-10F12.3-11F12.3-12F12.3-13F12.3-14F'12.3-15F12.3-16F.12.3-17F12.3-18F12.3-19F12.3-20F12.3-21F12.3-22F12'-23F12'-24F12.3-25F12.3-26F12.3-27F12.3-28F12.3-29F12.3-30ROOROOAOOROOROOA24R01ROOROOROOROOROOR01R01ROOROOR03R02R03R02R02R02R02R02R03R02R02R02R02R03R02R02R04R02R02R02R03R02R02R02R02R02R02R02R02R03F12.3-30aF12.3-31F12.3-32F12.3-33F12.3-34F12.3-35F12.3-36F12.3-37F12.3-38F12.3-39F12'-40F12.3-41F12.3-42F'2.3-43F123-44F12.3-45F12.3-46F12.3-47F12.3-48F12.3-49F12'-50F12.3-51F12.3-52F12.3-53F12.3-54F12.3-55F12.3-56F12.3-57F12.3-58F12.3-59F12.3-60F12.3-61F12.3-62F12.3-63F12.3-63aF12.3-64F12.3-65F12.3-66F12.3-67F12.3-68F12.3-69S?11F12.3-69S?12F12.3-69Sh3F12.3-69S?1412.4-1R02R02R02R02R03R02R03R02R02R02R02R02R03R02R02R02R02R03R02R02R04R02R02R02R03R02R02R02R02R02R02R02R02R03R02R02R02R02ROOAOOROOROOROOR03ROO12.4-1a12.4-1b12.4-1c12.4-1d12.4-212.4-2a12.4-2b12.4-3T12'-1T12.4-2T124-3T12.4-4T12.4-5T12.4-6T12'-7S?11T12.4-7S?12T12.4-8T124-9T12.4-10T12.4-11T12.4-12T12.4-1312.5-112.5-212.5-312.5-412.5-512.5-612.5-712.5-7a12.5-7b12.5-812.5-912.5-1012.5-1112.5-1212.5-1312.5-1412.5-14a12.5-14b12.5-1512.5-1612.5-1712.5-1812.5-19A15ROOA24A15A12A12A12ROOROOROOROOROOROOA20A20A20A20A20ROOA20A15A15R03R03A26R01ROOAOOA01R04A01AOOR04A01AOOAOOR03R03A05A05R04R03R03ROOR03USARRevision4EP12-2October1992 P~
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 12.3-31b 12~3 32 12~3 33 T 12'-1 Sh 1 T 12.3-1 Sh 2 T 12'-1 Sb 3 T 12.3-1 S11 4 T 12.3-2 Sh 1 T 12.3-2 Sh 2 T 12.3-2 S11 3 T 12'-3 Sb 1 T 12'-3 S11 2 T 12.3-4 S?I 1 T 12 3-4 S?1 2 T 12'-4 S?1 3 T 12.3-4 S?1 4 F 12'-1 F 12.3-2 F 12.3-3 F 12.3-4 F 12.3-5 F 12.3-6 F 12.3-7 F 12.3-8 F 12.3-9 F 12.3-10 F 12.3-11 F 12.3-12 F 12.3-13 F 12.3-14 F'12.3-15 F 12.3-16 F.12.3-17 F 12.3-18 F 12.3-19 F 12.3-20 F 12.3-21 F 12.3-22 F 12'-23 F 12'-24 F 12.3-25 F 12.3-26 F 12.3-27 F 12.3-28 F 12.3-29 F 12.3-30 ROO ROO AOO ROO ROO A24 R01 ROO ROO ROO ROO ROO R01 R01 ROO ROO R03 R02 R03 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 R03 R02 R02 R04 R02 R02 R02 R03 R02 R02 R02 R02 R02 R02 R02 R02 R03 F 12.3-30a F 12.3-31 F 12.3-32 F 12.3-33 F 12.3-34 F 12.3-35 F 12.3-36 F 12.3-37 F 12.3-38 F 12.3-39 F 12'-40 F 12.3-41 F 12.3-42 F'2.3-43 F 12 3-44 F 12.3-45 F 12.3-46 F 12.3-47 F 12.3-48 F 12.3-49 F 12'-50 F 12.3-51 F 12.3-52 F 12.3-53 F 12.3-54 F 12.3-55 F 12.3-56 F 12.3-57 F 12.3-58 F 12.3-59 F 12.3-60 F 12.3-61 F 12.3-62 F 12.3-63 F 12.3-63a F 12.3-64 F 12.3-65 F 12.3-66 F 12.3-67 F 12.3-68 F 12.3-69 S?1 1 F 12.3-69 S?1 2 F 12.3-69 Sh 3 F 12.3-69 S?1 4 12.4-1 R02 R02 R02 R02 R03 R02 R03 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 R03 R02 R02 R04 R02 R02 R02 R03 R02 R02 R02 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 ROO AOO ROO ROO ROO R03 ROO 12.4-1a 12.4-1b 12.4-1c 12.4-1d 12.4-2 12.4-2a 12.4-2b 12.4-3 T 12'-1 T 12.4-2 T 12 4-3 T 12.4-4 T 12.4-5 T 12.4-6 T 12'-7 S?1 1 T 12.4-7 S?1 2 T 12.4-8 T 12 4-9 T 12.4-10 T 12.4-11 T 12.4-12 T 12.4-13 12.5-1 12.5-2 12.5-3 12.5-4 12.5-5 12.5-6 12.5-7 12.5-7a 12.5-7b 12.5-8 12.5-9 12.5-10 12.5-11 12.5-12 12.5-13 12.5-14 12.5-14a 12.5-14b 12.5-15 12.5-16 12.5-17 12.5-18 12.5-19 A15 ROO A24 A15 A12 A12 A12 ROO ROO ROO ROO ROO ROO A20 A20 A20 A20 A20 ROO A20 A15 A15 R03 R03 A26 R01 ROO AOO A01 R04 A01 AOO R04 A01 AOO AOO R03 R03 A05 A05 R04 R03 R03 ROO R03 USAR Revision 4 EP 12-2 October 1992 P~
NineMilePaintUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER12PagePagePageT=Table.Amendment T=TableAmendment, T=TableAmendment F=FicFure NumberF~FicFure NumberF=FicFure Number12.5-20T12.5-1T12.5-2T12.5-3T12.5-4A26R01ROOA05A01USARRevision4EP12-3October1992
Nine Mile Paint Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page Page Page T=Table.Amendment T=Table Amendment, T=Table Amendment F=FicFure Number F~FicFure Number F=FicFure Number 12.5-20 T 12.5-1 T 12.5-2 T 12.5-3 T 12.5-4 A26 R01 ROO A05 A01 USAR Revision 4 EP 12-3 October 1992
~t NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER13PageT=TableF=FictureAmendment NumberPageT=TableAmendment FFicrureNumberPageT=TableAmendment F=FicFure Number13-i131113-iii13-iv13-iva13-ivb13-v13-vi13-vii13-viii13~1113.1-213.1-2a13.1-2b13'-313'-3a13.1-3b131-413.1-4a13.1-4b13.1-513.1-5a13.1-5b13.1-6T13'-1T13.1-2T13'-3T1301-3T13.1-3T1301-3T13.1-3T13.1-3T13'-3T13.1-3T13~13T13~1-3T13.1-4T131-4T13.1-4T13.1-4T13.1-4T13.1-5F13.1-1F13.1-1aF13.1-2ShShshShShShShshshShShShshShSh1234567891012345ROOROOROOR03ROOA09R04ROOR03R03A28R03R03A09R03R03A09ROOROOA01R03R03A09A28R03R04R04R04R04R03R03R03R03R03R03R04R03R03R03R03R03A28R03R03R03F13'-3F13.1-3aF13.1-4F13.1-4aF13.1-5F13.1-5aF13.1-5bF13.1-6F13.1-7F13'-8F13.1-9F13.1-1013~2113.2-21302-313.2-413.2-513.2-613~2713.2-813.2-913.2-1013.2-1113.2-1213~21313.2-1413.2-1513.2-1613.2-1713.2-1813.2-1913.2-2013.2-2113.2-2213~22313.2-2413.2-2513.2-2613.2-2713.2-2813.2-2913.2-3013'-3113.2-3213'-33R04R03R03R03R03A13R03R03R03R03R03R03R03ROOROOROOR03ROOR03ROOR03R03R03R03ROOR03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03ROOR03ROOR0313.2-3413.2-3513.2-3613~23713.2-3813.2-3913'-40T13'-1F13.2-113~3113~3213.4-113.4-213.4-2a13.4-2b13.4-313.4-4T13.4-1T13.4-2ShT13.4-2ShT13.4-2ShT13.4-3ShT13.4-3ShT13.4-3ShF13.4-113.5-113.5-213.5-313.5-3a13.5-3b13.5-413.5-4a13.5-4b13.5-513.5-613.5-7T13.5-1ShT13.5-1ShT13.5-2T13.5-3.sh T13.5-3ShT13'-3ShT13.5-4ROOROOROOROOR03R03ROOROOA28ROOROOR03R04R04R03R04ROO.R03ROOR03R03R03R03R03R04R03R03R03R03A06R03A06.A06R03R03R03R03R03R03R03R03R03R03USARRevision4EP13-1October1992 r
~t Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table F=Fictu re Amendment Number Page T=Table Amendment F Ficrure Number Page T=Table Amendment F=FicFure Number 13-i 13 11 13-iii 13-iv 13-iva 13-ivb 13-v 13-vi 13-vii 13-viii 1 3~1 1 13.1-2 13.1-2a 13.1-2b 13'-3 13'-3a 13.1-3b 13 1-4 13.1-4a 13.1-4b 13.1-5 13.1-5a 13.1-5b 13.1-6 T 13'-1 T 13.1-2 T 13'-3 T 1301-3 T 13.1-3 T 1301-3 T 13.1-3 T 13.1-3 T 13'-3 T 13.1-3 T 1 3~1 3 T 13~1-3 T 13.1-4 T 13 1-4 T 13.1-4 T 13.1-4 T 13.1-4 T 13.1-5 F 13.1-1 F 13.1-1a F 13.1-2 Sh Sh sh Sh Sh Sh Sh sh sh Sh Sh Sh sh Sh Sh 1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 ROO ROO ROO R03 ROO A09 R04 ROO R03 R03 A28 R03 R03 A09 R03 R03 A09 ROO ROO A01 R03 R03 A09 A28 R03 R04 R04 R04 R04 R03 R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 R03 A28 R03 R03 R03 F 13'-3 F 13.1-3a F 13.1-4 F 13.1-4a F 13.1-5 F 13.1-5a F 13.1-5b F 13.1-6 F 13.1-7 F 13'-8 F 13.1-9 F 13.1-10 1 3~2 1 13.2-2 1302-3 13.2-4 13.2-5 13.2-6 1 3~2 7 13.2-8 13.2-9 13.2-10 13.2-11 13.2-12 13~2 13 13.2-14 13.2-15 13.2-16 13.2-17 13.2-18 13.2-19 13.2-20 13.2-21 13.2-22 13~2 23 13.2-24 13.2-25 13.2-26 13.2-27 13.2-28 13.2-29 13.2-30 13'-31 13.2-32 13'-33 R04 R03 R03 R03 R03 A13 R03 R03 R03 R03 R03 R03 R03 ROO ROO ROO R03 ROO R03 ROO R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 ROO R03 13.2-34 13.2-35 13.2-36 13~2 37 13.2-38 13.2-39 13'-40 T 13'-1 F 13.2-1 13~3 1 13~3 2 13.4-1 13.4-2 13.4-2a 13.4-2b 13.4-3 13.4-4 T 13.4-1 T 13.4-2 Sh T 13.4-2 Sh T 13.4-2 Sh T 13.4-3 Sh T 13.4-3 Sh T 13.4-3 Sh F 13.4-1 13.5-1 13.5-2 13.5-3 13.5-3a 13.5-3b 13.5-4 13.5-4a 13.5-4b 13.5-5 13.5-6 13.5-7 T 13.5-1 Sh T 13.5-1 Sh T 13.5-2 T 13.5-3.sh T 13.5-3 Sh T 13'-3 Sh T 13.5-4 ROO ROO ROO ROO R03 R03 ROO ROO A28 ROO ROO R03 R04 R04 R03 R04 ROO.R03 ROO R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 A06 R03 A06.A06 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 USAR Revision 4 EP 13-1 October 1992 r
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER13PageT=TableAmendment F=FicrureNumberPageT=TableAmendment F=Ficrure NumberPageT=TableAmendment FFicrureNumberT13~5-5T13'-6SB1T13.5-6Sh2T135-6Sh3T13.5-6S114T13.5-6Sh5T13.5-7F13.5-113.6-1App13A13A-113A-213A-313A-413A-513A-613A-713A-813A-913A-1013A-1113A-12'3A-1313A-1413A-14a13A-14b13A-14c13A-14d13A-14e13A-14f13A-14g13A-142113A-14i13A-14j13A-14k13A-14L13A-14m13A-14n13A-14o13A-14p13A-14'3A-14r 13A-14s13A-14tA22A23ROOROOR02R03R03AOOR04AOOAOOA16A16A16AOOAOOAOOAOOAOOAOOAOOAOOA16A16A16A17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A1713A-14u13A-14v13A-1513A-1613A-1713A-1813A-1913A-19a13A-19b13A-2013A-2113A-2213A-2313A-2413A-2513A-2613A-2713A-28'3A-29 13A-3013A-3113A-3213A-3313A-3413A-3513A-3613A-3713A-3813A-3913A-4013A-4113A-41a13A-41b13A-4213A-4313A-43a13A-43b13A-43c13A-43d13A-4413A-4513A-4613A-4713A-4813A-4913A-50A17A17A16A16A16A16A16A16A16AOOAOOAOOAOOAOOAOOA16A16AOOAOOAOOAOOAOOAOOAOOA16A16A16A16A16A16A16A16A16A16A16A16A16A16A16AOOAOOA16A16A16A16AOO13A-5113A-5213A-5313A-5413A-5513A-5613A-5713A-5813A-5913A-6013A-6113A-6213A-6313A-6413A-6513A-6613A-6713A-6813A-68a13A-68b13A-68c13A-68d13A-6913A-7013A-7113A-7213A-72a13A-72b13A-72c13A-72d13A-72e13A>>72f13A-72g13A-72?113A-72i13A-72j13A-72k13A-72L13A-72m13A-72n13A-72o13A-72p13A-7313A-7413A-74a13A-74bAOOAOOAOOAOOAOOA16A16A16A16A16A16A16A16A16A16A16A16A16A09A09A17A17AOOA16A16AOOA17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A17A16A16A16A16USARRevision4EP13-2October1992 Ip NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER13PageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure Number13A-7513A-7613A-7713A-7813A-7913A-8013A-8113A-8213A-8313A-83a13A-83b13A-8413A-8513A-8613A-8713A-8813A-8913A-9013A-9113A-9213A-9313A-9413A-9513A-9613A-9713A-9813A-9913A-10013A-10113A-10213A-10313A-10413A-10513A-10613A-10713A-10813A-10913A-11013A-11113A-11213A-112a13A-112b13A-11313A-11413A-11513A-116A16A16A16AOOA16A16A16A16A16A16A16A16A16A16A16A16A16A16A16A16A16A16A16AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA16A16A16A16A16AOOAOOAOOAOO13A-11713A-11813A-11913A-12013A-12113A-12213A-12313A-12413A-124a13A-124b13A-124c13A-124d13A-12513A-12613A-12713A-12813A-12913A-129a13A-129b13A-129c13A-129d13A-129e13A-129f13A-129g13A-129'3A-129i 13A-129j13A-129k13A-129L13A-13013A-130a13A-130b13A-13113A-13213A-13313A-13413A-13513A-13613A-137App13B13B-1AOOA16A16A16A16A16A16A16A16A16A16A16AOOAOOAOOAOOAOOA17A17A17A17A17A17A17A17A17A17A17A17A16A16A16AOOAOOAOOA16A16A16A16AOOAOOUSARRevision4EP13-3October1992 06 NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER14PAGESPageT=TableF=FicFure Amendment NumberPageT=TableF=Ficpure Amendment NumberPageT=TableF=FicFureAmendment Number14-i14-ii14-iia14-iib14-11114-iv14-v14-vi14-vii14-viii14-ix14-x14-xl14-xia14-xib14-xll14.1-114.2-114.2-214'-314.2-414.2-514.2-614.2-714.2-814.2-914.2-1014.2-1114.2-1214.2-1314.2-1414.2-1514.2-1614.2-1714.2-1814.2-1914.2-2014.2-2114'-2214'-2314.2-2414.2-2514.2-2614.2-27A28A22~A28A22ROOROOROOROOROOROOROOA28ROOA28A16ROOAOOA22A22A22A22A28A25ROOROOA25ROOA28ROOA22ROOA22ROOA22A22.A22ROOA22A22ROOA22ROOROOA2214.2-2814.2-2914'-3014.2-3114.2-31a14'-31b14'-3214.2-3314.2-3414'-3514.2-3614.2-37T14.2-1Sh1"T14.2-1Sh2T14-2-1Sh3T14.2-1Sh4T14.2-1Sh5T14.2-1Sh6T14.2-1aSh1T14.2-1aSh2T14.2-laSh3T14.2-1aSh4T14.2-1bSh1T14.2-1bSh2T14.2-1bSh3T14.2-1bSh4F14.2-lb-1 T14.2-2Sh1T14.2-2Sh2T14.2-3Sh1T14.2-3Sh2T14.2-4T14.2-5Sh1T14.2-5Sh2T14.2-6T14.2-7Sh1T14.2-7Sh2T14.2-8Sh1T14.2-8Sh2T14.2-9Sh1T14.2-9Sh2T14.2-10Sh1T14.2-10Sh2T14.2-11Sh1T14.2-11Sh2T14.2-12Sh1A22R01ROOA28A28A28R01A28A28ROOROOA28ROOROOROOROOROOA22ROOROOROOROOROOROOROOROOROOA22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT14.2-1214.2-1314.2-1314.2-1414.2-1514.2-1514.2-1614.2-1614.2-1714.2-1714.2-1814.2-1914.2-1914'-2014.2-2014.2-2114.2-2114.2-2214.2-2214'-2314.2-2314.2-2414.2-2514.2-2514.2-2614.2-2614.2-2714.2-2714.2-2814.2-2814.2-2914'-2914.2-3014.2-3014.2-31142-3114'-3214.2-3214'-3314.2-3314.2-3414.2-3414'-3514'-3514'-3614.2-36ShShShShShShShshShShShShShShShShShShShShShShshshShshShShShShShShShShShShShShShShShShShA22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A24A22A22A22A24A22A24A22A24A22A24A22A24A22A24A22A25A25A24A22A22A22A24A22USARRevision4EP14-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table Amendment F=F icrure Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Ficrure Number T 13~5-5 T 13'-6 SB 1 T 13.5-6 Sh 2 T 13 5-6 Sh 3 T 13.5-6 S11 4 T 13.5-6 Sh 5 T 13.5-7 F 13.5-1 13.6-1 App 13A 13A-1 13A-2 13A-3 13A-4 13A-5 13A-6 13A-7 13A-8 13A-9 13A-10 13A-11 13A-12'3A-13 13A-14 13A-14a 13A-14b 13A-14c 13A-14d 13A-14e 13A-14f 13A-14g 13A-1421 13A-14i 13A-14j 13A-14k 13A-14L 13A-14m 13A-14n 13A-14o 13A-14p 13A-14'3A-14r 13A-14s 13A-14t A22 A23 ROO ROO R02 R03 R03 AOO R04 AOO AOO A16 A16 A16 AOO AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 13A-14u 13A-14v 13A-15 13A-16 13A-17 13A-18 13A-19 13A-19a 13A-19b 13A-20 13A-21 13A-22 13A-23 13A-24 13A-25 13A-26 13A-27 13A-28'3A-29 13A-30 13A-31 13A-32 13A-33 13A-34 13A-35 13A-36 13A-37 13A-38 13A-39 13A-40 13A-41 13A-41a 13A-41b 13A-42 13A-43 13A-43a 13A-43b 13A-43c 13A-43d 13A-44 13A-45 13A-46 13A-47 13A-48 13A-49 13A-50 A17 A17 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO AOO A16 A16 AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO A16 A16 A16 A16 AOO 13A-51 13A-52 13A-53 13A-54 13A-55 13A-56 13A-57 13A-58 13A-59 13A-60 13A-61 13A-62 13A-63 13A-64 13A-65 13A-66 13A-67 13A-68 13A-68a 13A-68b 13A-68c 13A-68d 13A-69 13A-70 13A-71 13A-72 13A-72a 13A-72b 13A-72c 13A-72d 13A-72e 13A>>72 f 13A-72g 13A-72?1 13A-72i 13A-72j 13A-72k 13A-72L 13A-72m 13A-72n 13A-72o 13A-72p 13A-73 13A-74 13A-74a 13A-74b AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A09 A09 A17 A17 AOO A16 A16 AOO A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A16 A16 A16 A16 USAR Revision 4 EP 13-2 October 1992 I p Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 13A-75 13A-76 13A-77 13A-78 13A-79 13A-80 13A-81 13A-82 13A-83 13A-83a 13A-83b 13A-84 13A-85 13A-86 13A-87 13A-88 13A-89 13A-90 13A-91 13A-92 13A-93 13A-94 13A-95 13A-96 13A-97 13A-98 13A-99 13A-100 13A-101 13A-102 13A-103 13A-104 13A-105 13A-106 13A-107 13A-108 13A-109 13A-110 13A-111 13A-112 13A-112a 13A-112b 13A-113 13A-114 13A-115 13A-116 A16 A16 A16 AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 AOO AOO AOO AOO 13A-117 13A-118 13A-119 13A-120 13A-121 13A-122 13A-123 13A-124 13A-124a 13A-124b 13A-124c 13A-124d 13A-125 13A-126 13A-127 13A-128 13A-129 13A-129a 13A-129b 13A-129c 13A-129d 13A-129e 13A-129f 13A-129g 13A-129'3A-129i 13A-129j 13A-129k 13A-129L 13A-130 13A-130a 13A-130b 13A-131 13A-132 13A-133 13A-134 13A-135 13A-136 13A-137 App 13B 13B-1 AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A16 A16 A16 AOO AOO AOO A16 A16 A16 A16 AOO AOO USAR Revision 4 EP 13-3 October 1992 0 6 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 14 PAGES Page T=Table F=FicFure Amendment Number Page T=Table F=Ficpure Amendment Number Page T=Table F=F icFure Amendment Number 14-i 14-ii 14-iia 14-iib 14-111 14-iv 14-v 14-vi 14-vii 14-viii 14-ix 14-x 14-xl 14-xia 14-xib 14-xll 14.1-1 14.2-1 14.2-2 14'-3 14.2-4 14.2-5 14.2-6 14.2-7 14.2-8 14.2-9 14.2-10 14.2-11 14.2-12 14.2-13 14.2-14 14.2-15 14.2-16 14.2-17 14.2-18 14.2-19 14.2-20 14.2-21 14'-22 14'-23 14.2-24 14.2-25 14.2-26 14.2-27 A28 A22~A28 A22 ROO ROO ROO ROO ROO ROO ROO A28 ROO A28 A16 ROO AOO A22 A22 A22 A22 A28 A25 ROO ROO A25 ROO A28 ROO A22 ROO A22 ROO A22 A22.A22 ROO A22 A22 ROO A22 ROO ROO A22 14.2-28 14.2-29 14'-30 14.2-31 14.2-31a 14'-31b 14'-32 14.2-33 14.2-34 14'-35 14.2-36 14.2-37 T 14.2-1 Sh 1"T 14.2-1 Sh 2 T 14-2-1 Sh 3 T 14.2-1 Sh 4 T 14.2-1 Sh 5 T 14.2-1 Sh 6 T 14.2-1a Sh 1 T 14.2-1a Sh 2 T 14.2-la Sh 3 T 14.2-1a Sh 4 T 14.2-1b Sh 1 T 14.2-1b Sh 2 T 14.2-1b Sh 3 T 14.2-1b Sh 4 F 14.2-lb-1 T 14.2-2 Sh 1 T 14.2-2 Sh 2 T 14.2-3 Sh 1 T 14.2-3 Sh 2 T 14.2-4 T 14.2-5 Sh 1 T 14.2-5 Sh 2 T 14.2-6 T 14.2-7 Sh 1 T 14.2-7 Sh 2 T 14.2-8 Sh 1 T 14.2-8 Sh 2 T 14.2-9 Sh 1 T 14.2-9 Sh 2 T 14.2-10 Sh 1 T 14.2-10 Sh 2 T 14.2-11 Sh 1 T 14.2-11 Sh 2 T 14.2-12 Sh 1 A22 R01 ROO A28 A28 A28 R01 A28 A28 ROO ROO A28 ROO ROO ROO ROO ROO A22 ROO ROO ROO ROO ROO ROO ROO ROO ROO A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-12 14.2-13 14.2-13 14.2-14 14.2-15 14.2-15 14.2-16 14.2-16 14.2-17 14.2-17 14.2-18 14.2-19 14.2-19 14'-20 14.2-20 14.2-21 14.2-21 14.2-22 14.2-22 14'-23 14.2-23 14.2-24 14.2-25 14.2-25 14.2-26 14.2-26 14.2-27 14.2-27 14.2-28 14.2-28 14.2-29 14'-29 14.2-30 14.2-30 14.2-31 14 2-31 14'-32 14.2-32 14'-33 14.2-33 14.2-34 14.2-34 14'-35 14'-35 14'-36 14.2-36 Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A25 A25 A24 A22 A22 A22 A24 A22 USAR Revision 4 EP 14-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER14PageT='TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh214.2-3714.2-3714.2-3814.2-3814'-3914.2-39142-4014.2-4014.2-4114'-4114.2-4214.2-4214.2-4314.2-4314~2-43A14.2-4414.2-4414'-4514.2-4514.2-4614.2-4614.2-4714.2-4714.2-4814'-4814'-4914.2-4914'-5014.2-5014.2-5114.2-5114.2-5214.2-5214.2-5314.2-5314.2-5414.2-5414.2-5514'-5514.2-5614.2-5614'-5714'-5714.2-5814'-5814.2-43AA22A22A24A22A24A22A24A22A28A28A24A22A24A22ROOA26A24A22A22A22A24A22A24A26A24A22A24A22A24A22A24A22A24A22A24A22A24A22A24A22A24A22A24A22A24A22TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT14.2-5914.2-5914.2-6014.2-6014'-6114.2-6114.2-6214.2-6214.2-6314.2-6314.2-6414.2-6414.2-6514.2-6514.2-6614.2-6614.2-6714.2-6714.2-6814.2-6814.2-6914.2-6914.2-7014.2-7014.2-7114.2-7114.2-7214.2-7214.2-7314.2-7314.2-7414.2-7414.2-7514.2-7514.2-7614.2-7614.2-7714.2-7714.2-7814.2-7814.2-7914.2-7914.2-8014.2-8014.2-8114.2-81Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2A24A22A24A22A24A22A24A22A28A28A24A22A24A22A22A22A24A22A24A22A24A22A22A22A24A22A24A22A25A25A26A26A24A22A26A22A24A28A24A22A24A22A24A22A24A22T142-82Sh1T14.2-82Sh2T14'-83Sh1T14.2-83Sh2T14.2-84Sh1T14.2-84Sh2T14.2-85Sh1T14.2-85Sh2T14.2-86Sh1T14.2-86Sh2T14.2-87Sh1T14.2-87Sh2T14.2-88Sh1T14'-88Sh2T14.2-89Sh1T14'-89Sh2T14.2-90Sh1T14.2-90Sh2T14.2-91Sh1T14.2-91Sh2T14.2-92Sh1T14.2-92Sh2T14.2-93Sh1T142-93Sh2T14.2-94Sh1T14.2-94Sh2T14.2-95Sh1T14.2-95Sh2T14.2-96Sh1T142-96Sh2T14.2-97Sh1T14.2-97Sh2T14.2-98Sh1T14.2-98Sh2T14'-99Sh1T14.2-99Sh2T142-100Sh1T14.2-100Sh2T14.2-101Sh1T14.2-101Sh2T14.2-102Sh1T14.2-102Sh2T14.2-103Sh1T14.2-103Sh2T14.2-104Sh1T14.2-104Sh2A24A22A22A22A22A22A22A22A24A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A22A24A22A22A22A22A22A22A22A22A22A24A22A24A24A24A26A24A22A24A22USARRevisionEP14-2October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T='Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 14.2-37 14.2-37 14.2-38 14.2-38 14'-39 14.2-39 14 2-40 14.2-40 14.2-41 14'-41 14.2-42 14.2-42 14.2-43 14.2-43 14~2-43A 14.2-44 14.2-44 14'-45 14.2-45 14.2-46 14.2-46 14.2-47 14.2-47 14.2-48 14'-48 14'-49 14.2-49 14'-50 14.2-50 14.2-51 14.2-51 14.2-52 14.2-52 14.2-53 14.2-53 14.2-54 14.2-54 14.2-55 14'-55 14.2-56 14.2-56 14'-57 14'-57 14.2-58 14'-58 14.2-43A A22 A22 A24 A22 A24 A22 A24 A22 A28 A28 A24 A22 A24 A22 ROO A26 A24 A22 A22 A22 A24 A22 A24 A26 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-59 14.2-59 14.2-60 14.2-60 14'-61 14.2-61 14.2-62 14.2-62 14.2-63 14.2-63 14.2-64 14.2-64 14.2-65 14.2-65 14.2-66 14.2-66 14.2-67 14.2-67 14.2-68 14.2-68 14.2-69 14.2-69 14.2-70 14.2-70 14.2-71 14.2-71 14.2-72 14.2-72 14.2-73 14.2-73 14.2-74 14.2-74 14.2-75 14.2-75 14.2-76 14.2-76 14.2-77 14.2-77 14.2-78 14.2-78 14.2-79 14.2-79 14.2-80 14.2-80 14.2-81 14.2-81 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 A24 A22 A24 A22 A24 A22 A24 A22 A28 A28 A24 A22 A24 A22 A22 A22 A24 A22 A24 A22 A24 A22 A22 A22 A24 A22 A24 A22 A25 A25 A26 A26 A24 A22 A26 A22 A24 A28 A24 A22 A24 A22 A24 A22 A24 A22 T 14 2-82 Sh 1 T 14.2-82 Sh 2 T 14'-83 Sh 1 T 14.2-83 Sh 2 T 14.2-84 Sh 1 T 14.2-84 Sh 2 T 14.2-85 Sh 1 T 14.2-85 Sh 2 T 14.2-86 Sh 1 T 14.2-86 Sh 2 T 14.2-87 Sh 1 T 14.2-87 Sh 2 T 14.2-88 Sh 1 T 14'-88 Sh 2 T 14.2-89 Sh 1 T 14'-89 Sh 2 T 14.2-90 Sh 1 T 14.2-90 Sh 2 T 14.2-91 Sh 1 T 14.2-91 Sh 2 T 14.2-92 Sh 1 T 14.2-92 Sh 2 T 14.2-93 Sh 1 T 14 2-93 Sh 2 T 14.2-94 Sh 1 T 14.2-94 Sh 2 T 14.2-95 Sh 1 T 14.2-95 Sh 2 T 14.2-96 Sh 1 T 14 2-96 Sh 2 T 14.2-97 Sh 1 T 14.2-97 Sh 2 T 14.2-98 Sh 1 T 14.2-98 Sh 2 T 14'-99 Sh 1 T 14.2-99 Sh 2 T 14 2-100 Sh 1 T 14.2-100 Sh 2 T 14.2-101 Sh 1 T 14.2-101 Sh 2 T 14.2-102 Sh 1 T 14.2-102 Sh 2 T 14.2-103 Sh 1 T 14.2-103 Sh 2 T 14.2-104 Sh 1 T 14.2-104 Sh 2 A24 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A24 A24 A24 A26 A24 A22 A24 A22 USAR Revision EP 14-2 October 1992
~\~1 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER14PageT=TableFFicFureAmendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableF=FicFure Amendment NumberTTTTTTTTTTTT14.2-10514.2-10514.2-10614.2-10614.2-10714.2-10714.2-10814.2-10814.2-10914.2-10914.2-11014.2-110T14.2-111TTTTTTTTTTTTTTTTTTTTTTTTTTTTT14.2-11114.2-11214.2-11214.2-11314.2-11314.2-11414'-11414.2-115142-11514.2-11614.2-11714.2-11714'-11814.2-11814.2-11914.2-11914.2-12014.2-120142-12114'-12114.2-12214.2-12214.2-12314.2-12314.2-12414.2-12414.2-12514'-12514.2-125T14.2-126T14.2-12614.2-12614.2-127Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh1Sh2Sh3Sh1Sh2A25A22A24A22A24A22A24A22A26A22A24A22A17A17A25A25A24A22A24A22A24A22A24A24A22A24A22A24A22A24A22A24A22A24A22A24A22A22A22A24A22A22A24A22Sh2aA22Sh1A22TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTFTTT14.2-12714.2-128142-12814.2-12914.2-12914.2-12914.2-13014'-13014.2-13114.2-13214.2-20114.2-20114.2-20214.2-20214.2-20314.2-20314.2-20414.2-20414.2-20514.2-20614.2-20614.2-20614.2-20614.2-20614.2-20614.2-20714.2-20714.2-20814.2-20814.2-20914.2-20914.2-21014.2-21014.2-21114.2-21114.2-21214.2-21214.2-21214.2-21314.2-21314.2-21314.2-213ShShShShshshShSh,ShShShshShShshShShShshShShShShshShShShShShShShShShshShShshShSh14.2-21414.2-215ShSh14.2-213-1 14.2-214Sh2A221A222A221A222A242aA281A222A22A24A261ROO2A221ROO2A281A082A281A222ROOA121A122ROO3ROO3aA283bA284A161A282A281A282A281A282ROO1ROO2A081A282A281A222ROO3A121ROO2ROO3ROO4ROOA081A122A221A28TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTF14~2-21714.2-21714.2-21814.2-21814~2-21914.2-21914.2-22014.2-22014.2-22114.2-22114.2-221142-22214.2-22214.2-22214.2-22314.2-22314.2-22414.2-22414.2-22514.2-22514'-22514'-22614.2-22614.2-22714'-22714'-22714.2-22814.2-22814.2-22914.2-23014.2-23014'-23014'-23114.2-23114.2-23114.2-23114.2-23214.2-23214.2-233ShShShShShShshShShshShShShShShShShShShShShShShShShShShShShShShShShShShShShSh14.2-233Sh14.2-233Sh14.2-233-1 14.2-215Sh14.2-216Sh14'-216Sh142-216A2121212121212312312121231212312123123412123A28A28R01A16ROOA28A22A28A08A28A28A28A28ROOA22ROOROOA16ROOA22A22A12A28A28A28ROOROOROOROOROOA28ROOA12A28A28A28A28ROOA28ROOA28A28A22ROOA16ROOUSARRevisionEP14-3October1992 T~
~\~1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T=Table F FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T 14.2-105 14.2-105 14.2-106 14.2-106 14.2-107 14.2-107 14.2-108 14.2-108 14.2-109 14.2-109 14.2-110 14.2-110 T 14.2-111 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-111 14.2-112 14.2-112 14.2-113 14.2-113 14.2-114 14'-114 14.2-115 14 2-115 14.2-116 14.2-117 14.2-117 14'-118 14.2-118 14.2-119 14.2-119 14.2-120 14.2-120 14 2-121 14'-121 14.2-122 14.2-122 14.2-123 14.2-123 14.2-124 14.2-124 14.2-125 14'-125 14.2-125 T 14.2-126 T 14.2-126 14.2-126 14.2-127 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 A25 A22 A24 A22 A24 A22 A24 A22 A26 A22 A24 A22 A17 A17 A25 A25 A24 A22 A24 A22 A24 A22 A24 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A22 A22 A24 A22 A22 A24 A22 Sh 2a A22 Sh 1 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F T T T 14.2-127 14.2-128 14 2-128 14.2-129 14.2-129 14.2-129 14.2-130 14'-130 14.2-131 14.2-132 14.2-201 14.2-201 14.2-202 14.2-202 14.2-203 14.2-203 14.2-204 14.2-204 14.2-205 14.2-206 14.2-206 14.2-206 14.2-206 14.2-206 14.2-206 14.2-207 14.2-207 14.2-208 14.2-208 14.2-209 14.2-209 14.2-210 14.2-210 14.2-211 14.2-211 14.2-212 14.2-212 14.2-212 14.2-213 14.2-213 14.2-213 14.2-213 Sh Sh Sh Sh sh sh Sh Sh, Sh Sh Sh sh Sh Sh sh Sh Sh Sh sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh 14.2-214 14.2-215 Sh Sh 14.2-213-1 14.2-214 Sh 2 A22 1 A22 2 A22 1 A22 2 A24 2a A28 1 A22 2 A22 A24 A26 1 ROO 2 A22 1 ROO 2 A28 1 A08 2 A28 1 A22 2 ROO A12 1 A12 2 ROO 3 ROO 3a A28 3b A28 4 A16 1 A28 2 A28 1 A28 2 A28 1 A28 2 ROO 1 ROO 2 A08 1 A28 2 A28 1 A22 2 ROO 3 A12 1 ROO 2 ROO 3 ROO 4 ROO A08 1 A12 2 A22 1 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F 14~2-217 14.2-217 14.2-218 14.2-218 14~2-219 14.2-219 14.2-220 14.2-220 14.2-221 14.2-221 14.2-221 14 2-222 14.2-222 14.2-222 14.2-223 14.2-223 14.2-224 14.2-224 14.2-225 14.2-225 14'-225 14'-226 14.2-226 14.2-227 14'-227 14'-227 14.2-228 14.2-228 14.2-229 14.2-230 14.2-230 14'-230 14'-231 14.2-231 14.2-231 14.2-231 14.2-232 14.2-232 14.2-233 Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 14.2-233 Sh 14.2-233 Sh 14.2-233-1 14.2-215 Sh 14.2-216 Sh 14'-216 Sh 14 2-216A 2 1 2 1 2 1 2 1 2 1 2 1 2 3 1 2 3 1 2 1 2 1 2 3 1 2 1 2 3 1 2 1 2 3 1 2 3 4 1 2 1 2 3 A28 A28 R01 A16 ROO A28 A22 A28 A08 A28 A28 A28 A28 ROO A22 ROO ROO A16 ROO A22 A22 A12 A28 A28 A28 ROO ROO ROO ROO ROO A28 ROO A12 A28 A28 A28 A28 ROO A28 ROO A28 A28 A22 ROO A16 ROO USAR Revision EP 14-3 October 1992 T~
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER14PageT=TableF=FicFure Amendment NumberPagePageT=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberTTTTTFTTTTTFTTTTTFTTTTTTTTTTTTTTTTTTTTTTT14.2-23414.2-23414'-234ShShSh14.2-23514'-23514'-23514'-236ShShShSh14.2-236Sh14.2-236-1 14.2-237Sh14.2-23714.2-23814.2-23914.2-239ShShSh14.2-239-1 14.2-24014'-24014.2-24114.2-24114.2-24114.2-241ShShShShShSh14.2-241a 14.2-241b 14.2-24214.2-24214.2-24314'-24314'-244ShShShShSh14.2-244Sh14.2-244'h 14.2-24514.2-24514.2-24514'-30114.2-30114.2-30214'-30314.2-303shShShshShShSh14'-234Sh14'-234Sh14.2-234-1 1234512312121212123412121231231212ROOROOROOA28A22A08A12A22A22ROOA28A22A28A28A22A28A28A08A28ROOA28ROOROOA22A22A22A08A28ROOROOA28A28A22A22A28A22ROOR01A28A28ROOT14.2-304T14.2-304T14.2-304T14'-304T14.2-304T14.2-305T14.2-305T14.2-306T14.2-307T14.2-401T14.2-402T14.2-402T14.2-402T14'-402T14.2-403F14.2-1F14.2-2F14.2-3F14.2-4F14.2-5F14.2-6F14.2-7Sh2aA28Sh2bA28Sh2cA28Sh2dA28Sh3A28Sh1A22Sh2A22A28A28A22Sh1A16Sh2A16Sh3A16Sh4A16A28A24A28A24A28ROOA22A1614.2-303sh2aROOTTT14.2-30314.2-30314.2-30414.2-304ShShShsh2bA283R011ROO2ROOUSARRevisionEP14-4October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T=Table F=FicFure Amendment Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T T T T T F T T T T T F T T T T T F T T T T T T T T T T T T T T T T T T T T T T T 14.2-234 14.2-234 14'-234 Sh Sh Sh 14.2-235 14'-235 14'-235 14'-236 Sh Sh Sh Sh 14.2-236 Sh 14.2-236-1 14.2-237 Sh 14.2-237 14.2-238 14.2-239 14.2-239 Sh Sh Sh 14.2-239-1 14.2-240 14'-240 14.2-241 14.2-241 14.2-241 14.2-241 Sh Sh Sh Sh Sh Sh 14.2-241a 14.2-241b 14.2-242 14.2-242 14.2-243 14'-243 14'-244 Sh Sh Sh Sh Sh 14.2-244 Sh 14.2-244'h 14.2-245 14.2-245 14.2-245 14'-301 14.2-301 14.2-302 14'-303 14.2-303 sh Sh Sh sh Sh Sh Sh 14'-234 Sh 14'-234 Sh 14.2-234-1 1 2 3 4 5 1 2 3 1 2 1 2 1 2 1 2 1 2 3 4 1 2 1 2 1 2 3 1 2 3 1 2 1 2 ROO ROO ROO A28 A22 A08 A12 A22 A22 ROO A28 A22 A28 A28 A22 A28 A28 A08 A28 ROO A28 ROO ROO A22 A22 A22 A08 A28 ROO ROO A28 A28 A22 A22 A28 A22 ROO R01 A28 A28 ROO T 14.2-304 T 14.2-304 T 14.2-304 T 14'-304 T 14.2-304 T 14.2-305 T 14.2-305 T 14.2-306 T 14.2-307 T 14.2-401 T 14.2-402 T 14.2-402 T 14.2-402 T 14'-402 T 14.2-403 F 14.2-1 F 14.2-2 F 14.2-3 F 14.2-4 F 14.2-5 F 14.2-6 F 14.2-7 Sh 2a A28 Sh 2b A28 Sh 2c A28 Sh 2d A28 Sh 3 A28 Sh 1 A22 Sh 2 A22 A28 A28 A22 Sh 1 A16 Sh 2 A16 Sh 3 A16 Sh 4 A16 A28 A24 A28 A24 A28 ROO A22 A16 14.2-303 sh 2a ROO T T T 14.2-303 14.2-303 14.2-304 14.2-304 Sh Sh Sh sh 2b A28 3 R01 1 ROO 2 ROO USAR Revision EP 14-4 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER15PAGESPageT=TableAmendment F=FBFureNumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number15-i15-ii15-iii15-iv15-v15-vi15-vii15-viii151X15-x15-xl15-xii15-xiii15-xiv15-xv15-xvl15-xvll15-xvl1115-xix15-xx15-xxi15-xxii15-xxiia15-xxiib15-xxiii15-xxiv15-xxv15-xxvi15-xxvii15'-115.0-1a15.0-1b15.0-215.0-315.0-415.0-515.0-615'-715.0-7a15.0-7b15'-815.0-915.0-9a15.0-9b15.0-10R03AOOAOOR03AOOROOA24A24AOOR03A06A24A12ROOAOOA18R03R03A24AOOA24ROOA18A18AOOAOOA22A24AOOR03R03R03AOOAOOAOOAOOAOOA06A06A06R01R03R03R02R0315.0-1115.0-11a15.0-11b15.0-11c15.0-11d15.0-12T15'-1T15.0-1T15.0-1T15.0-2T15.0-3T15.0-3T15.0-3T15.0-3T15.0-4T15'-5T15.0-5T15.0-6F15.0-1F15.0-2F15.0-315.1-115.1-215.1-2a15.1-2b15.1-315.1-415.1-515.1-615.1-715.1-815.1-915.1-1015.1-1115.1-1215.1-1315.1-1415.1-1515.1-1615.1-17T15.1-1T15.1-2T15.1-3T15.1-4T15.1-5Sh1Sh2,.Sh3Sh1Sh2Sh3Sh3aSh1Sh2R03R03R03R03R03R03R03R03R03R03R03R02R02R02AOOROOROOR03R03R03R03R03A22A06A06AOOA27A22AOOAOOR02AOOAOOA22R03AOOAOOAOOAOOAOOA22ROOA22A26AOOT15.1-6F15.1-1F15.1-2F15.1-3F15.1-415'-115.2-215.2-315.2-415.2-515.2-615.2-715.2-815.2-8a15.2-8b15.2-915.2-1015.2-1115.2-1215.2-1315.2-1415.2-1515.2-1615.2-1715.2-1815.2-1915.2-2015'-2115.2-21a15.2-21b15.2-2215.2-2315.2-2415.2-2515.2-25a15-2-25b15.2-2615.2-2715.2-2815.2-2915'-3015.2-3115.2-3215.2-32a15.2-32bIAOOAOOAOOAOOAOOR03AOOAOOA06A22A22AOOR01R01R01AOOA22AOOA28ROOROOA22.A23AOOAOOAOOAOOROOROOROOA22AOOAOOA10A10A10AOOAOOA22A22AOOAOOA22A22A22USARRevision4EP15-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 15 PAGES Page T=T able Amendment F=FBFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 15-i 15-ii 15-iii 15-iv 15-v 15-vi 15-vii 15-viii 15 1X 15-x 15-xl 15-xii 15-xiii 15-xiv 15-xv 15-xvl 15-xvll 15-xvl 1 1 15-xix 15-xx 15-xxi 15-xxii 15-xxiia 15-xxiib 15-xxiii 15-xxiv 15-xxv 15-xxvi 15-xxvii 15'-1 15.0-1a 15.0-1b 15.0-2 15.0-3 15.0-4 15.0-5 15.0-6 15'-7 15.0-7a 15.0-7b 15'-8 15.0-9 15.0-9a 15.0-9b 15.0-10 R03 AOO AOO R03 AOO ROO A24 A24 AOO R03 A06 A24 A12 ROO AOO A18 R03 R03 A24 AOO A24 ROO A18 A18 AOO AOO A22 A24 AOO R03 R03 R03 AOO AOO AOO AOO AOO A06 A06 A06 R01 R03 R03 R02 R03 15.0-11 15.0-11a 15.0-11b 15.0-11c 15.0-11d 15.0-12 T 15'-1 T 15.0-1 T 15.0-1 T 15.0-2 T 15.0-3 T 15.0-3 T 15.0-3 T 15.0-3 T 15.0-4 T 15'-5 T 15.0-5 T 15.0-6 F 15.0-1 F 15.0-2 F 15.0-3 15.1-1 15.1-2 15.1-2a 15.1-2b 15.1-3 15.1-4 15.1-5 15.1-6 15.1-7 15.1-8 15.1-9 15.1-10 15.1-11 15.1-12 15.1-13 15.1-14 15.1-15 15.1-16 15.1-17 T 15.1-1 T 15.1-2 T 15.1-3 T 15.1-4 T 15.1-5 Sh 1 Sh 2,.Sh 3 Sh 1 Sh 2 Sh 3 Sh 3a Sh 1 Sh 2 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R02 R02 R02 AOO ROO ROO R03 R03 R03 R03 R03 A22 A06 A06 AOO A27 A22 AOO AOO R02 AOO AOO A22 R03 AOO AOO AOO AOO AOO A22 ROO A22 A26 AOO T 15.1-6 F 15.1-1 F 15.1-2 F 15.1-3 F 15.1-4 15'-1 15.2-2 15.2-3 15.2-4 15.2-5 15.2-6 15.2-7 15.2-8 15.2-8a 15.2-8b 15.2-9 15.2-10 15.2-11 15.2-12 15.2-13 15.2-14 15.2-15 15.2-16 15.2-17 15.2-18 15.2-19 15.2-20 15'-21 15.2-21a 15.2-21b 15.2-22 15.2-23 15.2-24 15.2-25 15.2-25a 15-2-25b 15.2-26 15.2-27 15.2-28 15.2-29 15'-30 15.2-31 15.2-32 15.2-32a 15.2-32b I AOO AOO AOO AOO AOO R03 AOO AOO A06 A22 A22 AOO R01 R01 R01 AOO A22 AOO A28 ROO ROO A22.A23 AOO AOO AOO AOO ROO ROO ROO A22 AOO AOO A10 A10 A10 AOO AOO A22 A22 AOO AOO A22 A22 A22 USAR Revision 4 EP 15-1 October 1992
~re~9 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER15PageT=TableF=FicFFre Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number15.2-3315.2-34T15.2-1T15.2-2T15.2-3T15.2-4T15.2-5T15.2-6T15.2-7T15.2-7T15.2-8T15'-9T15-2-10T15-2-10T15.2-11T15.2-12T15.2-13F15.2-1F15.2-2F15.2-3F15.2-4F15.2-5F15.2-6F15.2-7F15'-8F15.2-9F15.2-10F15.2-11Sh1Sh2Sh1Sh215.3-115.3-215.3-315.3-415.3-515.3-615.3-715.3-815.3-915.2NotesSh15.2NotesShF15.2-12F15.2-13F15.2-14F15.2-15F15.2-16F15.2-17AOOAOOR03AOOAOOAOOA28AOOAOOAOOAOOA22AOOAOOA22A27R03AOOAOOA22A22AOOAOOAOOAOOA10A22A22A22A22AOOAOOAOOAOOAOOAOOAOOAOOAOOA22AOOAOOA22A27AOO15.3-1015.3-1115.3-1215.3-1315.3-14T15.3-1T15'-2T15'-3T15.3-4T15.3-5F15.3-1F15.3-2F15.3-3F15.3-4F15.3-515.4-115.4-215.4-315.4-415.4-4a15.4-4b15.4-515'-615.4-715.4-815.4-915.4-1015.4-1115.4-1215-4-1315-4-1415.4-1515.4-15a15-4-15b15.4-1615.4-1715.4-1815.4-18a15-4-18b15.4-1915.4-2015.4-21T15'-1T15'-2T15.4-3A22AOOAOOAOOAOOA22A10A10A22A10AOOAOOAOOAOOAOOR03A22R03R03ROOA28AOOAOOA22AOOAOOR03AOOA22A22AOOA22A06A27A22A12ROOROOA12A12AOOA28AOOAOOA22T15.4-4T15.4-5T15.4-6T15.4-7T15.4-8T15.4-9T15.4-10Sh1T15.4-10Sh2T15.4-11T15.4-12T15.4-13T15.4-14T15.4-15T15.4-16F15'-1F15'-2F15.4-3F15.4-4F15.4-5F15'-6F15.4-7F15.4-815'-115.5-215.5-3T15.5-1F15'-115.6-115.6-215.6-315.6-415.6-515.6-615.6-715.6-815.6-8a15.6-8b15.6-915.6-1015.6-1115.6-1215.6-12a15.6-12a.1 15.6-12a.2
~re~9 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table F=FicFFre Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 15.2-33 15.2-34 T 15.2-1 T 15.2-2 T 15.2-3 T 15.2-4 T 15.2-5 T 15.2-6 T 15.2-7 T 15.2-7 T 15.2-8 T 15'-9 T 15-2-10 T 15-2-10 T 15.2-11 T 15.2-12 T 15.2-13 F 15.2-1 F 15.2-2 F 15.2-3 F 15.2-4 F 15.2-5 F 15.2-6 F 15.2-7 F 15'-8 F 15.2-9 F 15.2-10 F 15.2-11 Sh 1 Sh 2 Sh 1 Sh 2 15.3-1 15.3-2 15.3-3 15.3-4 15.3-5 15.3-6 15.3-7 15.3-8 15.3-9 15.2 Notes Sh 15.2 Notes Sh F 15.2-12 F 15.2-13 F 15.2-14 F 15.2-15 F 15.2-16 F 15.2-17 AOO AOO R03 AOO AOO AOO A28 AOO AOO AOO AOO A22 AOO AOO A22 A27 R03 AOO AOO A22 A22 AOO AOO AOO AOO A10 A22 A22 A22 A22 AOO AOO AOO AOO AOO AOO AOO AOO AOO A22 AOO AOO A22 A27 AOO 15.3-10 15.3-11 15.3-12 15.3-13 15.3-14 T 15.3-1 T 15'-2 T 15'-3 T 15.3-4 T 15.3-5 F 15.3-1 F 15.3-2 F 15.3-3 F 15.3-4 F 15.3-5 15.4-1 15.4-2 15.4-3 15.4-4 15.4-4a 15.4-4b 15.4-5 15'-6 15.4-7 15.4-8 15.4-9 15.4-10 15.4-11 15.4-12 15-4-13 15-4-14 15.4-15 15.4-15a 15-4-15b 15.4-16 15.4-17 15.4-18 15.4-18a 15-4-18b 15.4-19 15.4-20 15.4-21 T 15'-1 T 15'-2 T 15.4-3 A22 AOO AOO AOO AOO A22 A10 A10 A22 A10 AOO AOO AOO AOO AOO R03 A22 R03 R03 ROO A28 AOO AOO A22 AOO AOO R03 AOO A22 A22 AOO A22 A06 A27 A22 A12 ROO ROO A12 A12 AOO A28 AOO AOO A22 T 15.4-4 T 15.4-5 T 15.4-6 T 15.4-7 T 15.4-8 T 15.4-9 T 15.4-10 Sh 1 T 15.4-10 Sh 2 T 15.4-11 T 15.4-12 T 15.4-13 T 15.4-14 T 15.4-15 T 15.4-16 F 15'-1 F 15'-2 F 15.4-3 F 15.4-4 F 15.4-5 F 15'-6 F 15.4-7 F 15.4-8 15'-1 15.5-2 15.5-3 T 15.5-1 F 15'-1 15.6-1 15.6-2 15.6-3 15.6-4 15.6-5 15.6-6 15.6-7 15.6-8 15.6-8a 15.6-8b 15.6-9 15.6-10 15.6-11 15.6-12 15.6-12a 15.6-12a.1 15.6-12a.2.A22 AOO AOO AOO A27 A22 A12 A12 A12 A12 A12 A12 A12 A12 A22 A22 AOO AOO AOO AOO AOO AOO AOO R03 AOO AOO AOO A12 A12 ROO A12 AOO R03 A12 ROO R03 A12 A25 AOO ROO R04 ROO ROO A25 USAR Revision 4 EP 15-2 October 1992 I
.A22AOOAOOAOOA27A22A12A12A12A12A12A12A12A12A22A22AOOAOOAOOAOOAOOAOOAOOR03AOOAOOAOOA12A12ROOA12AOOR03A12ROOR03A12A25AOOROOR04ROOROOA25USARRevision4EP15-2October1992 I
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=Ficture Number 15.6-12b 15.6-12c 15.6-12d 15.6-13 15.6-13a 15.6-13b 15.6-14 15.6-14a 15.6-14b 15.6-15 15.6-16 15.6-17 15.6-18 T 15'-1 Sh T 15.6-1 Sh T 15.6-2 T 15.6-3 T 15.6-4 T 15.6-5 T 15.6-6 Sh T 15.6-6 Sh T 15.6-7 T 15.6-8 T 15.6-9 T 15.6-10 T 15.6-11 T 15.6-12 T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-14 T 15.6-15 T 15.6-15a T 15.6-15b T 15.6-16 T 15.6-16a 1 2 1 2 1 2 3 4 5 6 7 8 9 10 11 12 13 ROO R03 A18 R01 A13 A13 R03 A10 A10 AOO A25 AOO A18 ROO R01 AOO A12 R01 R02 ROO ROO A12 ROO ROO A12 A12 A12 ROO R03 R03 R03 ROO ROO ROO ROO R01 R04 R03 ROO R03 ROO A21 A23 ROO A21 A23 T 15.6-16b T 15.6-17 T 15.6-18 T 15.6-19 T 15.6-20 T 15.6-21 15.7-1 15.7-2 15.7-3 15.7-4 15.7-5 15.7-6 15.7-7 15.7-8 15.7-9 15.7-10 15.7-11 15.7-12 15.7-13 15.7-13a 15.7-13b 15.7-14 15.7-15 15.7-16 15.7-17 15.7-18 T 15.7-1 T 15.7-2 T 15.7-3 T 15.7-4 T 15.7-5 T 15.7-6 T 15.7-7 Sh T 15.7-7 Sh T 15.7-8 Sh T 15.7-8 Sh T 15.7-9 Sh T 15.7-9 Sh T 15.7-10 T 15.7-11 T 15.7-12 T 15.7-13 T 15.7-14 T 15.7-15 T 15.7-16 Sh ROO A13 A13 A13 A13 A22 AOO A25 A23 A19 R02 R03 AOO AOO AOO AOO AOO R04 R04 R04 ROO A12 A18 A12 ROO R01 A25 A13 AOO AOO R01 AOO AOO AOO A23 AOO ROO ROO R01 ROO ROO A12 A12 A12 R01 T 15-7-16 T 15.7-17 15.8-1 15.8-2 15.8-3 15 8-4 15'-5 App 15A 15A-i 15A-ii 15A-iii 15A-iv 15A-v 15A-vi 15A-vii 15A-viii 15A-1 15A-2 15A-3 15A-4 15A-5 15A-6 15A-7 15A-8 15A-9 15A-10 15A-11 15A-12 15A-13 15A-14 15A-15 15A-16 15A-17 15A-18 15A-19 15A-20'5A-21 15A-22 15A-23 15A-24 15A-25 15A-26 15A-27 15A-28 Sh 2 R01 R01 R03 R03 A18 R03 R03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO USAR Revision 4 EP 15-3 October 1992 I~d I' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 15 PAGES Page T=Table Amendment F=FicFure Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number 15A-29 15A-30 15A-31 15A-32 15A-33 15A-34 15A-35 15A-36 15A-37 15A-38 15A-39 15A-40 15A-41 15A-42 15A-43 15A-44 15A-45 15A-46 15A-47 15A-48 15A-49 15A-50 15A-51 15A-52 15A-53 15A-54 15A-55 15A-56 15A-57 15A-58 15A-59 T 15A-1 T 15A-2 S?1 1 T 15A-2 Sh 2 T 15A-3 T 15A-4 T 15A-5 T 15A-6 T 15A-7 T 15A-8 T 15A-9 T 15A-10 T 15A-11 F 15A-1 F 15A-2 F 15A-3 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 15A-4 15A-5 15A-6 15A-7 15A-8 15A-9 15A-10 15A-11 15A-12 15A-13 15A-14 15A-15 15A-16 15A-17 15A-18 15A-19 15A-20 15A-21 15A-22 15A-23 15A-24 15A-25 15A-26 15A-27 15A-28 15A-29 15A-30 15A-31 15A-32 15A-33 15A-34 15A-35 15A-36 15A-37 15A-38 15A-39 15A-40 15A-41 15A-42 15A-43 15A-44 15A-45 15A-46 15A-47 15A-48 15A-49 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A28 R04 AOO AOO AOO AOO A28 AOO AOO AOO R03 AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO AOO AOO R04 R04 AOO AOO AOO AOO AOO AOO AOO AOO F 15A-50 F 15A-51 F 15A-52 F 15A-53 App 15B 15B-i 15B-ii 15B-iii 15B-iv 15B.1-1 15B.1-2 15B.2-1 15B.2-2 15B.2-3 15B.2-4 15B.2-5 15B.2-6 15B 3-1 15B.3-2 15B.3-3 15B.3-4 15B.3-4a 15B.3-4b 15B.3-5 15B.3-6 15B.3-7 15B.3-8 15B.3-9 15B.3-10 15B.3-11 15B.3-12 15B.3-13 15B.3-13a 15B.3-13b 15B.3-14 15B.3-15 15B.3-16 15B.3-17 15B.3-18 15B.3-19 15B.4-1 15B.4-2 15B.4-3 15B.5-1 15B.5-2 AOO AOO AOO R04 A26 R03 A26 R03 R03 R04 R03 A26 A26 A26 A26 A26 A26 R03 R03 R03 R03 R03 R03 R03 A26 A26 R03 R03 R03 R03 R03 R04 R04 R03 A26 R03 R03 R03 R03 R03 A26 A26 A26 A26 R03 USAR Revision 4 EP 15-4 October 1992
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER15PageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=Ficpure NumberPageT=TableAmendment F=Ficture Number15.6-12b15.6-12c15.6-12d15.6-1315.6-13a15.6-13b15.6-1415.6-14a15.6-14b15.6-1515.6-1615.6-1715.6-18T15'-1ShT15.6-1ShT15.6-2T15.6-3T15.6-4T15.6-5T15.6-6ShT15.6-6ShT15.6-7T15.6-8T15.6-9T15.6-10T15.6-11T15.6-12T15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-13ShT15.6-14T15.6-15T15.6-15aT15.6-15bT15.6-16T15.6-16a121212345678910111213ROOR03A18R01A13A13R03A10A10AOOA25AOOA18ROOR01AOOA12R01R02ROOROOA12ROOROOA12A12A12ROOR03R03R03ROOROOROOROOR01R04R03ROOR03ROOA21A23ROOA21A23T15.6-16bT15.6-17T15.6-18T15.6-19T15.6-20T15.6-2115.7-115.7-215.7-315.7-415.7-515.7-615.7-715.7-815.7-915.7-1015.7-1115.7-1215.7-1315.7-13a15.7-13b15.7-1415.7-1515.7-1615.7-1715.7-18T15.7-1T15.7-2T15.7-3T15.7-4T15.7-5T15.7-6T15.7-7ShT15.7-7ShT15.7-8ShT15.7-8ShT15.7-9ShT15.7-9ShT15.7-10T15.7-11T15.7-12T15.7-13T15.7-14T15.7-15T15.7-16ShROOA13A13A13A13A22AOOA25A23A19R02R03AOOAOOAOOAOOAOOR04R04R04ROOA12A18A12ROOR01A25A13AOOAOOR01AOOAOOAOOA23AOOROOROOR01ROOROOA12A12A12R01T15-7-16T15.7-1715.8-115.8-215.8-3158-415'-5App15A15A-i15A-ii15A-iii15A-iv15A-v15A-vi15A-vii15A-viii15A-115A-215A-315A-415A-515A-615A-715A-815A-915A-1015A-1115A-1215A-1315A-1415A-1515A-1615A-1715A-1815A-1915A-20'5A-2115A-2215A-2315A-2415A-2515A-2615A-2715A-28Sh2R01R01R03R03A18R03R03AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR04AOOAOOAOOAOOAOOUSARRevision4EP15-3October1992 I~dI' NineMilePointUnit2FSARLISTOFEFFECTIVE CHAPTER15PAGESPageT=TableAmendment F=FicFure NumberPageT=TableF=Ficrure Amendment NumberPageT=TableAmendment F=FicFure Number15A-2915A-3015A-3115A-3215A-3315A-3415A-3515A-3615A-3715A-3815A-3915A-4015A-4115A-4215A-4315A-4415A-4515A-4615A-4715A-4815A-4915A-5015A-5115A-5215A-5315A-5415A-5515A-5615A-5715A-5815A-59T15A-1T15A-2S?11T15A-2Sh2T15A-3T15A-4T15A-5T15A-6T15A-7T15A-8T15A-9T15A-10T15A-11F15A-1F15A-2F15A-3AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR03AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR04AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOR04AOOAOOAOOFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF15A-415A-515A-615A-715A-815A-915A-1015A-1115A-1215A-1315A-1415A-1515A-1615A-1715A-1815A-1915A-2015A-2115A-2215A-2315A-2415A-2515A-2615A-2715A-2815A-2915A-3015A-3115A-3215A-3315A-3415A-3515A-3615A-3715A-3815A-3915A-4015A-4115A-4215A-4315A-4415A-4515A-4615A-4715A-4815A-49AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOA28R04AOOAOOAOOAOOA28AOOAOOAOOR03AOOAOOAOOAOOAOOAOOAOOR04AOOAOOAOOAOOAOOAOOAOOR04R04AOOAOOAOOAOOAOOAOOAOOAOOF15A-50F15A-51F15A-52F15A-53App15B15B-i15B-ii15B-iii15B-iv15B.1-115B.1-215B.2-115B.2-215B.2-315B.2-415B.2-515B.2-615B3-115B.3-215B.3-315B.3-415B.3-4a15B.3-4b15B.3-515B.3-615B.3-715B.3-815B.3-915B.3-1015B.3-1115B.3-1215B.3-1315B.3-13a 15B.3-13b 15B.3-1415B.3-1515B.3-1615B.3-1715B.3-1815B.3-1915B.4-115B.4-215B.4-315B.5-115B.5-2AOOAOOAOOR04A26R03A26R03R03R04R03A26A26A26A26A26A26R03R03R03R03R03R03R03A26A26R03R03R03R03R03R04R04R03A26R03R03R03R03R03A26A26A26A26R03USARRevision4EP15-4October1992
~-I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table F=FicFure Amendment Number Page T=Table F Ficpure Amendment Number Page T=Table Amendment F FicFure Number 15B.5-3 15B.5-4 15B.6-1 15B.6-2 15B.6-3 15B.7-1 15B.7-2 15B.8-1 15B-8-2 App 15C 15C-i 15C-ii 15C-iii 15C-1 15C-2 15C-3 15C-4 15C-5 15C-6 15C-7 15C-8 15C-9 15C-10 15C-11 15C-12 15C-13 15C-14 15C-15 15C-16 15C-17 15C-18 15C-19 15C-20 App 15D 15D-i 15D-ii 15D-iii 15D-1 15D-1a 15D-1b 15D-2 15D-3 15D-4 15D-5 R03 A26 R03 A26 R03 A26 R03 A26 R03 A26 A26 R03 R03 R04 R03 R03 R03 R03 R03 A26 A26 R03 A26 R03 R03 A26 A26 R03 R03 R03 R03 R03 R03 R03 R04 R03 R03 R04 R04 R04 R03 R03 R03 R03 15D-6 15D-7 15D-8 T 15D-1 T 15D-2 T 15D-3 T 15D-4 T 15D-5 F 15D-1 F 15D-2 F 15D-3 F 15D-4 App 15E 15E-i 15E-ii 15E-iii 15E.1-1 15E.1-2 15E.2-1 15E.2-2 15E.3-1 15E.3-2 15E.3-3 15E.3-4 15E.3-5 15E.3-6 15E.3-7 15E.3-8 15E.3-9 15E.3-10 15E.3-11 15E.3-12 15E.3-13 15E.3-14 15E.3-15 15E.3-16 15E.3-17 15E.3-18 15E.4-1 15E.4-2 15E.4-3 15E.4-4 15E.4-5 15E.4-6 15E.5-1 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 A26 ROO ROO A26 A26 ROO ROO ROO ROO A26 ROO R01 ROO R01 A26 R03 A26 ROO ROO A26 A26 A26 A28 A26 A26 A26 A26 A26 ROO ROO A26 A26 ROO App 15F App 15G 15G-i 15G-ii 15G-iii 15G-1 15G-2 15G-3 15G-4 15G-5 15G-6 15G-7 15G-8 15G-9 15G-10 15G-11 15G-12 T 15G-1 T 15G-2 T 15G-3 T 15G-4 T 15G-5 T 15G-6 T 15G-7 T 15G-8 T 15G-9 T 15G-10 T 15G-11 S?1 1 T 15G-11 S?1 2 T 15G-12 T 15G-13 T 15G-14 F 15G-1 F 15G-2 F 15G-3 F 15G-4 F 15G-5 F 15G-6 F 15G-7 F 15G-8 F 15G-9 F 15G-10 App 15H 15H-1 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO ROO USAR Revision 4 EP 15-5 October 1992 E
~-I NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER15PageT=TableF=FicFure Amendment NumberPageT=TableFFicpureAmendment NumberPageT=TableAmendment FFicFureNumber15B.5-315B.5-415B.6-115B.6-215B.6-315B.7-115B.7-215B.8-115B-8-2App15C15C-i15C-ii15C-iii15C-115C-215C-315C-415C-515C-615C-715C-815C-915C-1015C-1115C-1215C-1315C-1415C-1515C-1615C-1715C-1815C-1915C-20App15D15D-i15D-ii15D-iii15D-115D-1a15D-1b15D-215D-315D-415D-5R03A26R03A26R03A26R03A26R03A26A26R03R03R04R03R03R03R03R03A26A26R03A26R03R03A26A26R03R03R03R03R03R03R03R04R03R03R04R04R04R03R03R03R0315D-615D-715D-8T15D-1T15D-2T15D-3T15D-4T15D-5F15D-1F15D-2F15D-3F15D-4App15E15E-i15E-ii15E-iii15E.1-115E.1-215E.2-115E.2-215E.3-115E.3-215E.3-315E.3-415E.3-515E.3-615E.3-715E.3-815E.3-915E.3-1015E.3-1115E.3-1215E.3-1315E.3-1415E.3-1515E.3-1615E.3-1715E.3-1815E.4-115E.4-215E.4-315E.4-415E.4-515E.4-615E.5-1R03R03R03R03R03R03R03R03R03R03R03R03A26ROOROOA26A26ROOROOROOROOA26ROOR01ROOR01A26R03A26ROOROOA26A26A26A28A26A26A26A26A26ROOROOA26A26ROOApp15FApp15G15G-i15G-ii15G-iii15G-115G-215G-315G-415G-515G-615G-715G-815G-915G-1015G-1115G-12T15G-1T15G-2T15G-3T15G-4T15G-5T15G-6T15G-7T15G-8T15G-9T15G-10T15G-11S?11T15G-11S?12T15G-12T15G-13T15G-14F15G-1F15G-2F15G-3F15G-4F15G-5F15G-6F15G-7F15G-8F15G-9F15G-10App15H15H-1ROOR03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03ROOROOUSARRevision4EP15-5October1992 E
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 15H-2 15H-3 15H-4 15H-5 15H-6 15H-7 15H-8 15H-9 15H-10 15H-11 15H-12 15H-13 15H-14 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 15-6 October 1992
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER15PagePagePageT=TableAmendment T=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberF=FicFure Number15H-215H-315H-415H-515H-615H-715H-815H-915H-1015H-1115H-1215H-1315H-14ROOROOROOROOROOROOROOROOROOROOROOROOROOUSARRevision4EP15-6October1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER16PagePagePageT=TableAmendment T=TableAmendment T=TableAmendment F=FicFure NumberF=FicFure NumberF=FicFure Number16-1ROOUSARRevision4EP16-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 16 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 16-1 ROO USAR Revision 4 EP 16-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER17PageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure Number17i17ii17-iii17-1v17-v17.0-117.0-217.0-3T17.0-117~1-117.1-1a17.1-1b17'-217.1-2a17.1-2b17~1317'-417.1-4a17.1-4b17.1-517.1-5a17.1-5b17.1-617~1717.1-817.1-917.1-1017.1-10a17.1-10b17.1-1117.1-1217.1-1317.1-13a17'-13b17.1-1417.1-1517.1-15a17.1-15b17.1-1617.1-16a17.1-16b17.1-1717.1-17a17'-17bA13A09A15ROOA24A07AOOA15A07ROOA26A20A28ROOA09A28A28A28A28A28ROOA05A28ROOA28AOOA28A13A13ROOAOOA09A28A05A28A09A09A05A05A05A05A05A05A0517.1-1817.1-1917.1-2017.1-2117.1-2217.1-22a17.1-22b1701-2317.1-23a17'-23b17.1-2417.1-24a17.1-24b17.1-2517.1-2617'-2717.1-27a17.1-27b17.1-2817'-2917.1-3017.1-30a17.1-30b17.1-3117.1-3217.1-32a17.1-32b17~13317.1-33a17.1-33b17.1-3417.1-34a17.1-34b17.1-3517.1-35a17.1-35b17.1-3617.1-36a17.1-36b17~13717.1-3817.1-38a17.1-38b17.1-3917.1-39a17.1-39bAOOAOOAOOAOOA28A28A09ROOA05A05A05A05A01AOOA05A09A09A09AOOAOOA05A05A01A09A09A09A09A05A05A05A09R01A09A28A15A15A09A28A05AOOA28A28A15A05A09A0517.1-4017.1-40a17.1-40b17.1-4117.1-4217.1-4317.1-43a17.1-43b17.1-4417.1-44a17.1-44b17.1-4517.1-4617.1-4717'-4817'-4917.1-5017.1-50a17.1-50b17.1-5117.1-5217.1-53T17.1-1Sh1T17.1-1S?12T17.1-1Sh3T17'-1Sh4T17.1-1Sh5F171-1F17.1-217~21A09A22A05A09AOOA05A05A05A05A05A05A09AOOA28A28A05A01A01A01AOOA28A28AOOAOOAOOAOOAOOA28ROOR04USARRevision4EP17-1October1992
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 17 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 17 i 17 ii 17-iii 17-1v 17-v 17.0-1 17.0-2 17.0-3 T 17.0-1 17~1-1 17.1-1a 17.1-1b 17'-2 17.1-2a 17.1-2b 17~1 3 17'-4 17.1-4a 17.1-4b 17.1-5 17.1-5a 17.1-5b 17.1-6 17~1 7 17.1-8 17.1-9 17.1-10 17.1-10a 17.1-10b 17.1-11 17.1-12 17.1-13 17.1-13a 17'-13b 17.1-14 17.1-15 17.1-15a 17.1-15b 17.1-16 17.1-16a 17.1-16b 17.1-17 17.1-17a 17'-17b A13 A09 A15 ROO A24 A07 AOO A15 A07 ROO A26 A20 A28 ROO A09 A28 A28 A28 A28 A28 ROO A05 A28 ROO A28 AOO A28 A13 A13 ROO AOO A09 A28 A05 A28 A09 A09 A05 A05 A05 A05 A05 A05 A05 17.1-18 17.1-19 17.1-20 17.1-21 17.1-22 17.1-22a 17.1-22b 1701-23 17.1-23a 17'-23b 17.1-24 17.1-24a 17.1-24b 17.1-25 17.1-26 17'-27 17.1-27a 17.1-27b 17.1-28 17'-29 17.1-30 17.1-30a 17.1-30b 17.1-31 17.1-32 17.1-32a 17.1-32b 17~1 33 17.1-33a 17.1-33b 17.1-34 17.1-34a 17.1-34b 17.1-35 17.1-35a 17.1-35b 17.1-36 17.1-36a 17.1-36b 17~1 37 17.1-38 17.1-38a 17.1-38b 17.1-39 17.1-39a 17.1-39b AOO AOO AOO AOO A28 A28 A09 ROO A05 A05 A05 A05 A01 AOO A05 A09 A09 A09 AOO AOO A05 A05 A01 A09 A09 A09 A09 A05 A05 A05 A09 R01 A09 A28 A15 A15 A09 A28 A05 AOO A28 A28 A15 A05 A09 A05 17.1-40 17.1-40a 17.1-40b 17.1-41 17.1-42 17.1-43 17.1-43a 17.1-43b 17.1-44 17.1-44a 17.1-44b 17.1-45 17.1-46 17.1-47 17'-48 17'-49 17.1-50 17.1-50a 17.1-50b 17.1-51 17.1-52 17.1-53 T 17.1-1 Sh 1 T 17.1-1 S?1 2 T 17.1-1 Sh 3 T 17'-1 Sh 4 T 17.1-1 Sh 5 F 17 1-1 F 17.1-2 1 7~2 1 A09 A22 A05 A09 AOO A05 A05 A05 A05 A05 A05 A09 AOO A28 A28 A05 A01 A01 A01 AOO A28 A28 AOO AOO AOO AOO AOO A28 ROO R04 USAR Revision 4 EP 17-1 October 1992


NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESCHAPTER18PageT=TableF=FicFure Amendment NumberPageT=TableFFicpurePageAmendment T=TableAmendment NumberFFiqureNumber18-i18-ia18-ib18-ii18-iii18-iv18.1-118.1-1a18.1-1b18.1-2R03R03R03R03R03R03R03R03R03R03F18.2-1R03F18.2-2R03F18.2-3R03F18.2-4R03F18.2-5R03F18.2-6Sh1R03F18.2-6Sh2R03F18.2-7.R03F18.2-8R0318.2-118'-218'-318.2-418.2-518.2-618.2-718'-818.2-918.2-1018.2-1118.2-1218.2-1318.2-1418.2-1518.2-1618.2-1718.2-18T18.2-1T18.2-2T'18.2-2T18.2-2T18.2-2T18.2-2T18.2-2T18.2-2T18'-2T18'-2T18'-2T18.2-2T18.2-2T18.2-2T18.2-2ShShShShShShShShShShshShShSh1234567891011121314R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R03R04R03R03R03R03USARRevision4EP18-1October1992 0.LIP NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESAPPENDIXARELOADANALYSISPageT=TableAmendment F=FicFure NumberPagePageT=TableAmendment T=TableAmendment F=FicFFre NumberFFicFureNumberA-iA-iiA-iiiA-ivA-ivaA-ivbA-vA-viA-viiA.0-1A.0-2A.0-3A.0-4FA.0-1A.4.1-1A.4.2-1A.4.3-1A.4.4-1A.4.4-2A.4.4-3FA.4-1A.5'-1A.5.2-2A.5.2-3A.5.2-4TA.5'-1TA.5.2-2TA.5.2-3FA.5.2-1A.6-1A.6-2A.6-3TA.6-1TA.6-2FA.6-1FA.6-2FA.6-3FA.6-4A.15.0-1R03R03R03R04R04R04R04R04R04R04R04R04R04R04R04R03R04R04R04R04R04R04R04R04R04R03R03R04R04R04R04R04R04R04R03R03R03R03R04A.15.0-2A15.0-3A.15.0-4A.15.0-5A.15.0-6A.15.0-7TA.15.0-1Sh1TA.15.0-1S?12TA.15.0-2TA.15.0-3TA.15.0-4S?11TA.15.0-4S?12TA.15.0-4S113FA.15'-1FA.15.0-2A.15'-1A.15.1-2A.15.1-3A.15.1-4A.15.1-5A.15.1-6A.15.1-7A.15.1-8A.15.1-9TA.15.1-1TA.15.1-2TA.15'-3FA.15'-1FA.15.1-2FA.15'-3A.15.2-1A.15.2-2A.15.2-3A.15'-4A.15.2-5A.15.2-6A.15.2-7A.15.2-8A.15.2-9A.15.2-10 A.15.2-11 A.15.2-12 R04R04R04R03R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R04R03R04R04R04R04R04R04R04R04R04TA.15.2-1TA.15.2-2FA.15.2-1FA.15.2-2A.15'-1A.15'-2A.154-3A.15.4-4A.15.4-5A.15.4-6A.15.4-7A.15.4-8A.15'-9TA.15'-1TA.15'-2TA.15.4-3TA.15'-4FA.15.4-1a FA.15.4-1b FA.15'-2FA.15'-3Ae15B-1A.15C-1A.15D-1R04R04R04R04R04R04R04R04R04R04R04R04R04R03R04R04R04R04R04R04R04R04R04R04USARRevision4EPA-1October1992 h~
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 18 Page T=Table F=FicFure Amendment Number Page T=Table F Ficpure Page Amendment T=Table Amendment Number F Fiqure Number 18-i 18-ia 18-ib 18-ii 18-iii 18-iv 18.1-1 18.1-1a 18.1-1b 18.1-2 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 F 18.2-1 R03 F 18.2-2 R03 F 18.2-3 R03 F 18.2-4 R03 F 18.2-5 R03 F 18.2-6 Sh 1 R03 F 18.2-6 Sh 2 R03 F 18.2-7.R03 F 18.2-8 R03 18.2-1 18'-2 18'-3 18.2-4 18.2-5 18.2-6 18.2-7 18'-8 18.2-9 18.2-10 18.2-11 18.2-12 18.2-13 18.2-14 18.2-15 18.2-16 18.2-17 18.2-18 T 18.2-1 T 18.2-2 T'18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18'-2 T 18'-2 T 18'-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh 1 2 3 4 5 6 7 8 9 10 11 12 13 14 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 USAR Revision 4 EP 18-1 October 1992 0.L IP Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX A RELOAD ANALYSIS Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFFre Number F FicFure Number A-i A-ii A-iii A-iv A-iva A-ivb A-v A-vi A-vii A.0-1 A.0-2 A.0-3 A.0-4 F A.0-1 A.4.1-1 A.4.2-1 A.4.3-1 A.4.4-1 A.4.4-2 A.4.4-3 F A.4-1 A.5'-1 A.5.2-2 A.5.2-3 A.5.2-4 T A.5'-1 T A.5.2-2 T A.5.2-3 F A.5.2-1 A.6-1 A.6-2 A.6-3 T A.6-1 T A.6-2 F A.6-1 F A.6-2 F A.6-3 F A.6-4 A.15.0-1 R03 R03 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R03 R04 R04 R04 R04 R04 R04 R04 R03 R03 R03 R03 R04 A.15.0-2 A 15.0-3 A.15.0-4 A.15.0-5 A.15.0-6 A.15.0-7 T A.15.0-1 Sh 1 T A.15.0-1 S?1 2 T A.15.0-2 T A.15.0-3 T A.15.0-4 S?1 1 T A.15.0-4 S?1 2 T A.15.0-4 S11 3 F A.15'-1 F A.15.0-2 A.15'-1 A.15.1-2 A.15.1-3 A.15.1-4 A.15.1-5 A.15.1-6 A.15.1-7 A.15.1-8 A.15.1-9 T A.15.1-1 T A.15.1-2 T A.15'-3 F A.15'-1 F A.15.1-2 F A.15'-3 A.15.2-1 A.15.2-2 A.15.2-3 A.15'-4 A.15.2-5 A.15.2-6 A.15.2-7 A.15.2-8 A.15.2-9 A.15.2-10 A.15.2-11 A.15.2-12 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 T A.15.2-1 T A.15.2-2 F A.15.2-1 F A.15.2-2 A.15'-1 A.15'-2 A.15 4-3 A.15.4-4 A.15.4-5 A.15.4-6 A.15.4-7 A.15.4-8 A.15'-9 T A.15'-1 T A.15'-2 T A.15.4-3 T A.15'-4 F A.15.4-1a F A.15.4-1b F A.15'-2 F A.15'-3 Ae15B-1 A.15C-1 A.15D-1 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 USAR Revision 4 EP A-1 October 1992 h~
NineMilePointUnit2DARLISTOFEFFECTIVE PAGESDESIGNASSESSMENT REPORTAPPENDIX6APageT=TableAmendment
Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table Amendment~Fi ere Number Page T=Tab le Amendment Page T=Table Amendment 6A-i 6A-ii 6A-iii 6A-iiia 6A-iiib 6A-iv 6A<<v 6A-vi 6A-vii 6A-viia 6A-viib 6A-viii 6A-viiia 6A-viiib 6A-ix 6A-ixa 6A-ixb 6A-x 6A-xi 6A-xii 6A-xiii 6A-xiv 6A-xv 6A-xvi 6A-xvii 6A-xviii 6A-xviiia 6A-xviiib 6A-xix 6A-xx 6A-xxi 6A-xxii 6A-xxiia 6A-xxiib 6A-xxiii 6A-xxiv 6A-xxv 6A-xxvi 6A-xxvii 6A-xxviii 6A.1-1 6A.1-2 6A.1-2a 6A.1-2b A28 AOO A24 A24 A24 A24 A24 A07 A24 A24 A09 A27 A09 A09 A21 A24 A17 ROO A24 ROO A27 A24 A25 A24 ROO A24 A22 A22 A24 A24 ROO ROO A24 A24 AOO A24 A24 A24 R04 A24 A26 A09 A09 A09 6A.1-3 6A.1-4 6A.1-5 T 6A.1-1 Sh 1 T 6A.1-1 Sh 2 T 6A.1-1 Sh 3 F 6A.1-1 F 6A.1-2 F 6A.1-3 6A.2-1 6A.2-2 6A.2-3 6A.2-4 6A.2-5 6A.2-6 6A.2-7 6A.2-8 6A.2-8a 6A.2-8b 6A.2-9 6A.2-10 6A.2-11 6A.2-12 6A.2-13 6A.2-14 T 6A.2-1 Sh 1 T 6A.2-1 Sh 2 T 6A.2-1a Sh 1 T 6A.2-1a Sh 2 T 6A.2-1b Sh 1 T 6A.2-1b Sh 2 T 6A.2-2 Sh 1 T 6A.2-2 Sh 2 T 6A.2-2 Sh 3 T 6A.2-3 Sh 1 T 6A.2-3 Sh 2 T 6A.2-3 Sh 3 F 6A.2-1 F 6A.2-2 F 6A.2-3 F 6A.2-4 F 6A.2-5 F 6A.2-6 F 6A.2-7 A09 AOO A23 R04 R04 R04 A17 AOO R02 AOO AOO AOO AOO AOO AOO R04 R04 R04 A05 R02 AOO R04 A23 R04 A27 AOO AOO A27 A27 A09 A09 A23 R04 A23 AOO A23 AOO AOO AOO AOO AOO ROO R02 R02 F 6A.2-8 F 6A.2-9 F 6A.2-10 F 6A.2-11 F 6A.2-12 F 6A 2-13 F 6A.2-14 F 6A.2-15 F 6A.2-16 F 6A.2-17 F 6A.2-18 F 6A.2-19 F 6A.2-20 F 6A.2-21 F 6A.2-22 F 6A.2-23 F 6A.2-24 F 6A.2-25 F 6A.2-26 F 6A.2-27 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-9a 6A.3-9b 6A.3-9c 6A.3-9d 6A.3-9e 6A.3-9f 6A.3-9g 6A.3-9h 6A.3-9i 6A.3-9j 6A.3-9k 6A.3-9L'6A.3-10 6A.3-11 6A.3-12 ROO ROO ROO ROO ROO R02 ROO ROO AOO ROO ROO ROO ROO ROO ROO ROO ROO R02 AOO A23 AOO AOO AOO AOO A26 R02 A26 AOO A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 AOO R02 AOO USAR Revision 4 DAR-1 October 1992
~FiereNumberPageT=TableAmendment PageT=TableAmendment 6A-i6A-ii6A-iii6A-iiia6A-iiib6A-iv6A<<v6A-vi6A-vii6A-viia6A-viib6A-viii6A-viiia6A-viiib6A-ix6A-ixa6A-ixb6A-x6A-xi6A-xii6A-xiii6A-xiv6A-xv6A-xvi6A-xvii6A-xviii6A-xviiia 6A-xviiib 6A-xix6A-xx6A-xxi6A-xxii6A-xxiia6A-xxiib6A-xxiii6A-xxiv6A-xxv6A-xxvi6A-xxvii6A-xxviii 6A.1-16A.1-26A.1-2a6A.1-2bA28AOOA24A24A24A24A24A07A24A24A09A27A09A09A21A24A17ROOA24ROOA27A24A25A24ROOA24A22A22A24A24ROOROOA24A24AOOA24A24A24R04A24A26A09A09A096A.1-36A.1-46A.1-5T6A.1-1Sh1T6A.1-1Sh2T6A.1-1Sh3F6A.1-1F6A.1-2F6A.1-36A.2-16A.2-26A.2-36A.2-46A.2-56A.2-66A.2-76A.2-86A.2-8a6A.2-8b6A.2-96A.2-106A.2-116A.2-126A.2-136A.2-14T6A.2-1Sh1T6A.2-1Sh2T6A.2-1aSh1T6A.2-1aSh2T6A.2-1bSh1T6A.2-1bSh2T6A.2-2Sh1T6A.2-2Sh2T6A.2-2Sh3T6A.2-3Sh1T6A.2-3Sh2T6A.2-3Sh3F6A.2-1F6A.2-2F6A.2-3F6A.2-4F6A.2-5F6A.2-6F6A.2-7A09AOOA23R04R04R04A17AOOR02AOOAOOAOOAOOAOOAOOR04R04R04A05R02AOOR04A23R04A27AOOAOOA27A27A09A09A23R04A23AOOA23AOOAOOAOOAOOAOOROOR02R02F6A.2-8F6A.2-9F6A.2-10F6A.2-11F6A.2-12F6A2-13F6A.2-14F6A.2-15F6A.2-16F6A.2-17F6A.2-18F6A.2-19F6A.2-20F6A.2-21F6A.2-22F6A.2-23F6A.2-24F6A.2-25F6A.2-26F6A.2-276A.3-16A.3-26A.3-36A.3-46A.3-56A.3-66A.3-76A.3-86A.3-96A.3-9a6A.3-9b6A.3-9c6A.3-9d6A.3-9e6A.3-9f6A.3-9g6A.3-9h6A.3-9i6A.3-9j6A.3-9k6A.3-9L'6A.3-106A.3-116A.3-12ROOROOROOROOROOR02ROOROOAOOROOROOROOROOROOROOROOROOR02AOOA23AOOAOOAOOAOOA26R02A26AOOA22A22A22A22A22A22A22A22A22A22A22A22A22AOOR02AOOUSARRevision4DAR-1October1992


NineMilePointUnit2DARLISTOFEFFECTIVE PAGESDESIGNASSESSMENT REPORTAPPENDIX6APageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment NumberTTTTTTTTFFFF~FFFFFFFFFFFFFFFFFFFFF6A.3-16A.3-26A.3-36A.3-46A.3-56A.3-66A.3-76A.3-86A.3-96A.3-106A.3-116A.3-126A.3-136A.3-146A.3-156A.3-16A.3-26A.3-36A.3-46A.3-56A.3-66A.3-76A.3-86A.3-96A.3-106A.3-116A.3-126A.3-136A.3-146A.3-156A.3-166A.3-176A.3-186A.3-196A.3-206A.3-216A.3-226A.3-236A.3-246A.3-256A.3-266A.3-276A.3-286A.3-296A.3-30AOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOAOOROOROOAOOAOOROOROOROOAOOAOOAOOAOOROOROOROOROOROOAOOROOROOROOROOROOAOOAOOAOOAOOAOOAOOAOOAOOF6A.3-31F6A.3-32F6A.3-33F6A.3-34F6A.3-35F6A.3-36F6A.3-37F6A.3-38F6A.3-39F6A.3-40F6A.3-41F6A.3-42F6A.3-43F6A.3-446A.4-16A.4-26A.4-2a6A.4-2b6A.4-36A.4-46A.4-4a6A.4-4b6A.4-56A.4-5a6A.4-5b6A.4-66A.4-76A.4-86A.4-8a6A.4-8b6A.4-96A.4-106A.4-116A.4-126A.4-12a6A.4-12b6A.4-136A.4-146A.4-156A.4-166A.4-16a6A.4-16b6A.4-176A.4-18ROOAOOROOROOROOROOAOOROOAOOAOOAOOROOA23A23AOOROOROOROOAOOA23A21A21A23A23A21ROOAOOA23A23A21AOOAOOAOOA23A23A06AOOA23A26A26A06A06AOOAOO6A.4-196A.4-19a6A.4-19b6A.4-206A.4-216A.4-226A.4-236A.4-246A.4-24a6A.4-24b6A.4-256A.4-25a6A.4-25b6A.4-266A.4-276A.4-286A.4-296A.4-306A.4-316A.4-326A.4-336A.4-346A.4-356A.4-366A.4-376A.4-37a6A.4-37b6A.4-386A.4-396A.4-406A.4-41T6A.4-1T6A.4-1T6A.4-2T6A.4-3T6A.4-3aShShT6A.4-4T6A.4-5T6A.4-6T6A.4-7T6A.4-7ShShShshT6A.4-8T6A.4-9T6A.4-10T6A.4-10121212A06A21A21A23AOOA28A27A23A23A19A22A22A22A23A23A23A23A26A26AOOA26AOOAOOAOOA23A21A21ROOROOAOOA21ROOROOAOOROOA21A28AOOAOOAOOA23AOOAOOA17A27USARRevision4DAR-2October1992 0jO'S4 NineMilePointUnit2DARLISTOFEFFECTIVE PAGESDESIGNASSESSMENT REPORTAPPENDIX6APageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=Ficcure NumberPageT=TableAmendment F=FicFure NumberT6A.4-10T6A.4-11T6A.4-12T6A.4-13T6A.4-14T6A.4-15T6A.4-15T6A.4-16T6A.4-17F6A4-1F6A.4-2F6A.4-3F6A.4-4F6A.4-5F6A.4-6F6A.4-7F6A.4-8F6A.4-9F6A.4-10F6A.4-11F6A.4-12F6A.4-13F6A.4-14F6A.4-15F6A.4-16F6A4-17F6A.4-18F6A.4-19F6A.4-20F6A.4-21F6A.4-22F6A.4-23F6A.4-24F6A.4-25F6A.4-26F6A.4-27F6A.4-28F6A.4-29F6A.4-30F6A.4-31F6A.4-32F6A.4-33F6A.4-34F6A.4-35F6A.4-36S113Sb1S?12A17AOOAOOAOOA17A17A17A17AOOROOAOOAOOAOOAOOAOOAOOAOOAOOAOOROOAOOA17ROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOROOcF6A.4-37F6A.4-38F6A.4-39F6A.4-40F6A.4-41F6A.4-42F6A.4-43F6A.4-44F6A.4-45F6A.4-46F6A.4-47F6A.4-48F6A.4-49F6A.4-50F6A.4-51F6A.4-52F6A.4-53F6A.4-54F6A.4-55F6A.4-56F6A.4-576A.5-16A.5-26A.5-2a6A.5-2b6A.5-36A.5-3a6A.5-3b6A.5-46A.5-4a6A.5-4b6A.5-56A.5-6T6A.5-1T6A.5-2ShT6A.5-2ShT6A.5-3T6A.5-4ShT6A.5-4ShT6A.5-5T6A.5-6S11T6A.5-6ShT6A.5-7T6A.5-8ShROOAOOR02ROOROOROOAOOAOOAOOROOROOR01ROOA21A25A21A21A21A21A21A21AOOR04A07A05A07A07A07A07A07A07A07AOOA26A26A26A23A24A07A07A24A07A07A07TFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF6A.5-8Sh6A.5-16A.5-26A.5-36A.5-46A.5-56A.5-66A.5-76A.5-86A.5-96A.5-106A.5-116A.5-126A.5-136A.5-146A.5-156A.5-166A.5-176A.5-186A.5-196A.5-206A5-216A.5-226A.5-236A.5-246A.5-256A.5-266A.5-276A.5-286A.5-296A.5-306A.5-316A.5-326A.5-336A.5-346A.5-356A.5-366A.5-376A.5-386A.5-396A.5-406A.5-416A.5-426A.5-43A07AOOAOOAOO'OOAOOR04AOOAOOAOOAOOAOOA23AOOAOOAOOAOOAOOAOOAOOA16AOOAOOAOOAOOAOOA23A23A23A23A23A23AOOA23A23AOOAOOA23A23A23A23A23A23A23USARRevision4DAR-3October1992
Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number T T T T T T T T F F F F~F F F F F F F F F F F F F F F F F F F F F 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-10 6A.3-11 6A.3-12 6A.3-13 6A.3-14 6A.3-15 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-10 6A.3-11 6A.3-12 6A.3-13 6A.3-14 6A.3-15 6A.3-16 6A.3-17 6A.3-18 6A.3-19 6A.3-20 6A.3-21 6A.3-22 6A.3-23 6A.3-24 6A.3-25 6A.3-26 6A.3-27 6A.3-28 6A.3-29 6A.3-30 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO AOO AOO ROO ROO ROO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO ROO ROO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO F 6A.3-31 F 6A.3-32 F 6A.3-33 F 6A.3-34 F 6A.3-35 F 6A.3-36 F 6A.3-37 F 6A.3-38 F 6A.3-39 F 6A.3-40 F 6A.3-41 F 6A.3-42 F 6A.3-43 F 6A.3-44 6A.4-1 6A.4-2 6A.4-2a 6A.4-2b 6A.4-3 6A.4-4 6A.4-4a 6A.4-4b 6A.4-5 6A.4-5a 6A.4-5b 6A.4-6 6A.4-7 6A.4-8 6A.4-8a 6A.4-8b 6A.4-9 6A.4-10 6A.4-11 6A.4-12 6A.4-12a 6A.4-12b 6A.4-13 6A.4-14 6A.4-15 6A.4-16 6A.4-16a 6A.4-16b 6A.4-17 6A.4-18 ROO AOO ROO ROO ROO ROO AOO ROO AOO AOO AOO ROO A23 A23 AOO ROO ROO ROO AOO A23 A21 A21 A23 A23 A21 ROO AOO A23 A23 A21 AOO AOO AOO A23 A23 A06 AOO A23 A26 A26 A06 A06 AOO AOO 6A.4-19 6A.4-19a 6A.4-19b 6A.4-20 6A.4-21 6A.4-22 6A.4-23 6A.4-24 6A.4-24a 6A.4-24b 6A.4-25 6A.4-25a 6A.4-25b 6A.4-26 6A.4-27 6A.4-28 6A.4-29 6A.4-30 6A.4-31 6A.4-32 6A.4-33 6A.4-34 6A.4-35 6A.4-36 6A.4-37 6A.4-37a 6A.4-37b 6A.4-38 6A.4-39 6A.4-40 6A.4-41 T 6A.4-1 T 6A.4-1 T 6A.4-2 T 6A.4-3 T 6A.4-3a Sh Sh T 6A.4-4 T 6A.4-5 T 6A.4-6 T 6A.4-7 T 6A.4-7 Sh Sh Sh sh T 6A.4-8 T 6A.4-9 T 6A.4-10 T 6A.4-10 1 2 1 2 1 2 A06 A21 A21 A23 AOO A28 A27 A23 A23 A19 A22 A22 A22 A23 A23 A23 A23 A26 A26 AOO A26 AOO AOO AOO A23 A21 A21 ROO ROO AOO A21 ROO ROO AOO ROO A21 A28 AOO AOO AOO A23 AOO AOO A17 A27 USAR Revision 4 DAR-2 October 1992 0 j O'S 4 Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficcure Number Page T=Table Amendment F=FicFure Number T 6A.4-10 T 6A.4-11 T 6A.4-12 T 6A.4-13 T 6A.4-14 T 6A.4-15 T 6A.4-15 T 6A.4-16 T 6A.4-17 F 6A 4-1 F 6A.4-2 F 6A.4-3 F 6A.4-4 F 6A.4-5 F 6A.4-6 F 6A.4-7 F 6A.4-8 F 6A.4-9 F 6A.4-10 F 6A.4-11 F 6A.4-12 F 6A.4-13 F 6A.4-14 F 6A.4-15 F 6A.4-16 F 6A 4-17 F 6A.4-18 F 6A.4-19 F 6A.4-20 F 6A.4-21 F 6A.4-22 F 6A.4-23 F 6A.4-24 F 6A.4-25 F 6A.4-26 F 6A.4-27 F 6A.4-28 F 6A.4-29 F 6A.4-30 F 6A.4-31 F 6A.4-32 F 6A.4-33 F 6A.4-34 F 6A.4-35 F 6A.4-36 S11 3 Sb 1 S?1 2 A17 AOO AOO AOO A17 A17 A17 A17 AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO AOO A17 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO c F 6A.4-37 F 6A.4-38 F 6A.4-39 F 6A.4-40 F 6A.4-41 F 6A.4-42 F 6A.4-43 F 6A.4-44 F 6A.4-45 F 6A.4-46 F 6A.4-47 F 6A.4-48 F 6A.4-49 F 6A.4-50 F 6A.4-51 F 6A.4-52 F 6A.4-53 F 6A.4-54 F 6A.4-55 F 6A.4-56 F 6A.4-57 6A.5-1 6A.5-2 6A.5-2a 6A.5-2b 6A.5-3 6A.5-3a 6A.5-3b 6A.5-4 6A.5-4a 6A.5-4b 6A.5-5 6A.5-6 T 6A.5-1 T 6A.5-2 Sh T 6A.5-2 Sh T 6A.5-3 T 6A.5-4 Sh T 6A.5-4 Sh T 6A.5-5 T 6A.5-6 S11 T 6A.5-6 Sh T 6A.5-7 T 6A.5-8 Sh ROO AOO R02 ROO ROO ROO AOO AOO AOO ROO ROO R01 ROO A21 A25 A21 A21 A21 A21 A21 A21 AOO R04 A07 A05 A07 A07 A07 A07 A07 A07 A07 AOO A26 A26 A26 A23 A24 A07 A07 A24 A07 A07 A07 T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6A.5-8 Sh 6A.5-1 6A.5-2 6A.5-3 6A.5-4 6A.5-5 6A.5-6 6A.5-7 6A.5-8 6A.5-9 6A.5-10 6A.5-11 6A.5-12 6A.5-13 6A.5-14 6A.5-15 6A.5-16 6A.5-17 6A.5-18 6A.5-19 6A.5-20 6A 5-21 6A.5-22 6A.5-23 6A.5-24 6A.5-25 6A.5-26 6A.5-27 6A.5-28 6A.5-29 6A.5-30 6A.5-31 6A.5-32 6A.5-33 6A.5-34 6A.5-35 6A.5-36 6A.5-37 6A.5-38 6A.5-39 6A.5-40 6A.5-41 6A.5-42 6A.5-43 A07 AOO AOO AOO'OO AOO R04 AOO AOO AOO AOO AOO A23 AOO AOO AOO AOO AOO AOO AOO A16 AOO AOO AOO AOO AOO A23 A23 A23 A23 A23 A23 AOO A23 A23 AOO AOO A23 A23 A23 A23 A23 A23 A23 USAR Revision 4 DAR-3 October 1992


NineMilePointUnit2DARLISTOFEFFECTIVE PAGESDESIGNASSESSMENT REPORTAPPENDIX6APageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure Number6A.6-16A.6-26A.6-36A.6-4T6A.6-1T6A~6-2T6A.6-2F6A.6-1F6A.6-2F6A.6-3F6A.6-4F6A.6-5F6A.6-6F6A.6-76A.7-16A.7-26A.7-36A.7-46A.7-56A.7-5a6A.7-5b6A.7-66A.7-7T6A.7-1T6A.7-2F6A.7-16A.8-16A.8-26A.9-16A.9-26A.9-36A.9-46A.9-4a6A.9-4b6A.9-56A.9-66A.9-76A.9-86A.9-96A.9-9a6A.9-9b6A.9-10S?I1S?12R04R04R04AOOA23A23A23R04R04R04R04R04R04R04R04A07R04R04A23A07A07A23A23R04A23AOOAOOAOOAOOAOOR02ROOROOROOA27ROOROOA20A20A20A20A206A.9-116A.9-11al 6A.9-11b1 6A.9-11a6A.9-1lb6A.9-11c6A.9-11d6A.9-1le6A.9-11f6A.9-12T6A.9-1T6A.9-2T6A.9-2aT6A.9-2bT6A.9-3T6A.9-4T6A.9-5T6A.9-6T6A.9-7F6A.9-1F6A.9-2F6A.9-36A.10-16A.10-26A.10-36A.10-46A.10-56A.10-66A.10-76A.10-86A.10-96A.10-9a6A.10-9b6A.10-10T6A.10-1T6A.10-2Sh1T6A.10-2S?12T6A.10-3T6A.10-4T6A.10-5T6A.10-6T6A.10-7T6A.10-8T6A.10-9A20A20A20A09A09A09A09A09A09A23R01ROOROOROOROOROOR03ROOROOA23A23A23R01ROOA21A22A21A21A21A21ROOA24A24ROOROOROOROOA21A21A21A21R01A21A21F6A.10-1F6A.10-2F6A.10-3F6A.10-4F6A.10-5F6A.10-6F6A.10-7F6A.10-8F6A.10-9F6A.10-10F6A.10-11F6A.10-12F6A.10-13F6A.10-14F6A.10-15F6A.10-16F6A.10-17F6A.10-18F6A.10-19F6A.10-20A21ROOROOROOROOROOROOROOROOROOR01R01R01A22A22A22A22A22A22A22USARRevision4DAR-4October1992 I-1 NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESAPPENDIXRREVIEWSAFESHUTDOWNANALYSISAPPENDIX9BPageT=TableAmendment F=FicFure NumberPageT=TableAmendment F=FicFure NumberPageT=TableF=FicFure Amendment Number9B-i9B-ia9B-ib9B-ii9B-iii9B-iv9B.1-19B.2-19B.2-29B.2-39B.3-19B.4-19B.4-29B.4-39B.4-49B.4-59B.4-69B.4-79B.4-8F9B.4-1F9B.4-29B.5-19B.5-29B.5-39B.5-49B.5-5T9B.5-19B.6-19B.6-29B.6-39B.6-4T9B.6-1ShT9B.6-1ShT9B.6-1ShT9B.6-1ShT9B.6-1ShT9B.6-1ShT9B.6-2A24A24A23ROOA24A12A23R02R02R02A23A04A22R02R02R02R02A04A22A22R02ROOA04A04A21A23ROOR02R02R02AllA28A28ROOR03ROOROOAllT9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3T9B.6-3F9B.6-1F9B.6-2F9B.6-3F9B.6-4F9B.6-5F9B.6-69B.7-19B.8-19B.8-29B.8-39B.8-49B.8-59B.8-5a9B.8-5b9B.8-69B.8-7T9B.8-1T9B.8-1T9B.8-1T9B.8-1T9B.8-1T9B-8-1T9B.8-1T9B.8-1T9B~8-1T9B.8-1T9B.8-1T9B.8-1T9B.8-1'T9B.8-1T9B.8-1T9B.8-1Sh1Sh2Sh3Sh4Sh5Sh6,Sh7Sh7aSh8Sh9Sh1Sh2Sh2aSh3Sh4Sh5Sh5aSh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14A23AllROOAllROOAllA23ROOR03AllA04AllAllAllAllAllA23ROOA23RolA23RolRolROOA25R02ROOR04R02R02R03R02R02AllA28R02A28ROGR02R02R02AllTTTTTTTTTTTTTTTTTTTTTTTTTTT9B.8-1T9B.8-1T.9B.8-19B.8-19B.8-19B.8-19B.8-1TTTTTT9B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-.19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B~8-19B.8-19B.8-19B~8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-1Sh15Sh16Sh17Sh18Sh19Sh20Sh21Sh22Sh23Sh24Sh25Sh26Sh27Sh28Sh29Sh30Sh30aSh31Sh32Sh33Sh34Sh35Sh36Sh37Sh38Sh39Sh40Sh41Sh42Sh43Sh44Sh45Sh46Sh47Sh48Sh49Sh50Sh51Sh52Sh53Sh54Sh55Sh56Sh57'OOR02AllROOAllA28A28A28A28A28A28R02R02R02R02R02R02R02R02ROOA28A28A23A23A23A23A23A23A23A23A23A23R02A23A23A23A23R03R02R03R02R02A19A19USARRevision4SSA-1October1992 0
Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 6A.6-1 6A.6-2 6A.6-3 6A.6-4 T 6A.6-1 T 6A~6-2 T 6A.6-2 F 6A.6-1 F 6A.6-2 F 6A.6-3 F 6A.6-4 F 6A.6-5 F 6A.6-6 F 6A.6-7 6A.7-1 6A.7-2 6A.7-3 6A.7-4 6A.7-5 6A.7-5a 6A.7-5b 6A.7-6 6A.7-7 T 6A.7-1 T 6A.7-2 F 6A.7-1 6A.8-1 6A.8-2 6A.9-1 6A.9-2 6A.9-3 6A.9-4 6A.9-4a 6A.9-4b 6A.9-5 6A.9-6 6A.9-7 6A.9-8 6A.9-9 6A.9-9a 6A.9-9b 6A.9-10 S?I 1 S?1 2 R04 R04 R04 AOO A23 A23 A23 R04 R04 R04 R04 R04 R04 R04 R04 A07 R04 R04 A23 A07 A07 A23 A23 R04 A23 AOO AOO AOO AOO AOO R02 ROO ROO ROO A27 ROO ROO A20 A20 A20 A20 A20 6A.9-11 6A.9-11al 6A.9-11b1 6A.9-11a 6A.9-1lb 6A.9-11c 6A.9-11d 6A.9-1le 6A.9-11f 6A.9-12 T 6A.9-1 T 6A.9-2 T 6A.9-2a T 6A.9-2b T 6A.9-3 T 6A.9-4 T 6A.9-5 T 6A.9-6 T 6A.9-7 F 6A.9-1 F 6A.9-2 F 6A.9-3 6A.10-1 6A.10-2 6A.10-3 6A.10-4 6A.10-5 6A.10-6 6A.10-7 6A.10-8 6A.10-9 6A.10-9a 6A.10-9b 6A.10-10 T 6A.10-1 T 6A.10-2 Sh 1 T 6A.10-2 S?1 2 T 6A.10-3 T 6A.10-4 T 6A.10-5 T 6A.10-6 T 6A.10-7 T 6A.10-8 T 6A.10-9 A20 A20 A20 A09 A09 A09 A09 A09 A09 A23 R01 ROO ROO ROO ROO ROO R03 ROO ROO A23 A23 A23 R01 ROO A21 A22 A21 A21 A21 A21 ROO A24 A24 ROO ROO ROO ROO A21 A21 A21 A21 R01 A21 A21 F 6A.10-1 F 6A.10-2 F 6A.10-3 F 6A.10-4 F 6A.10-5 F 6A.10-6 F 6A.10-7 F 6A.10-8 F 6A.10-9 F 6A.10-10 F 6A.10-11 F 6A.10-12 F 6A.10-13 F 6A.10-14 F 6A.10-15 F 6A.10-16 F 6A.10-17 F 6A.10-18 F 6A.10-19 F 6A.10-20 A21 ROO ROO ROO ROO ROO ROO ROO ROO ROO R01 R01 R01 A22 A22 A22 A22 A22 A22 A22 USAR Revision 4 DAR-4 October 1992 I-1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX R REVIEW SAFE SHUTDOWN ANALYSIS APPENDIX 9B Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number 9B-i 9B-ia 9B-ib 9B-ii 9B-iii 9B-iv 9B.1-1 9B.2-1 9B.2-2 9B.2-3 9B.3-1 9B.4-1 9B.4-2 9B.4-3 9B.4-4 9B.4-5 9B.4-6 9B.4-7 9B.4-8 F 9B.4-1 F 9B.4-2 9B.5-1 9B.5-2 9B.5-3 9B.5-4 9B.5-5 T 9B.5-1 9B.6-1 9B.6-2 9B.6-3 9B.6-4 T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-2 A24 A24 A23 ROO A24 A12 A23 R02 R02 R02 A23 A04 A22 R02 R02 R02 R02 A04 A22 A22 R02 ROO A04 A04 A21 A23 ROO R02 R02 R02 All A28 A28 ROO R03 ROO ROO All T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 F 9B.6-1 F 9B.6-2 F 9B.6-3 F 9B.6-4 F 9B.6-5 F 9B.6-6 9B.7-1 9B.8-1 9B.8-2 9B.8-3 9B.8-4 9B.8-5 9B.8-5a 9B.8-5b 9B.8-6 9B.8-7 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B-8-1 T 9B.8-1 T 9B.8-1 T 9B~8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1'T 9B.8-1 T 9B.8-1 T 9B.8-1 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6, Sh 7 Sh 7a Sh 8 Sh 9 Sh 1 Sh 2 Sh 2a Sh 3 Sh 4 Sh 5 Sh 5a Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 A23 All ROO All ROO All A23 ROO R03 All A04 All All All All All A23 ROO A23 Rol A23 Rol Rol ROO A25 R02 ROO R04 R02 R02 R03 R02 R02 All A28 R02 A28 ROG R02 R02 R02 All T T T T T T T T T T T T T T T T T T T T T T T T T T T 9B.8-1 T 9B.8-1 T.9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 T T T T T T 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-.1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B~8-1 9B.8-1 9B.8-1 9B~8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 30a Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57'OO R02 All ROO All A28 A28 A28 A28 A28 A28 R02 R02 R02 R02 R02 R02 R02 R02 ROO A28 A28 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 R02 A23 A23 A23 A23 R03 R02 R03 R02 R02 A19 A19 USAR Revision 4 SSA-1 October 1992 0
NineMilePointUnit2FSARLISTOFEFFECTIVE PAGESAPPENDIXRREVIEWSAFESHUTDOWNANALYSISAPPENDIX9BPageT=TableF=FicFUFe Amendment NumberPageT=TableF=FicFure Amendment NumberPageT=TableAmendment F=FicFure NumberTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT-TTTTTTTTTT9B.8-19B.8-19B.8-19B.8-19B.8-19B8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-19B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-29B.8-2Sh58Sh59Sh60Sh60aSh61Sh62Sh63Sh64Sh65Sh66Sh66aSh67Sh68Sh69Sh70Sh71Sh72Sh73Sh73aSh74Sh75Sh75aSh75bSh1Sh2Sh3Sh4Sh5Sh6Sh7Sh8Sh9Sh10Sh11Sh12Sh13Sh14Sh15Sh16Sh17Sh18Sh19Sh20Sh21ROOA11ROOROOR02R02R02R02R02R02R02R02ROOR02R02R02R02R02ROOR02ROOR02R02R02R02A28A11A28R02A28A11R02A11A11A11A28A28A28A28,A28A28R02R02ROOT9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-2T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-3T9B.8-39B.9-1Sh22ROOSh23ROOSh24ROOSh25A28Sh26A28Sh27A28Sh28A23Sh29A23Sh29aA23Sh29bA23Sh29cA23Sh29dA23Sh29eA23Sh291A23Sh30A11Sh31R03Sh32ROOSh33A23Sh33aA23Sh34ROOSh34aROOSh35A11Sh36A23Sh37R02Sh38ROOSh38aA23Sh38bR01Sh1R03Sh2ROOSh3ROOSh4ROOSh5ROOSh5aROOSh6ROOSh7ROOSh8ROOSh9ROOSh10ROOSh11A23Sh12ROOSh13R01Sh14ROOR029B.10-19B.11-19B.12-19B.12-29B.12-39B.12-49B.12-59B.12-69B.12-79B.12-89B.12-99B.12-109B.12-11ROOA21ROOROOROOROOROOROOROOROOROOROOROOUSARRevision4SSA-2October1992 0
Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX R REVIEW SAFE SHUTDOWN ANALYSIS APPENDIX 9B Page T=Table F=FicFUFe Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T-T T T T T T T T T T 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B 8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 Sh 58 Sh 59 Sh 60 Sh 60a Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 66a Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 73a Sh 74 Sh 75 Sh 75a Sh 75b Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 ROO A11 ROO ROO R02 R02 R02 R02 R02 R02 R02 R02 ROO R02 R02 R02 R02 R02 ROO R02 ROO R02 R02 R02 R02 A28 A11 A28 R02 A28 A11 R02 A11 A11 A11 A28 A28 A28 A28, A28 A28 R02 R02 ROO T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 9B.9-1 Sh 22 ROO Sh 23 ROO Sh 24 ROO Sh 25 A28 Sh 26 A28 Sh 27 A28 Sh 28 A23 Sh 29 A23 Sh 29a A23 Sh 29b A23 Sh 29c A23 Sh 29d A23 Sh 29e A23 Sh 291 A23 Sh 30 A11 Sh 31 R03 Sh 32 ROO Sh 33 A23 Sh 33a A23 Sh 34 ROO Sh 34a ROO Sh 35 A11 Sh 36 A23 Sh 37 R02 Sh 38 ROO Sh 38a A23 Sh 38b R01 Sh 1 R03 Sh 2 ROO Sh 3 ROO Sh 4 ROO Sh 5 ROO Sh 5a ROO Sh 6 ROO Sh 7 ROO Sh 8 ROO Sh 9 ROO Sh 10 ROO Sh 11 A23 Sh 12 ROO Sh 13 R01 Sh 14 ROO R02 9B.10-1 9B.11-1 9B.12-1 9B.12-2 9B.12-3 9B.12-4 9B.12-5 9B.12-6 9B.12-7 9B.12-8 9B.12-9 9B.12-10 9B.12-11 ROO A21 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 SSA-2 October 1992 0
EDFKTYININEMILEPOINTNUCLEARSTATION-UNIT27NIAGARAUMOHAWKVOL.1  
ED FKTY I NINE MILE POINT NUCLEAR STATION-UNIT 2 7 NIAGARA U MOHAWK VOL.1  


NineMilePointUnit2FSARTABLEOFCONTENTS(Cont)Section5.35.4Appendixes CHAPTER66.16.26.36.46.56.6Appendixes CHAPTER77.17'7.37.47.57'7~7Appendixes CHAPTER88.18.28.3Appendix8ACHAPTER9TitleReactorVesselComponent andSubsystem Design5Ag5BENGINEERED SAFETYFEATURESEngineered SafetyFeatureMaterials Containment Systems'mergency CoreCoolingSystemsHabitability SystemsFissionProductRemovalandControlSystemsInservice Inspection ofSafetyClass2andClass3Components through6CINSTRUMENTATION ANDCONTROLSYSTEMSIntroduction ReactorProtection (Trip)System(RPS)Instrumentation andControlsEngineered SafetyFeatureSystemsSystemsRequiredforSafeShutdownSafety-Related DisplayInstrumentation AllOtherInstrumentation SystemsRequiredforSafetyControlSystemsNotRequiredforSafety7Ag7BELECTRICPOWERIntroduction OffsitePowerSystemOnsitePowerSystemAUXILIARY SYSTEMSVolume1313131313141515151515151515161616161616161616,1717I179.19.29.39.49.5Appendixes FuelStorageandHandlingWaterSystemsProcessAuxiliaries AirConditioning, Heating,Cooling,andVentilation SystemsOtherAuxiliary Systems9Ag9C17181920,2121,22IUSARRevisionApril1989 NineMilePointUnit2FSARTABLEOFCONTENTS(Cont'd)SectionTitleVolumeCHAPTER10STEAMANDPOWERCONVERSION SYSTEM2310.110.210.310.4SummaryDescription TurbineGenerator MainSteamSupplySystemOtherFeaturesofSteamandPowerConversion System232324CHAPTER11RADIOACTIVE WASTEMANAGEMENT 2411.111.211.311.411.5Appendix11ASourceTermsLiquidWasteManagement SystemsGaseousWasteManagement SystemsSolidWasteManagement SystemProcessandEffluentRadiological Monitoring andSamplingSystems242425252525CHAPTER12RADIATION PROTECTION 2512.112.212.3EnsuringThatOccupational Radiation Exposures AreAsLowAsReasonably Achievable (ALARA)Radiation SourcesRadiation Protection DesignFeaturesDoseAssessment Radiation Protection Program2525252626CHAPTER13CONDUCTOFOPERATIONS 2613.113.213.313.413.513.6Appendix13AOrganizational Structure ofApplicant TrainingSiteEmergency PlanOperation ReviewandAuditPlantProcedures Industrial Security26262626262626CHAPTER14INITIALTESTPROGRAM2614.1SpecificInformation ToBeIncludedinPreliminary SafetyAnalysisReport(PSAR)26USARRevisionivOctober1991 NineMilePointUnit2FSARTABLEOFCONTENTS(Cont'd)SectionTitleVolume14.2CHAPTER15SpecificInformation ToBeIncludedinFinalSafetyAnalysisReport(FSAR)ACCIDENTANALYSIS26r272715.015.1GeneralDecreaseinReactorCoolantTemperature 15.2IncreaseinReactorPressure15.3DecreaseinReactorCoolantSystemFlowRate15.4Reactivity andPowerDistribution Anomalies 15.5IncreaseinReactorCoolantInventory 15.6DecreaseinReactorCoolantInventory 15.7Radioactive ReleaseFromSubsystems orComponents 15.8Anticipated Transients withoutScram(ATWS)Appendices 15Athrough15H27272727272727272728CHAPTER16CHAPTER1717.017.117.2CHAPTER18TECHNICAL SPECIFICATIONS QUALITYASSURANCE Introduction QualityAssurance ProgramDuringOperation QualityAssurance ProgramDuringtheOperations PhaseHUMANFACTORSENGINEERING/SAFETY P2QMMETER DISPLAYSYSTEM28282828282818.118.2APPENDIXADetailedControlRoomDesignReviewSafetyParameter DisplaySystemRELOADANALYSIS282828USARRevision3October1991
Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont)Section 5.3 5.4 Appendixes CHAPTER 6 6.1 6.2 6.3 6.4 6.5 6.6 Appendixes CHAPTER 7 7.1 7'7.3 7.4 7.5 7'7~7 Appendixes CHAPTER 8 8.1 8.2 8.3 Appendix 8A CHAPTER 9 Title Reactor Vessel Component and Subsystem Design 5Ag 5B ENGINEERED SAFETY FEATURES Engineered Safety Feature Materials Containment Systems'mergency Core Cooling Systems Habitability Systems Fission Product Removal and Control Systems Inservice Inspection of Safety Class 2 and Class 3 Components through 6C INSTRUMENTATION AND CONTROL SYSTEMS Introduction Reactor Protection (Trip)System (RPS)Instrumentation and Controls Engineered Safety Feature Systems Systems Required for Safe Shutdown Safety-Related Display Instrumentation All Other Instrumentation Systems Required for Safety Control Systems Not Required for Safety 7Ag 7B ELECTRIC POWER Introduction Offsite Power System Onsite Power System AUXILIARY SYSTEMS Volume 13 13 13 13 13 14 15 15 15 15 15 15 15 15 16 16 16 16 16 16 16 16 16,17 17 I 17 9.1 9.2 9.3 9.4 9.5 Appendixes Fuel Storage and Handling Water Systems Process Auxiliaries Air Conditioning, Heating, Cooling, and Ventilation Systems Other Auxiliary Systems 9Ag 9C 17 18 19 20,21 21,22 I USAR Revision April 1989 Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont'd)Section Title Volume CHAPTER 10 STEAM AND POWER CONVERSION SYSTEM 23 10.1 10.2 10.3 10.4 Summary Description Turbine Generator Main Steam Supply System Other Features of Steam and Power Conversion System 23 23 24 CHAPTER 11 RADIOACTIVE WASTE MANAGEMENT 24 11.1 11.2 11.3 11.4 11.5 Appendix 11A Source Terms Liquid Waste Management Systems Gaseous Waste Management Systems Solid Waste Management System Process and Effluent Radiological Monitoring and Sampling Systems 24 24 25 25 25 25 CHAPTER 12 RADIATION PROTECTION 25 12.1 12.2 12.3 Ensuring That Occupational Radiation Exposures Are As Low As Reasonably Achievable (ALARA)Radiation Sources Radiation Protection Design Features Dose Assessment Radiation Protection Program 25 25 25 26 26 CHAPTER 13 CONDUCT OF OPERATIONS 26 13.1 13.2 13.3 13.4 13.5 13.6 Appendix 13A Organizational Structure of Applicant Training Site Emergency Plan Operation Review and Audit Plant Procedures Industrial Security 26 26 26 26 26 26 26 CHAPTER 14 INITIAL TEST PROGRAM 26 14.1 Specific Information To Be Included in Preliminary Safety Analysis Report (PSAR)26 USAR Revision iv October 1991 Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont'd)Section Title Volume 14.2 CHAPTER 15 Specific Information To Be Included in Final Safety Analysis Report (FSAR)ACCIDENT ANALYSIS 26r 27 27 15.0 15.1 General Decrease in Reactor Coolant Temperature 15.2 Increase in Reactor Pressure 15.3 Decrease in Reactor Coolant System Flow Rate 15.4 Reactivity and Power Distribution Anomalies 15.5 Increase in Reactor Coolant Inventory 15.6 Decrease in Reactor Coolant Inventory 15.7 Radioactive Release From Subsystems or Components 15.8 Anticipated Transients without Scram (ATWS)Appendices 15A through 15H 27 27 27 27 27 27 27 27 27 28 CHAPTER 16 CHAPTER 17 17.0 17.1 17.2 CHAPTER 18 TECHNICAL SPECIFICATIONS QUALITY ASSURANCE Introduction Quality Assurance Program During Operation Quality Assurance Program During the Operations Phase HUMAN FACTORS ENGINEERING/SAFETY P2QMMETER DISPLAY SYSTEM 28 28 28 28 28 28 18.1 18.2 APPENDIX A Detailed Control Room Design Review Safety Parameter Display System RELOAD ANALYSIS 28 28 28 USAR Revision 3 October 1991


NineMilePointUnit2FSARCHAPTER1INTRODUCTION ANDGENERALDESCRIPTION OFPLANTTABLEOFCONTENTSSectionTitleINTRODUCTION Pacae1.1-11.21.2.11.2.11.2.11.2.11.F11.2.11.2.11.2.1.1.2.2.1.3.3.1.3.2.3.31.2.1.3.8 1.2.21.2:2.11.2.2.21.2.2.31.2.31.2.41.2.4.11.2.4.21.2'.31.2.4.41.2.4.51.2.4.61.2.51.2.5.11.2.5.21~2'.31.2.1~3.41.2.1.3.5 1.2.1.3.6 1.'2.1.3.7 GENERALPLANTDESCRIPTION Principal DesignCriteriaGeneralCriteriaPowerGeneration DesignCriteriaSafetyDesignCriteriaSystem-by-System ApproachNuclearSystemCriteriaPowerConversion SystemsCriteriaElectrical PowerSystemsDesignCriteriaRadwasteSystemDesignCriteriaAuxiliary SystemsDesignCriteriaShielding andAccessControlDesignCriteriaNuclearSafetySystemsandEngineered Safeguards DesignCriteriaProcessControlSystemDesignCriteriaSiteDescription SiteCharacteristics:
Nine Mile Point Unit 2 FSAR CHAPTER 1 INTRODUCTION AND GENERAL DESCRIPTION OF PLANT TABLE OF CONTENTS Section Title INTRODUCTION Pacae 1.1-1 1.2 1.2.1 1.2.1 1.2.1 1.2.1 1.F 1 1.2.1 1.2.1 1.2.1.1.2.2.1.3.3.1.3.2.3.3 1.2.1.3.8 1.2.2 1.2:2.1 1.2.2.2 1.2.2.3 1.2.3 1.2.4 1.2.4.1 1.2.4.2 1.2'.3 1.2.4.4 1.2.4.5 1.2.4.6 1.2.5 1.2.5.1 1.2.5.2 1~2'.3 1.2.1~3.4 1.2.1.3.5 1.2.1.3.6 1.'2.1.3.7 GENERAL PLANT DESCRIPTION Principal Design Criteria General Criteria Power Generation Design Criteria Safety Design Criteria System-by-System Approach Nuclear System Criteria Power Conversion Systems Criteria Electrical Power Systems Design Criteria Radwaste System Design Criteria Auxiliary Systems Design Criteria Shielding and Access Control Design Criteria Nuclear Safety Systems and Engineered Safeguards Design Criteria Process Control System Design Criteria Site Description Site Characteristics:
SiteLocationandSizeAccesstotheSiteDescription oftheSiteandEnvironsStructures andEquipment NuclearSteamSupplySystemReactorCoreandControlRodsReactorVesselandInternals ReactorRecirculation SystemResidualHeatRemovalSystemReactorWaterCleanupSystemNuclearLeakDetection SystemElectrical, Instrumentation, andContr'olSystemsElectrical PowerSystemNuclearSystemProcessControlandInstrumentation PowerConversion SystemsProcessControlandInstrumentation 1~2-11~21l.2-11~231.2-41~2-71.2-71.2-81.2-91.2-91.2-91.2-91.2-101.2-101.2-121.2-121.2-121.2-131.2-131.2-151.2-151.2-161.2-171.2-171.2-171.2-181.2-181.2-181.2-201.2-21Amendment 24February1986 NineMilePointUnit2FSARCHAPTER1TABLEOFCONTENTS(Cont)Section1.21.21.21.21.21.2~6.7.7.1.7.2.7.3.7.41.21.21~21~21.21.21.2.8.8.1.8.2.8.3.8.4.8.5~8.61.21.21.21~2.8.7~8.8.8.9.91.21~21.21.21.21.21~21.21.21.2.9.1.9.2.9.3.9.4.9.5.9.6.9.7.9.8.9.9.9.101.21.21.2.9.11.9.12.9.131.2.9.141.2.9'51.2.9.181.2.9.161.2.9.17TitleRadioactive WasteSystemFuelHandlingandStorageSystemsNewFuelStorageSpentFuelStorageFuelHandlingSystemSpentFuelPoolCoolingandCleanupSystemPowerConversion SystemTurbineGenerator MainSteamSystemMainCondenser MainCondenser AirRemovalSystemTurbineGlandSealingSystemSteamBypassSystemandPressureControlSystemCirculating WaterSystemCondensate andFeedwater SystemsCondensate Demineralizer SystemNuclearSafetySystemsandEngineered
Site Location and Size Access to the Site Description of the Site and Environs Structures and Equipment Nuclear Steam Supply System Reactor Core and Control Rods Reactor Vessel and Internals Reactor Recirculation System Residual Heat Removal System Reactor Water Cleanup System Nuclear Leak Detection System Electrical, Instrumentation, and Contr'ol Systems Electrical Power System Nuclear System Process Control and Instrumentation Power Conversion Systems Process Control and Instrumentation 1~2-1 1~2 1 l.2-1 1~2 3 1.2-4 1~2-7 1.2-7 1.2-8 1.2-9 1.2-9 1.2-9 1.2-9 1.2-10 1.2-10 1.2-12 1.2-12 1.2-12 1.2-13 1.2-13 1.2-15 1.2-15 1.2-16 1.2-17 1.2-17 1.2-17 1.2-18 1.2-18 1.2-18 1.2-20 1.2-21 Amendment 24 February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABLE OF CONTENTS (Cont)Section 1.2 1.2 1.2 1.2 1.2 1.2~6.7.7.1.7.2.7.3.7.4 1.2 1.2 1~2 1~2 1.2 1.2 1.2.8.8.1.8.2.8.3.8.4.8.5~8.6 1.2 1.2 1.2 1~2.8.7~8.8.8.9.9 1.2 1~2 1.2 1.2 1.2 1.2 1~2 1.2 1.2 1.2.9.1.9.2.9.3.9.4.9.5.9.6.9.7.9.8.9.9.9.10 1.2 1.2 1.2.9.11.9.12.9.13 1.2.9.14 1.2.9'5 1.2.9.18 1.2.9.16 1.2.9.17 Title Radioactive Waste System Fuel Handling and Storage Systems New Fuel Storage Spent Fuel Storage Fuel Handling System Spent Fuel Pool Cooling and Cleanup System Power Conversion System Turbine Generator Main Steam System Main Condenser Main Condenser Air Removal System Turbine Gland Sealing System Steam Bypass System and Pressure Control System Circulating Water System Condensate and Feedwater Systems Condensate Demineralizer System Nuclear Safety Systems and Engineered
'SafetyFeaturesReactorProtection SystemNeutronMonitoring SystemControlRodDriveSystemControlRodDriveHousingSupportsControlRodVelocityLimiterNuclearSystemPressureReliefSystemReactorCoreIsolation CoolingSystemEmergency CoreCoolingSystemsContainment SystemsContainment andReactorVesselIsolation Control.SystemMainSteamIsolation ValvesMainSteamFlowRestrictors MainSteamRadiation Monitoring SystemResidualHeatRemovalSystemVentilation ExhaustRadiation Monitoring SystemStandbyGasTreatment SystemSafety-Related Electrical PowerSystemsStandbyLiquidControlSystemPa<ac1.2-221.2-231.2-231.2-231.2-241.2-241.2-241.2-241.2-,251.2-251.2-251.2-251.2-261.2-261.2-26l.2-261.2-271~2271.2-271.2-271.2-271.2-281.2-281.2-281.2-281.2-291'-301.2-301.2-31l.2-311.2-311.2-321.2-321.2-321.2-33Amendment 241-iiFebruary1986 NineMilePointUnit2FSARCHAPTER1TABIEOFCONTENTS(Cont)Section1.2.9.191.2.9.201.2.9.211.2.101.2.10.11.2.10.21.2.10.31.2.10.41.2.10.51.2.10'1.2.10.71.2.10.81.2.10.91.2.10.10 1.2.10.11 1.2.10.12 1.2.10.13 1.2.10.14 1.2.10.15 1.2.10'61~2~111.31.3.11.3.21.3'1.41.4.11.4.21.4.31.4.4TitleSafeShutdownfromOutsidetheControlRoomMainControlRoomHeating,Ventilating andAirConditioning SystemRedundant Reactivity ControlSystemCoolingWaterandAuxiliary SystemsReactorBuildingClosedLoopCoolingWaterSystemTurbineBuildingClosedLoopCoolingWaterSystemServiceWaterSystemUltimateHeatSinkPlantChilledWaterSystemHeating,Ventilating, andAirConditioning SystemsProcessSamplingCondensate MakeupandDrawoffSystemWaterTreatment andMakeupWater'Systems DomesticWaterandSanitaryDrainsandDisposalSystemsCompressed AirSystemsAuxiliary SteamSystemStandbyDieselGenerator FuelOilStorage,andTransferSystemFireProtection SystemCommunication SystemsLightingSystemsReferences COMPARISON TABLESComparison withSimilarFacilityDesignsComparison ofFinalandPreliminary Information Reference IDENTIFICATION OFAGENTSANDCONTRACTORS Applicant Architect-Engineer NuclearSteamSupplySystemTurbineGenerator SupplierPa<ac1.2-331.2-331.2-331.2-341.2-341.2-341.2-341.2-341.2-341.2-351.2-351.2-351.2-351.2-361.2-361.2-371~2371~2371~2-371'-381.2-41'~311.3-11~31l.3-1I1.4-11.4-11.4-21.4-31.4-4Amendment 241iiiFebruary1986 NineMilePointUnit2FSARCHAPTER1TABLEOFCONTENTS(Cont)Section1.4.51.4.6TitleTechnical Consultants Reference Pacae1.4-41.4-824241.51.5.11.5.1.11.5.1.21.5.1.31.5.1.41.5.1.51.5.21.5.31.61.71.7.11.7.21.81.91.101.11l.121.12,.11.12.21~13REQUIREMENTS FORFURTHERTECHNICAL INFORMATION CurrentBWRDevelopment ProgramsInstrumentation forVibration Detection CoreSprayDistribution CoreSprayandCoreFloodingHeatTransferEffectiveness Verification ofPressureSuppression DesignBoilingTransition TestingGeotechnical Investigations References MATERIALINCORPORATED BYREFERENCE DRAWINGSANDOTHERDETAILEDINFORMATION Electrical, Instrumentation,,and ControlDrawingsPipingandInstrumentation DrawingsCONFORMANCE TONRCREGULATORY GUIDESSTANDARDREVIEWPLANCONFORMANCE TOACCEPTANCE CRITERIAUNIT2RESPONSETOREGULATORY ISSUESRESULTING FROMTMIABBREVIATIONS ANDACRONYMSGENERICLICENSING ISSUESIntroduction Iicensing IssuesUNIT2POSITIONONUNRESOLVED SAFETYISSUES1.5-11.5-11.5-11.5-11.5-11.5-21.5-31.5-31.5-51.6-11.7-11.7-11.7-11.8-11.9-11.10-11.11-11;12-11.12-11.12-11.13-1Amendment 241-3.VFebruary1986 NineMilePointUnit2FSARCHAPTER,1INTRODUCTION ANDGENERALDESCRIPTION OFTHEPLANT
'Safety Features Reactor Protection System Neutron Monitoring System Control Rod Drive System Control Rod Drive Housing Supports Control Rod Velocity Limiter Nuclear System Pressure Relief System Reactor Core Isolation Cooling System Emergency Core Cooling Systems Containment Systems Containment and Reactor Vessel Isolation Control.System MainSteam Isolation Valves Main Steam Flow Restrictors Main Steam Radiation Monitoring System Residual Heat Removal System Ventilation Exhaust Radiation Monitoring System Standby Gas Treatment System Safety-Related Electrical Power Systems Standby Liquid Control System Pa<ac 1.2-22 1.2-23 1.2-23 1.2-23 1.2-24 1.2-24 1.2-24 1.2-24 1.2-,25 1.2-25 1.2-25 1.2-25 1.2-26 1.2-26 1.2-26 l.2-26 1.2-27 1~2 2 7 1.2-27 1.2-27 1.2-27 1.2-28 1.2-28 1.2-28 1.2-28 1.2-29 1'-30 1.2-30 1.2-31 l.2-31 1.2-31 1.2-32 1.2-32 1.2-32 1.2-33 Amendment 24 1-ii February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABIE OF CONTENTS (Cont)Section 1.2.9.19 1.2.9.20 1.2.9.21 1.2.10 1.2.10.1 1.2.10.2 1.2.10.3 1.2.10.4 1.2.10.5 1.2.10'1.2.10.7 1.2.10.8 1.2.10.9 1.2.10.10 1.2.10.11 1.2.10.12 1.2.10.13 1.2.10.14 1.2.10.15 1.2.10'6 1~2~11 1.3 1.3.1 1.3.2 1.3'1.4 1.4.1 1.4.2 1.4.3 1.4.4 Title Safe Shutdown from Outside the Control Room Main Control Room Heating, Ventilating and Air Conditioning System Redundant Reactivity Control System Cooling Water and Auxiliary Systems Reactor Building Closed Loop Cooling Water System Turbine Building Closed Loop Cooling Water System Service Water System Ultimate Heat Sink Plant Chilled Water System Heating, Ventilating, and Air Conditioning Systems Process Sampling Condensate Makeup and Drawoff System Water Treatment and Makeup Water'Systems Domestic Water and Sanitary Drains and Disposal Systems Compressed Air Systems Auxiliary Steam System Standby Diesel Generator Fuel Oil Storage, and Transfer System Fire Protection System Communication Systems Lighting Systems References COMPARISON TABLES Comparison with Similar Facility Designs Comparison of Final and Preliminary Information Reference IDENTIFICATION OF AGENTS AND CONTRACTORS Applicant Architect-Engineer Nuclear Steam Supply System Turbine Generator Supplier Pa<ac 1.2-33 1.2-33 1.2-33 1.2-34 1.2-34 1.2-34 1.2-34 1.2-34 1.2-34 1.2-35 1.2-35 1.2-35 1.2-35 1.2-36 1.2-36 1.2-37 1~2 3 7 1~2 3 7 1~2-37 1'-38 1.2-41'~3 1 1.3-1 1~3 1 l.3-1 I 1.4-1 1.4-1 1.4-2 1.4-3 1.4-4 Amendment 24 1 iii February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABLE OF CONTENTS (Cont)Section 1.4.5 1.4.6 Title Technical Consultants Reference Pacae 1.4-4 1.4-8 24 24 1.5 1.5.1 1.5.1.1 1.5.1.2 1.5.1.3 1.5.1.4 1.5.1.5 1.5.2 1.5.3 1.6 1.7 1.7.1 1.7.2 1.8 1.9 1.10 1.11 l.12 1.12,.1 1.12.2 1~13 REQUIREMENTS FOR FURTHER TECHNICAL INFORMATION Current BWR Development Programs Instrumentation for Vibration Detection Core Spray Distribution Core Spray and Core Flooding Heat Transfer Effectiveness Verification of Pressure Suppression Design Boiling Transition Testing Geotechnical Investigations References MATERIAL INCORPORATED BY REFERENCE DRAWINGS AND OTHER DETAILED INFORMATION Electrical, Instrumentation,,and Control Drawings Piping and Instrumentation Drawings CONFORMANCE TO NRC REGULATORY GUIDES STANDARD REVIEW PLAN CONFORMANCE TO ACCEPTANCE CRITERIA UNIT 2 RESPONSE TO REGULATORY ISSUES RESULTING FROM TMI ABBREVIATIONS AND ACRONYMS GENERIC LICENSING ISSUES Introduction Iicensing Issues UNIT 2 POSITION ON UNRESOLVED SAFETY ISSUES 1.5-1 1.5-1 1.5-1 1.5-1 1.5-1 1.5-2 1.5-3 1.5-3 1.5-5 1.6-1 1.7-1 1.7-1 1.7-1 1.8-1 1.9-1 1.10-1 1.11-1 1;12-1 1.12-1 1.12-1 1.13-1 Amendment 24 1-3.V February 1986 Nine Mile Point Unit 2 FSAR CHAPTER, 1 INTRODUCTION AND GENERAL DESCRIPTION OF THE PLANT


==1.1INTRODUCTION==
==1.1 INTRODUCTION==


ThisFinalSafetyAnalysisReport(FSAR)issubmitted bytheNiagaraMohawkPowerCorporation (Applicant) anditsco-owners (CentralHudsonGasandElectricCorporation, LongIslandLightingCompany,NewYorkStateElectricandGasCorporation, andRochester GasandElectricCorporation) insupportoftheapplication foraClass103operating licensefor0henuclearpowerstationdesignated NineMilePointNuclearStation-Unit2(Unit2).Unit2islocatedona364-ha(900-acre) siteownedbyNiagaraMohawkPowerCorporation (NMPC),andissituatedonthesoutheast shoreofLakeOntario,OswegoCounty,NY,approximately 10km(6.2mi)northeast ofthecityofOswego.Unit,2andsupportfacilities occupyabout18.2ha(45acres),andsharethesitewiththeexistingUnit1(DocketNo.50-220)whichhasbeenincommercial operation since1969.,TheNineMilePointsiteisadjacenttotheJamesA.FitzPatrick NuclearPowerPlantownedbytheNYPA;Unit2islocated274m(900ft)eastofNine'MilePointUnit1andabout716m(2,350ft)westoftheJamesA.FitzPatrick Plant.Unit2employsanuclearsteamsupplysystem(NSSS)consisting ofasinglecycle,forcedcirculating boilingwaterreactor(BWR).Theplantratedcorethermalpowerlevel(Figure1.1-1-)is3,323MWtcorresponding toanetelectrical outputof1,080MWe,anddesignthermalpowerof3,463MWtcorresponding toagrosselectrical outputof1,202MWe.Thethermalpowerusedfortheplanttransient andloss-of-coolant
This Final Safety Analysis Report (FSAR)is submitted by the Niagara Mohawk Power Corporation (Applicant) and its co-owners (Central Hudson Gas and Electric Corporation, Long Island Lighting Company, New York State Electric and Gas Corporation, and Rochester Gas and Electric Corporation) in support of the application for a Class 103 operating license for 0he nuclear power station designated Nine Mile Point Nuclear Station-Unit 2 (Unit 2).Unit 2 is located on a 364-ha (900-acre) site owned by Niagara Mohawk Power Corporation (NMPC), and is situated on the southeast shore of Lake Ontario, Oswego County, NY, approximately 10 km (6.2 mi)northeast of the city of Oswego.Unit, 2 and support facilities occupy about 18.2 ha (45 acres), and share the site with the existing Unit 1 (Docket No.50-220)which has been in commercial operation since 1969.,The Nine Mile Point site is adjacent to the James A.FitzPatrick Nuclear Power Plant owned by the NYPA;Unit 2 is located 274 m (900 ft)east of Nine'Mile Point Unit 1 and about 716 m (2,350 ft)west of the James A.FitzPatrick Plant.Unit 2 employs a nuclear steam supply system (NSSS)consisting of a single cycle, forced circulating boiling water reactor (BWR).The plant rated core thermal power level (Figure 1.1-1-)is 3,323 MWt corresponding to a net electrical output of 1,080 MWe, and design thermal power of 3,463 MWt corresponding to a gross electrical output of 1,202 MWe.The thermal power used for the plant transient and loss-of-coolant
'accident (LOCA)analysesis3,463MWt.Allsafetysystemshavebeendesignedforathermalpower.of3,489MWt.TheNSSSsupplierisGeneralElectricCompany-NuclearEnergyOperations (GE-NEO).
'accident (LOCA)analyses is 3,463 MWt.All safety systems have been designed for a thermal power.of 3,489 MWt.The NSSS supplier is General Electric Company-Nuclear Energy Operations (GE-NEO).The balance of the plant is designed and constructed by Stone Ec Webster Engineering Corporation (SWEC).Other plants designed by SWEC that are similar in concept are currently under review by the Nuclear Regulatory Commission.
Thebalanceoftheplantisdesignedandconstructed byStoneEcWebsterEngineering Corporation (SWEC).OtherplantsdesignedbySWECthataresimilarinconceptarecurrently underreviewbytheNuclearRegulatory Commission.
These are the Shoreham Nuclear Power Station, Brookhaven, Long Island, NY, and the River Bend Station, St.Francisville, LA.The containment design employs the BWR Mark II concept of over-under pressure suppression with multiple , downcomers Amendment 19 1.1-1 May 1985 Nine Mile Point Unit 2 FSAR connecting the reactor drywell to the water-filled pressure suppression chamber.The primary containment,.-
ThesearetheShorehamNuclearPowerStation,Brookhaven, LongIsland,NY,andtheRiverBendStation,St.Francisville, LA.Thecontainment designemploystheBWRMarkIIconceptofover-under pressuresuppression withmultiple,downcomers Amendment 191.1-1May1985 NineMilePointUnit2FSARconnecting thereactordrywelltothewater-filled pressuresuppression chamber.Theprimarycontainment,.-
is.a steel-lined, reinforced concrete enclosure housing the reactor and the suppression pool.The reactor building completely encloses the.primary containment.
is.asteel-lined, reinforced concreteenclosure housingthereactorandthesuppression pool.Thereactorbuildingcompletely enclosesthe.primarycontainment.
The structure provides secondary containment when the primary containment is closed and in service, and provides primary containment when the primary containment is open, as during refueling.
Thestructure providessecondary containment whentheprimarycontainment isclosedandinservice,andprovidesprimarycontainment whentheprimarycontainment isopen,asduringrefueling.
The reactor building houses the refueling and reactor servicing equipment, new and spent fuel storage facilitie's,'and--other reactor auxiliary and service equipment.
Thereactorbuildinghousestherefueling andreactorservicing equipment, newandspentfuelstoragefacilitie's,
The primary purpose of the reactor building is to minimize ground.-level release of airborne radioactive material.The outer wall of the reactor building is reinforced concrete up to the crane rail level above the refueling floor.Above the crane'ail level, the superstructure is a steel frame using metal wall panels with sealed joints.Access to the building is through airlocks.II The power generation complex includes several contiguous buildings:
'and--otherreactorauxiliary andserviceequipment.
the reactor building with two auxiliary bays, the control building, the turbine building, and the radwaste building.Other buildings, such as the security facility, are'lso located in the general plant area.A screenwell for the circulating and service water systems is located approximately 107 m (350 ft)northwest of the centerline of the reactor building.Condenser cooling for Unit 2 is provided from a counterflow, natural-draft, hyperbolic, concrete cooling, tower located approximately 330 m (1,000 ft)south of the centerline of the reactor building.The ultimate heat.sink for emergency core cooling is Lake Ontario.Below grade and north of the screenwell building, there are two concrete tunnels'hat convey the ,service water intake, service water discharge, and cooling tower blowdown.A safety-related intake pipe is enclosed in'each tunnel.The intake pipes extend from the intake shaft approximately 396 m (1, 300 f t)northward under Lake Ontario to the submerged intake structures.
Theprimarypurposeofthereactorbuildingistominimizeground.-level releaseofairborneradioactive material.
One tunnel also contains the discharge pipe which extends approximately 550 m (1,800 ft)to the discharge diffuser.Radionuclides are emitted to the atmosphere from two locations at Unit 2.These are the stack and the combined vent for the radwaste-and reactor buildings.
Theouterwallofthereactorbuildingisreinforced concreteuptothecraneraillevelabovetherefueling floor.Abovethecrane'ail level,thesuperstructure isasteelframeusingmetalwallpanelswithsealedjoints.Accesstothebuildingisthroughairlocks.
Fiquid radwaste is stored for decay or concentrated to a solid waste for controlled disposal at regulated storage sites.1~1 2 Nine Mile Point Unit 2 FSAR The shielding design'and plant layout are based on extensive experience of NMPC and SWEC in controlling radiological exposures to as low as reasonably achievable levels.Estimated radiological doses for normal operations and postulated accidents are all fractional parts of the doses listed in federal radiological guidelines for siting and operation of nuclear power plants.Environmental impacts are described in the separate Environmental Report Operating License Stage being submitted for Unit 2.This FSAR is written in accordance with Regulatory Guide 1.70, Standard Format and Content of Safety Analysis Reports for Nuclear Power Plants.The content of this FSAR addresses applicable regulatory guides issued up to July 1982.The Unit 2 Preliminary Safety Analysis Report (PSAR)was submitted on June 15, 1972 (Docket No.50-410).The NRC Safety Evaluation Report was issued on June 15, 1973, and the construction permit (CPPR-112) was issued on June 24, 1974.Environmental impacts related to the plant are discussed in the Environmental Report-Construction Permit Stage submitted on June 15, 1972.The NRC Final Environmental Statement was issued in June 1973.The approximate schedule for Unit 2 fuel loading and commercial operation is as follows: Fuel loading Commercial operation March 1986 October 1986 Amendment 24 1.1-3 February 1986 I
IIThepowergeneration complexincludesseveralcontiguous buildings:
Nine Nile Point Unit 2 FSAR 1.2 GENERAL PLANT DESCRIPTION 1.F 1 Principal Design Criteria The principal architectural and engineering criteria for the design, construction, and operation of Unit 2 are summarized in this Section.There are two ways of considering principal design criteria: on a classification-by-classification basis, or on a system-by-system (system group)basis.Safety analyses generally utilize the information formatted in the classification-by-classification approach but/system descriptions are more easily understood through the system-by-system method.This section uses both methods for summarizing the principal design criteria.1.2.1.1 General Criteria Some of the criteria are generally applicable to more than one classification or more than one system group.These general criteria are as follows: Unit 2 is designed, fabricated, and erected to produce electric power in a safe and.reliable manner.Unit design generally conforms with applicable codes and regulations.
thereactorbuildingwithtwoauxiliary bays,thecontrolbuilding, theturbinebuilding, andtheradwastebuilding.
Exceptions are evaluated and justified.
Otherbuildings, suchasthesecurityfacility, are'lsolocatedinthegeneralplantarea.Ascreenwell forthecirculating andservicewatersystemsislocatedapproximately 107m(350ft)northwest ofthecenterline ofthereactorbuilding.
The General Design Criteria of 10CFR50 Appendix A have been satisfied in the Unit 2 design.2.3.Unit 2 is designed, fabricated, and erected to operate in such a way that the release of radioactive materials to the environment is limited to less than the limit and guideline values of applicable federal regulations pertaining to the release of radioactive materials for normal operations and abnormal events.Unit 2 is designed to support a GE boiling water reactor (BWR)and nuclear steam supply system (NSSS)to produce steam for direct use in a turbine generator unit.This design incorporates ,features typical of many other BWR plants.4.Certain portions of the plant are designed to withstand extreme natural phenomena such as earthquakes, flooding, or tornadoes, and unnatural phenomena such as fige, flooding from in-plant leakage, internally or externally generated missiles, and others.1.2-1 Nine Mile Point Unit 2 FSAR The reactor core and reactivity control systems are designed so that control rod action is capable of bringing the core to subcritical condition and maintaining it, even with the rod of highest reactivity worth fully withdrawn and unavailable for insertion.
Condenser coolingforUnit2isprovidedfromacounterflow, natural-draft, hyperbolic, concretecooling,towerlocatedapproximately 330m(1,000ft)southofthecenterline ofthereactorbuilding.
Design margins for the nuclear safety systems and engineered safeguards are conservative.
Theultimateheat.sinkforemergency corecoolingisLakeOntario.Belowgradeandnorthofthescreenwell
Nuclear abnormal damage.environs material Appendix safety systems are designed to respond to operation transients to preclude fuel'ny fission products released to the via normal discharge paths for radioactive will not exceed the limits of 10CFR50 I.Nuclear safety systems and engineered safeguards are designed to assure that no damage to the reactor coolant pressure boundary (RCPB)results from internal pressures caused by abnormal operational transients or accidents.
: building, therearetwoconcretetunnels'hatconveythe,servicewaterintake,servicewaterdischarge, andcoolingtowerblowdown.
Where positive, precise action is immediately required in response to accidents, such action is automatic and requires no decision or manipulation of controls by station operations personnel.
Asafety-related intakepipeisenclosedin'eachtunnel.Theintakepipesextendfromtheintakeshaftapproximately 396m(1,300ft)northward underLakeOntariotothesubmerged intakestructures.
Essential safety actions are carried out by safety-related equipment of sufficient redundancy and independence so that no single failure of active components can prevent required actions.Any single failure within the safety-related protection system shall n'ot prevent proper protective action at the system level when required.Provisions have been made for control of the components of nuclear safety systems and engineered safeguards from the control room.C Nuclear safety systems and engineered safeguards are designed to permit demonstration of their functional performance requirements.
Onetunnelalsocontainsthedischarge pipewhichextendsapproximately 550m(1,800ft)tothedischarge diffuser.
Unit 2 features essential to the mitigation of accident consequences are designed, fabricated, and erected to quality standards that reflect the importance of the safety function to be performed.
Radionuclides areemittedtotheatmosphere fromtwolocations atUnit2.Thesearethestackandthecombinedventfortheradwaste-andreactorbuildings.
1.2-2 Nine Mile Point Unit 2 FSAR I 1.2'~2 Power Generation Design Criteria Principal power generation design criteria are as follows: 1.Fuel cladding'designed to retain integrity as a radioactive material barrier throughout the full operational range of the plant and any abnormal operation transient.
Fiquidradwasteisstoredfordecayorconcentrated toasolidwasteforcontrolled disposalatregulated storagesites.1~12 NineMilePointUnit2FSARTheshielding design'andplantlayoutarebasedonextensive experience ofNMPCandSWECincontrolling radiological exposures toaslowasreasonably achievable levels.Estimated radiological dosesfornormaloperations andpostulated accidents areallfractional partsofthedoseslistedinfederalradiological guidelines forsitingandoperation ofnuclearpowerplants.Environmental impactsaredescribed intheseparateEnvironmental ReportOperating LicenseStagebeingsubmitted forUnit2.ThisFSARiswritteninaccordance withRegulatory Guide1.70,StandardFormatandContentofSafetyAnalysisReportsforNuclearPowerPlants.ThecontentofthisFSARaddresses applicable regulatory guidesissueduptoJuly1982.TheUnit2Preliminary SafetyAnalysisReport(PSAR)wassubmitted onJune15,1972(DocketNo.50-410).TheNRCSafetyEvaluation ReportwasissuedonJune15,1973,andtheconstruction permit(CPPR-112) wasissuedonJune24,1974.Environmental impactsrelatedtotheplantarediscussed intheEnvironmental Report-Construction PermitStagesubmitted onJune15,1972.TheNRCFinalEnvironmental Statement wasissuedinJune1973.Theapproximate scheduleforUnit2fuelloadingandcommercial operation isasfollows:FuelloadingCommercial operation March1986October1986Amendment 241.1-3February1986 I
The fuel cladding is designed to accommodate, without loss of integrity, pressures generated by fission gases released from fuel material throughout the design life of the fuel.2.Heat removal systems are provided in sufficient capacity and redundancy to remove heat generated in the reactor core for the full range of normal operating conditions from plant shutdown to design power, and also for any abnormal operational"transient.
NineNilePointUnit2FSAR1.2GENERALPLANTDESCRIPTION 1.F1Principal DesignCriteriaTheprincipal architectural andengineering criteriaforthedesign,construction, andoperation ofUnit2aresummarized inthisSection.Therearetwowaysofconsidering principal designcriteria:
The capacity'f such systems is adequate to prevent fuel cladding damage.3.Backup heat removal systems are provided to remove decay heat generated in the core under circumstances where normal operational heat removal systems have become inoperative.
onaclassification-by-classification basis,oronasystem-by-system (systemgroup)basis.Safetyanalysesgenerally utilizetheinformation formatted intheclassification-by-classification approachbut/systemdescriptions aremoreeasilyunderstood throughthesystem-by-system method.Thissectionusesbothmethodsforsummarizing theprincipal designcriteria.
The capacity of such systems is adequate to prevent fuel cladding damage.4 Control equipment is provided to allow the reactor to respond automatically to major or minor load changes and other abnormal operational transients, including bringing the reactor to a hot shutdown condition.
1.2.1.1GeneralCriteriaSomeofthecriteriaaregenerally applicable tomorethanoneclassification ormorethanonesystemgroup.Thesegeneralcriteriaareasfollows:Unit2isdesigned, fabricated, anderectedtoproduceelectricpowerinasafeand.reliablemanner.Unitdesigngenerally conformswithapplicable codesandregulations.
5.Reactor power level is manually controlled.
Exceptions areevaluated andjustified.
6.Control of the NSSS, including the reactor, is'ossible from a single location.NSSS and reactor controls, including alarms, are arranged to allow the operator to rapidly assess the condition of the nuclear system and locate process system malfunctions.
TheGeneralDesignCriteriaof10CFR50AppendixAhavebeensatisfied intheUnit2design.2.3.Unit2isdesigned, fabricated, anderectedtooperateinsuchawaythatthereleaseofradioactive materials totheenvironment islimitedtolessthanthelimitandguideline valuesofapplicable federalregulations pertaining tothereleaseofradioactive materials fornormaloperations andabnormalevents.Unit2isdesignedtosupportaGEboilingwaterreactor(BWR)andnuclearsteamsupplysystem(NSSS)toproducesteamfordirectuseinaturbinegenerator unit.Thisdesignincorporates
8.Fuel handling and storage facilities are designed to maintain adequate shielding, cooling, and water quality for spent fuel and to prevent inadvertent criticality.
,features typicalofmanyotherBWRplants.4.Certainportionsoftheplantaredesignedtowithstand extremenaturalphenomena suchasearthquakes,
Amendment 21 1.2-3 September 1985 Nine Mile Point Unit 2 FSAR Interlocks or other automatic equipment are provided as backup to procedural controls to avoid conditions requiring the functioning of nuclear safety systems or engineered safeguards.
: flooding, ortornadoes, andunnatural phenomena suchasfige,floodingfromin-plantleakage,internally orexternally generated
Safety Design Criteria The.unit is designed, fabricated, and erected to operate so that the release of radioactive materials to the environment is significantly less than the requirements of 10CFR20 or 10CFR100.Those portions of the nuclear system that form part of the RCPB are designed to retain integrity as a radioactive barrier following abnormal operational transients or an accident event.The reactor core is designed so its nuclear characteristics do,not contribute to a divergent power transient.
: missiles, andothers.1.2-1 NineMilePointUnit2FSARThereactorcoreandreactivity controlsystemsaredesignedsothatcontrolrodactioniscapableofbringingthecoretosubcritical condition andmaintaining it,evenwiththerodofhighestreactivity worthfullywithdrawn andunavailable forinsertion.
The NSSS and supporting systems are designed so that there is no tendency for divergent oscillation of any operating characteristic, considering the interaction of the nuclear system with other appropriate unit systems'aseous, liquid, and solid waste disposal faci'lities are designed so the discharge of radioactive effluents and offsite shipment of radioactive materials can be made in accordance with applicable regulations'esign of the radwaste system provides means by which Unit 2 operators can be alerted when limits on the release of radioactive material are approached.
Designmarginsforthenuclearsafetysystemsandengineered safeguards areconservative.
Sufficient indications are provided to determine that the reactor is operating within the limits of applicable regulations in any mode of unit operations.
Nuclearabnormaldamage.environsmaterialAppendixsafetysystemsaredesignedtorespondtooperation transients toprecludefuel'nyfissionproductsreleasedtothevianormaldischarge pathsforradioactive willnotexceedthelimitsof10CFR50I.Nuclearsafetysystemsandengineered safeguards aredesignedtoassurethatnodamagetothereactorcoolantpressureboundary(RCPB)resultsfrominternalpressures causedbyabnormaloperational transients oraccidents.
Adequate radiation shielding is provided and access control patterns are established to allow a properly trained operating staff to control radiation doses to-a level that is as low as reasonably achievable during normal operation.
Wherepositive, preciseactionisimmediately requiredinresponsetoaccidents, suchactionisautomatic andrequiresnodecisionormanipulation ofcontrolsbystationoperations personnel.
1.2-4 Nine Mile Point Unit 2 FSAR Essential safety actions are designed to be carried out by equipment of sufficient redundance and independence that no single failure can prevent the required actions.Any single failure within the protection system shall not prevent proper action at the system level when required.Provisions are made for control of the components of nuclear safety systems from the control room.Nuclear safety systems are designed to demonstrate functional performance requirements.
Essential safetyactionsarecarriedoutbysafety-related equipment ofsufficient redundancy andindependence sothatnosinglefailureofactivecomponents canpreventrequiredactions.Anysinglefailurewithinthesafety-related protection systemshalln'otpreventproperprotective actionatthesystemlevelwhenrequired.
1 The design of nuclear safety systems includes design allowances for environmental disturbances at the site such as earthquakes, floods, high winds, storms and other disturbances such as fire and flooding from leakage of fluid systems, internally and externally generated missiles, and others.Standby electrical power sources are of suf f icient capacity to power all-necessary nuclear safety systems requiring electrical power.Standby ac and dc power sources are provided to remove decay heat when the offsite power supply is not available.
Provisions havebeenmadeforcontrolofthecomponents ofnuclearsafetysystemsandengineered safeguards fromthecontrolroom.CNuclearsafetysystemsandengineered safeguards aredesignedtopermitdemonstration oftheirfunctional performance requirements.
Engineered safeguards are designed to assure that no damage to the RCPB results from internal pressures caused by an accident or abnormal transient.
Unit2featuresessential tothemitigation ofaccidentconsequences aredesigned, fabricated, anderectedtoqualitystandards thatreflecttheimportance ofthesafetyfunctiontobeperformed.
A primary containment is provided that completely encloses the reactor vessel.The primary containment uses the pressure suppression concept.The primary containment is designed to retain integrity as a radioactive material barrier during and following accidents that release radioactive material into the primary containment volume.It is possible to test primary.containment integrity and leaktightness at periodic intervals.
1.2-2 NineMilePointUnit2FSARI1.2'~2PowerGeneration DesignCriteriaPrincipal powergeneration designcriteriaareasfollows:1.Fuelcladding'designedtoretainintegrity asaradioactive materialbarrierthroughout thefulloperational rangeoftheplantandanyabnormaloperation transient.
A reactor building is provided that completely encloses both the primary containment and the fuel storage areas.The secondary containment includes a method for controlling release of radioactive materials from the barrier and includes a capability for filtering radioactive materials within the barrier.1.2-5 Nine Mile Point Unit 2 FSAR 18.The reactor building is designed to act as a radioactive material barrier, if required, when the primary containment is open for expected operational purposes.19.The primary containment and reactor building, in conjunction with other engineered safeguards, limits radiological effects of accidents resulting in the release of radioactive material to the primary containment volume to significantly less than the requirements of 10CFR100.20.Provisions are made for removing energy from within the primary containment to maintain the integrity of the primary containment system following accidents that release energy to the primary containment.
Thefuelcladdingisdesignedtoaccommodate, withoutlossofintegrity, pressures generated byfissiongasesreleasedfromfuelmaterialthroughout thedesignlifeofthefuel.2.Heatremovalsystemsareprovidedinsufficient capacityandredundancy toremoveheatgenerated inthereactorcoreforthefullrangeofnormaloperating conditions fromplantshutdowntodesignpower,andalsoforanyabnormaloperational "transient.
21.Piping that penetrates the primary containment structure and serves as a path for the uncontrolled release of radioactive material to the environs is automatically isolated whenever such potential for radioactive material release exists.Such isolation is effected in time to limit radiological effects to significantly less than the requirements of 10CFR100.22.The emergency core cooling system (ECCS)is provided to limit fuel cladding temperature to 2,200 F as a result of a loss-of-coolant accident (IOCA).23.The ECCS provides for continuity of core cooling over the complete range of postulated break sizes in the RCPB.24.The ECCS is diverse, reliable, and redundant.
Thecapacity'f suchsystemsisadequatetopreventfuelcladdingdamage.3.Backupheatremovalsystemsareprovidedtoremovedecayheatgenerated inthecoreundercircumstances wherenormaloperational heatremovalsystemshavebecomeinoperative.
25.-Operation of the ECCS is initiated automatically when required,'regardless of the availability of offsite power.26.The main control room is shielded against radiation to permit continued occupancy under accident conditions.
Thecapacityofsuchsystemsisadequatetopreventfuelcladdingdamage.4Controlequipment isprovidedtoallowthereactortorespondautomatically tomajororminorloadchangesandotherabnormaloperational transients, including bringingthereactortoahotshutdowncondition.
27.In the event that the main control room becomes uninhabitable, it is possible to bring the reactor from power range operation to a cold shutdown 1.2-6 Nine Mile Point Unit 2 FSAR condition by manipulating local controls and equipment available outside the main control room.28.Backup reactor shutdown capability is provided independent of normal reactivity control provisions.
5.Reactorpowerlevelismanuallycontrolled.
This backup system shuts down the reactor from any normal operating condition and maintains the shutdown condition.
6.ControloftheNSSS,including thereactor,is'ossiblefromasinglelocation.
I 1.2.1.3 System-by-System Approach The principal architectural and engineering criteria for design are summarized below on a system-by-system or system-group basis.The system-by-system presentation facilitates understanding of the actual design of any one system.Only the most restrictive of any related criteria are stated for a system.Where the most restrictive criterion is classified as a power generation consideration, less restrictive safety criteria may not be stated in the system-by-system presentation.
NSSSandreactorcontrols, including alarms,arearrangedtoallowtheoperatortorapidlyassessthecondition ofthenuclearsystemandlocateprocesssystemmalfunctions.
However, the actual design of a system must reflect all criteria that pertain to it.1.2.1.3.1 Nuclear System Criteria Principal design criteria for the reactor, ECCS, RCPB, and reactivity control systems are as follows: The nuclear system is designed to support a GE BWR rated at 3,323 MWt.2.Fuel cladding is designed to retain integrity as a radioactive material barrier throughout the design power range.Fuel cladding is designed to accommodate, without.loss of integrity, the pressures generated by the fission gases released from fuel material throughout the design life of the fuel.3.Fuel cladding, in conjunction with other unit systems, is designed to retain integrity throughout any abnormal operational transient.
8.Fuelhandlingandstoragefacilities aredesignedtomaintainadequateshielding, cooling,andwaterqualityforspentfuelandtopreventinadvertent criticality.
Those portions of the nuclear system that form part of the RCPB are designed to retain integrity as a radioactive material barrier following abnormal operational transients and accidents.
Amendment 211.2-3September 1985 NineMilePointUnit2FSARInterlocks orotherautomatic equipment areprovidedasbackuptoprocedural controlstoavoidconditions requiring thefunctioning ofnuclearsafetysystemsorengineered safeguards.
5.Heat removal systems including the ECCS and makeup water supplies are provided in sufficient capacity, redundancy, and operational adequacy to remove heat 1%2 7 Nine Mile Point Unit 2 FSAR generated in the reactor core for the full range of normal operational conditions from unit shutdown to design power and for any abnormal operational transient or accident.The capacity of such systems is adequate to prevent fuel cladding damage.6.The reactor core and reactivity control system is designed to-ensure that control rod action is capable of bringing the core subcritical and maintaining it thus, even with the rod of highest reactivity worth fully withdrawn and unavailable for insertion.
SafetyDesignCriteriaThe.unitisdesigned, fabricated, anderectedtooperatesothatthereleaseofradioactive materials totheenvironment issignificantly lessthantherequirements of10CFR20or10CFR100.
An alternate reactivity control system is provided should the control rods or drive system become inoperable.
ThoseportionsofthenuclearsystemthatformpartoftheRCPBaredesignedtoretainintegrity asaradioactive barrierfollowing abnormaloperational transients oranaccidentevent.Thereactorcoreisdesignedsoitsnuclearcharacteristics do,notcontribute toadivergent powertransient.
The alternate system is capable of shutting down the reactor and maintaining it subcritical.
TheNSSSandsupporting systemsaredesignedsothatthereisnotendencyfordivergent oscillation ofanyoperating characteristic, considering theinteraction ofthenuclearsystemwithotherappropriate unitsystems'aseous, liquid,andsolidwastedisposalfaci'lities aredesignedsothedischarge ofradioactive effluents andoffsiteshipmentofradioactive materials canbemadeinaccordance withapplicable regulations'esign oftheradwastesystemprovidesmeansbywhichUnit2operators canbealertedwhenlimitsonthereleaseofradioactive materialareapproached.
7.The reactor core is'designed so that, its nuclear characteristics do not contribute to'divergent power transient.
Sufficient indications areprovidedtodetermine thatthereactorisoperating withinthelimitsofapplicable regulations inanymodeofunitoperations.
8.The nuclear system is designed so there is no tendency for divergent oscillation of any operating characteristic, considering the interaction of the nuclear system with'other appropriate unit systems.1.2.1.3.2 Power Conversion Systems.Criteria Components of the power conversion systems are designed to perform these basic objectives:
Adequateradiation shielding isprovidedandaccesscontrolpatternsareestablished toallowaproperlytrainedoperating stafftocontrolradiation dosesto-alevelthatisaslowasreasonably achievable duringnormaloperation.
Reliably produce electrical power from the steam supplied by the reactor, condense the steam into water, and return the water to the reactor as heated feedwater, with a major portion of its gaseous and particulate impurities removed.2.Assure that any fission products or radioactivity associated with the steam and condensate during normal operation or accident conditions are safely contained within the system or are released under controlled conditions in accordance with waste disposal regulations.
1.2-4 NineMilePointUnit2FSAREssential safetyactionsaredesignedtobecarriedoutbyequipment ofsufficient redundance andindependence thatnosinglefailurecanpreventtherequiredactions.Anysinglefailurewithintheprotection systemshallnotpreventproperactionatthesystemlevelwhenrequired.
1.2-8 Nine Mile Point Unit 2 FSAR 1.2.1.3.3 Electrical Power Systems Design Criteria Sufficient preferred and standby ac and dc power sources are provided to attain prompt shutdown and continued maintenance of the unit in a safe condition under all credible circumstances.
Provisions aremadeforcontrolofthecomponents ofnuclearsafetysystemsfromthecontrolroom.Nuclearsafetysystemsaredesignedtodemonstrate functional performance requirements.
Power sources are adequate to accomplish all required engineered safeguard functions under postulated design basis accident conditions.
1Thedesignofnuclearsafetysystemsincludesdesignallowances forenvironmental disturbances atthesitesuchasearthquakes, floods,highwinds,stormsandotherdisturbances suchasfireandfloodingfromleakageoffluidsystems,internally andexternally generated
1.2.1.3.4 Radwaste System Design Criteria Radwaste systems are designed to limit release of radioactive materials from the unit during normal operation to significantly less than the requirements of 10CFR20, and within the guidelines of Appendix I to 10CFRSO.Gaseous, liquid,, and solid waste disposal systems are designed so that offsite shipments will be in accordance with applicable regulations, including 10CFR20, 10CFR71, and 49CFR171 through 179, as appropriate.
: missiles, andothers.Standbyelectrical powersourcesareofsufficientcapacitytopowerall-necessary nuclearsafetysystemsrequiring electrical power.Standbyacanddcpowersourcesareprovidedtoremovedecayheatwhentheoffsitepowersupplyisnotavailable.
3.The design provides means by which unit operations personnel can be alerted whenever operational limits on the release of radioactive material are approached.
Engineered safeguards aredesignedtoassurethatnodamagetotheRCPBresultsfrominternalpressures causedbyanaccidentorabnormaltransient.
1.2.1.3.5 Auxiliary Systems Design Criteria Auxiliary systems are provided to support the NSSS and power generation system to provide for maintenance of the plant environment, in-plant radiation and airborne contamination control, compressed air supplies, sealing steam, etc.2.Essential auxiliary systems are designed to function during accident conditions.
Aprimarycontainment isprovidedthatcompletely enclosesthereactorvessel.Theprimarycontainment usesthepressuresuppression concept.Theprimarycontainment isdesignedtoretainintegrity asaradioactive materialbarrierduringandfollowing accidents thatreleaseradioactive materialintotheprimarycontainment volume.Itispossibletotestprimary.containment integrity andleaktightness atperiodicintervals.
1.2.1.3.6 Shielding and Access Control Design Criteria Radiation shielding is provided and access control patterns are established to allow a properly trained operating staff to control radiation doses within the limits of published regulations during normal operation.
Areactorbuildingisprovidedthatcompletely enclosesboththeprimarycontainment andthefuelstorageareas.Thesecondary containment includesamethodforcontrolling releaseofradioactive materials fromthebarrierandincludesacapability forfiltering radioactive materials withinthebarrier.1.2-5 NineMilePointUnit2FSAR18.Thereactorbuildingisdesignedtoactasaradioactive materialbarrier,ifrequired, whentheprimarycontainment isopenforexpectedoperational purposes.
Shielding design, equipment layout, and zoning have been performed to ensure radiation doses are maintained as low as reasonably achievable.
19.Theprimarycontainment andreactorbuilding, inconjunction withotherengineered safeguards, limitsradiological effectsofaccidents resulting inthereleaseofradioactive materialtotheprimarycontainment volumetosignificantly lessthantherequirements of10CFR100.
1.2-9 Nine Nile Point Unit 2 FSAR 2.The main control room is shielded against, radiation so that in conjunction with the control room air conditioning system occupancy is allowed under accident conditions.
20.Provisions aremadeforremovingenergyfromwithintheprimarycontainment tomaintaintheintegrity oftheprimarycontainment systemfollowing accidents thatreleaseenergytotheprimarycontainment.
1.2.1.3.7 Nuclear Safety Systems and Engineered Safeguards Design Criteria Principal design criteria for nuclear safety systems and engineered safeguards are as follows: 1.These criteria correspond to 10CFR50 General Design Criteria 1 through 64 as described in Section 3.1.2~2.Standby ac and dc power sources are, designed to have sufficient capacity to power all necessary nuclear safety systems and engineered safeguards requiring electrical power.3.Standby ac power sources-are provided to allow reactor shutdown and removal of decay heat when offsite power is not available.
21.Pipingthatpenetrates theprimarycontainment structure andservesasapathfortheuncontrolled releaseofradioactive materialtotheenvironsisautomatically isolatedwheneversuchpotential forradioactive materialreleaseexists.Suchisolation iseffectedintimetolimitradiological effectstosignificantly lessthantherequirements of10CFR100.
ln the event that the main control room is uninhabitable, it is possible to bring the reactor from power range operation to a cold shutdown condition by use of the shutdown room or manipulating local controls and equipment that are available outside the control room.5.Backup reactor shutdown capability is provided independently of normal reactivity control provisions.
22.Theemergency corecoolingsystem(ECCS)isprovidedtolimitfuelcladdingtemperature to2,200Fasaresultofaloss-of-coolant accident(IOCA).23.TheECCSprovidesforcontinuity ofcorecoolingoverthecompleterangeofpostulated breaksizesintheRCPB.24.TheECCSisdiverse,reliable, andredundant.
This backup system has the capability to shut down the reactor from any normal or upset operating condition and subsequently to maintain the shutdown condition.
25.-Operation oftheECCSisinitiated automatically whenrequired,'regardless oftheavailability ofoffsitepower.26.Themaincontrolroomisshieldedagainstradiation topermitcontinued occupancy underaccidentconditions.
1.2.1.3.8 Process Control Syst: em Design Criteria Principal design criteria for process control systems are listed as follows: NSSS Process Control Desi n Criteria 1.Control equipment is provided to allow the reactor to respond automatically to load changes within design limits.1.2-10 Nine Mile Point Unit 2 FSAR 2.Controls are provided to manually control reactor power level.3.Control of the nuclear system is possible from-a--single"location.
27.Intheeventthatthemaincontrolroombecomesuninhabitable, itispossibletobringthereactorfrompowerrangeoperation toacoldshutdown1.2-6 NineMilePointUnit2FSARcondition bymanipulating localcontrolsandequipment available outsidethemaincontrolroom.28.Backupreactorshutdowncapability isprovidedindependent ofnormalreactivity controlprovisions.
Nuclear systems process controls and alarms are arranged to allow the operator to rapidly assess the condition of the nuclear system and to locate process system malfunctions.
Thisbackupsystemshutsdownthereactorfromanynormaloperating condition andmaintains theshutdowncondition.
5.Interlocks or other automatic equipment are provided as a backup to procedural controls to avoid conditions r'equiring actuation of nuclear safety systems or engineered safeguards.
I1.2.1.3System-by-System ApproachTheprincipal architectural andengineering criteriafordesignaresummarized belowonasystem-by-system orsystem-group basis.Thesystem-by-system presentation facilitates understanding oftheactualdesignofanyonesystem.Onlythemostrestrictive ofanyrelatedcriteriaarestatedforasystem.Wherethemostrestrictive criterion isclassified asapowergeneration consideration, lessrestrictive safetycriteriamaynotbestatedinthesystem-by-system presentation.
Power Conversion S stems Process Control Desi n Criteria Control equipment is provided to control reactor pressure throughout its operating range.2.The turbine is capable of responding automatically to minor changes in load.3.,The feedwater system is controlled to maintain the water level in the reactor vessel at the optimum level range.4 Control of the power conversion equipment is possible from one location.5.Interlocks or other, automatic equipment are provided as a backup to procedural controls to avoid conditions requiring the actuation of nuclear safety systems or engineered safeguards.
However,theactualdesignofasystemmustreflectallcriteriathatpertaintoit.1.2.1.3.1 NuclearSystemCriteriaPrincipal designcriteriaforthereactor,ECCS,RCPB,andreactivity controlsystemsareasfollows:ThenuclearsystemisdesignedtosupportaGEBWRratedat3,323MWt.2.Fuelcladdingisdesignedtoretainintegrity asaradioactive materialbarrierthroughout thedesignpowerrange.Fuelcladdingisdesignedtoaccommodate, without.lossofintegrity, thepressures generated bythefissiongasesreleasedfromfuelmaterialthroughout thedesignlifeofthefuel.3.Fuelcladding, inconjunction withotherunitsystems,isdesignedtoretainintegrity throughout anyabnormaloperational transient.
Electrical Power S stem Process Control Desi n Criteria The safety-related (Class 1E)electrical power system is designed as a three-division system, any two out of three divisions being adequate to safely shut down the unit.2.The protection system is designed to detect and isolate faulted equipment from the system with a minimum of disturbance in the event of any fault in the system.Amendment 21 1.2-11 September 1985 Nine Mile Point Unit 2 FSAR 3.In the event of a loss of offsite power the protection system isolates the emergency buses from the offsite system and initiates the starting of the standby ac power sources.4.In the event of loss of offsite power and LOCA the protection system isolates the: emergency buses from the offsite system and the normal electrical system, and the standby diesel generators are started and sequentially loaded by a programmed control system to energize all safety-related loads.5.All electrically-operated breakers are controllable from the control room.6'.Metering for generators, transformers, and other essential circuits is available in the control room.1.2.2 Site Description 1.2.2.1 Site Characteristics:
ThoseportionsofthenuclearsystemthatformpartoftheRCPBaredesignedtoretainintegrity asaradioactive materialbarrierfollowing abnormaloperational transients andaccidents.
Site Location and Size The project site comprises approximately 364 ha (900 acres)and is located on the south shore of Lake Ontario in the town of Scriba, Oswego County, NY, on land owned by the Niagara Mohawk Power Corporation (NMPC).The Nine Mile Point Nuclear Station-Unit 2 (Unit 2)shares the site with existing Unit 1;Unit 2 and support facilities occupy about 18.2 ha (45 acres)of the total site acreage.The James A.FitzPatrick plant, owned by the NYPA, is located east of the project site.The centerline-to-centerline distance between Unit 2 and the FitzPatrick plant reactors is about 716 m (2, 350 ft).The distance between the Nine Mile Point Unit 1 and Unit 2 reactor centerlines is about 274 m (900 ft).The site plan is shown on Figure 1.2-1.All activities at the site are under the direct control of NMPC"'.1.2.2.2 Access to the Site The protected area of the site is isolated from the surrounding area by fencing.Access to the site is controlled at the gate of the main entrance to the plant by security personnel.
5.Heatremovalsystemsincluding theECCSandmakeupwatersuppliesareprovidedinsufficient
All other gates are kept locked"'.USAR Revision 4 1.2-12 October 1992 Nine Mile Point Unit 2 FSAR 1~2.2.3 Description of the Site and Environs Most of the land immediately to the south and west of the site is pasture or inactive farmland.For the region west, south, and east of the site, the country is characterized by rolling terrain rising gently up from Lake Ontario which lies immediately to the north of the site.Within an approximate 8-km (5-mi)radius of Unit 2, the 1980 population was 3,468.The population for this same area is projected to be 5,301 in 1990 and 7,213 in 2010.The nearest dwellings are on Lakeview Road approximately 1.6 km (1 mi)from the station.The Ontario Bible Conference operates a summer camp on the lakefront adjacent to the western boundary of the site'swego, which is the nearest city, is located about 10 km (6.2 mi)southwest of the site and had a 1980 population of 19,793.The nearest population center with a population in excess of 25,000 is the city of Syracuse, approximately 53 km (32.8 mi)southeast of the site.Buffalo is approximately 217 km (135 mi)west of the site.Figure 2.1-1 shows the location of the site relative to the larger cities in New York State which are within the 80-km (50-mi)radius of the site.1.2.3 Structures and Equipment The buildings and structures essential to the safe operation and shutdown of the plant are designed to withstand extreme environmental and abnormal loading conditions.
: capacity, redundancy, andoperational adequacytoremoveheat1%27 NineMilePointUnit2FSARgenerated inthereactorcoreforthefullrangeofnormaloperational conditions fromunitshutdowntodesignpowerandforanyabnormaloperational transient oraccident.
The structures and/or portions thereof so designated are designed to provide the protection as required from tornadoes, missiles, earthquakes, pipe whip, and internal or external flooding.Additional discussions of design considerations are found in Chapter 3.Locations and orientation of the structures are shown on Figures 1.2-1 and 1.2-2.The general arrangement of personnel access between structures is shown on Figures 1.2-3 through 1.2-5.The general arrangement of the major structures and equipment is shown on Figures 1.2-6 through 1.2-40.The principal structures located at the site are listed below along with the brief description of the major equipment, within each structure.
Thecapacityofsuchsystemsisadequatetopreventfuelcladdingdamage.6.Thereactorcoreandreactivity controlsystemisdesignedto-ensurethatcontrolrodactioniscapableofbringingthecoresubcritical andmaintaining itthus,evenwiththerodofhighestreactivity worthfullywithdrawn andunavailable forinsertion.
The primary containment structure (Figures 1.2-6'through 1.2-12)houses the reactor pressure vessel, reactor 1.2-13 Nine Mile Point Unit, 2 FSAR recirculation pumps and motors, drywell cooling system unit, coolers, safety relief valves, accumulators, and other equipment.
Analternate reactivity controlsystemisprovidedshouldthecontrolrodsordrivesystembecomeinoperable.
The reactor building and auxiliary bays (Figures-1.2-6 through l.2-12)enclose the primary containment structure.
Thealternate systemiscapableofshuttingdownthereactorandmaintaining itsubcritical.
These structures house the remaining portions of the NSSS, refueling and fuel storage equipment, control rod drive (CRD)hydraulic units, equipment for the reactor water cleanup system (RWCU), equipment for the standby liquid control system (SLCS), equipment for the reactor building closed loop cooling water system, and other equipment.
7.Thereactorcoreis'designed sothat,itsnuclearcharacteristics donotcontribute to'divergent powertransient.
The radwaste building (Figures 1.2-13 and 1.2-14)houses primarily the tanks and equipment associated with the liquid and solid radwaste systems.The control building (Figures 1.2-15 and 1.2-16)houses the main control room, standby switchgear, batteries and associated instrumentation, cables, and equipment.
8.Thenuclearsystemisdesignedsothereisnotendencyfordivergent oscillation ofanyoperating characteristic, considering theinteraction ofthenuclearsystemwith'otherappropriate unitsystems.1.2.1.3.2 PowerConversion Systems.CriteriaComponents ofthepowerconversion systemsaredesignedtoperformthesebasicobjectives:
The diesel generator building (Figures 1.2-17 and 1.2-18)houses three standby diesel generators, diesel oil storage tanks, and associated controls and instrumentation.
Reliablyproduceelectrical powerfromthesteamsuppliedbythereactor,condensethesteamintowater,andreturnthewatertothereactorasheatedfeedwater, withamajorportionofitsgaseousandparticulate impurities removed.2.Assurethatanyfissionproductsorradioactivity associated withthesteamandcondensate duringnormaloperation oraccidentconditions aresafelycontained withinthesystemorarereleasedundercontrolled conditions inaccordance withwastedisposalregulations.
The turbine building including heater bay (Figures 1'-19 through 1.2-25)houses the turbine generator, condensers, moisture separator reheater, condensate demineralizer system, feedwater heaters, steam jet air ejectors, reactor feed pumps, turbine building closed loop cooling water system, and miscellaneous tanks and equipment to support the power conversion system and other related systems.The screenwell building (Figures 1.2-26 through 1.2-28)houses the circulating water pumps and the service water pumps with associated equipment and instrumentation.
1.2-8 NineMilePointUnit2FSAR1.2.1.3.3 Electrical PowerSystemsDesignCriteriaSufficient preferred andstandbyacanddcpowersourcesareprovidedtoattainpromptshutdownandcontinued maintenance oftheunitinasafecondition underallcrediblecircumstances.
The intake and discharge tunnels and intake structures (Figures 1.2-29'and 1.2-30)are used for transporting service water to and from the lake.The intake tunnels also supply makeup water for the circulating water system.The main stack (Figure 1.2-31)is used to provide elevated release of gases from the off-gas, standby gas treatment, and other systems.The off-gas regeneration and condensate demineralizer rooms (Figures 1.2-19 through 1.2-25)house the catalytic recombiners, off-gas filter, condensate demineralizer, and related equipment.
Powersourcesareadequatetoaccomplish allrequiredengineered safeguard functions underpostulated designbasisaccidentconditions.
1.2-14 Nine Mile Point Unit 2 FSAR The normal switchgear building (Figures 1.2-32 and 1.2-33)houses the normal switchgear and associated equipment.
1.2.1.3.4 RadwasteSystemDesignCriteriaRadwastesystemsaredesignedtolimitreleaseofradioactive materials fromtheunitduringnormaloperation tosignificantly lessthantherequirements of10CFR20,andwithintheguidelines ofAppendixIto10CFRSO.Gaseous,liquid,,andsolidwastedisposalsystemsaredesignedsothatoffsiteshipments willbeinaccordance withapplicable regulations, including 10CFR20,10CFR71,and49CFR171through179,asappropriate.
The auxiliary boiler building (Figure 1.2-34), located north of the screenwell building, houses the electric boilers and accessories to supply steam to the plant during shutdown.The standby gas treatment building and railroad access area (Figures 1~2-35 and 1.2-36)house the standby gas treatment, filters and associated equipment and allow access for spent fuel shipping.I The condensate storage tank building (Figure 1.2-37)houses the condensate storage tanks and associated equipment.
3.Thedesignprovidesmeansbywhichunitoperations personnel canbealertedwheneveroperational limitsonthereleaseofradioactive materialareapproached.
The natural-draft cooling tower (Figures 1.2-38 and 1.2-39)provides the normal heat, sink for heat transferred to the circulating water system from the main condensers.
1.2.1.3.5 Auxiliary SystemsDesignCriteriaAuxiliary systemsareprovidedtosupporttheNSSSandpowergeneration systemtoprovideformaintenance oftheplantenvironment, in-plantradiation andairbornecontamination control,compressed airsupplies, sealingsteam,etc.2.Essential auxiliary systemsaredesignedtofunctionduringaccidentconditions.
The auxiliary service building (Figures 1.2-7 and 1.2-8), adjacent to the reactor building, houses the HVAC room and decontamination and shower facilities for personnel.
1.2.1.3.6Shielding andAccessControlDesignCriteriaRadiation shielding isprovidedandaccesscontrolpatternsareestablished toallowaproperlytrainedoperating stafftocontrolradiation doseswithinthelimitsofpublished regulations duringnormaloperation.
The decontamination area (Figures 1.2-19 through 1.2-21, 1.2-23, and 1.2-24), immediately south of the radwaste building, provides the facility for decontamination of large tools and equipment, and a sample room.It also houses clean steam reboilers and related equipment.
Shielding design,equipment layout,andzoninghavebeenperformed toensureradiation dosesaremaintained aslowasreasonably achievable.
The hydrogen storage area (for hydrogen cooling of the turbine generator, Figure 1.2-40)is located west of the off-gas area.The hydrogen storage bottles are mounted on concrete.pads and are in a fenced area.1.2.4 Nuclear Steam Supply System The nuclear system includes a direct.-cycle, forced circulation, GE BWR that produces steam for direct use in the steam turbine.A heat balance showing the major parameters of the nuclear system for the warranted power condition is shown on Figure 1.1-1.The nuclear steam supply system is further discussed in Chapters 4 and 5.1.2.4.1 Reactor Core and Control Rods The reactor fuel and core design are described in Se'ction 2 of Reference 5 and Section 1 of Reference 6.Amendment 21 1.2-15 September 1985 Nine Mile Point Unit 2 FSAR Experience has shown that the control rods are.not susceptible to distortion and have an average life expectancy many times the residence time of a fuel loading.1.2.4.2 Reactor Vessel and Internals The reactor vessel contains the core and supporting structures; the steam separators and dryers;the jet pumps;the control rod guide tubes;the distribution lines for the feedwater, core sprays, and standby liquid control;the incore instrumentation; and other components.
1.2-9 NineNilePointUnit2FSAR2.Themaincontrolroomisshieldedagainst,radiation sothatinconjunction withthecontrolroomairconditioning systemoccupancy isallowedunderaccidentconditions.
The main connections to the vessel include the steam lines, coolant recirculation lines, feedwater lines, CRD and incore nuclear instrument housings, core spray lines, residual heat removal lines, standby liquid control line, core differential pressure line, jet pump pressure sensing lines, and water level instrumentation.
1.2.1.3.7 NuclearSafetySystemsandEngineered Safeguards DesignCriteriaPrincipal designcriteriafornuclearsafetysystemsandengineered safeguards areasfollows:1.Thesecriteriacorrespond to10CFR50GeneralDesignCriteria1through64asdescribed inSection3.1.2~2.Standbyacanddcpowersourcesare,designedtohavesufficient capacitytopowerallnecessary nuclearsafetysystemsandengineered safeguards requiring electrical power.3.Standbyacpowersources-areprovidedtoallowreactorshutdownandremovalofdecayheatwhenoffsitepowerisnotavailable.
The reactor vessel is designed and fabricated in accordance with applicable codes for a pressure of 1,250 psig.The nominal operating pressure in the steam space above the separators is 1,020 psia.The vessel is fabricated of low-alloy steel and is clad internally with stainless steel (except for the top head nozzles and nozzle weld zones which are unclad).The reactor core is cooled by demineralized water that enters the lower portion of the core and boils as it flows upward around the fuel rods.The steam leaving the core is dried by steam separators and dryers located in the upper portion of the.reactor pressure vessel (RPV).The steam is then directed to the turbine through the main steam line'.Each steam line has two isolation valves in series, one on either side of the primary containment barrier.Amendment 21 1.2-16 September 1985 Nine Mile Point Unit 2 FSAR 1.2.4.3 Reactor Recirculation System The reactor recirculation system consists of two recirculation pump loops external to the RPV.These, loops provide the piping path for the driving flow of water to the RPV~jet pumps.Each external loop contains one high capacity motor-driven recirculation pump, two motor-operated maintenance valves, and one hydraulically operated flow control valve.The variable position hydraulic flow control valve operates in conjunction with a low.frequency motor generator set to control reactor power level through the effects of'coolant flow rate on moderator void.content.The jet pumps are RPV internals.
lntheeventthatthemaincontrolroomisuninhabitable, itispossibletobringthereactorfrompowerrangeoperation toacoldshutdowncondition byuseoftheshutdownroomormanipulating localcontrolsandequipment thatareavailable outsidethecontrolroom.5.Backupreactorshutdowncapability isprovidedindependently ofnormalreactivity controlprovisions.
They provide a continuous internal circulation path for the major portion of the core coolant flow.The jet pumps are located in the annular region between the core shroud and the vessel inner wall.Any recirculation line break still allows core flooding to approximately two-thirds of the core height, the level of the inlet of the jet pumps.1.2.4.4 Residual Heat Removal System The residual, heat removal (RHR)system is a system of pumps, heat exchangers, and piping that fulfills the following functions:
Thisbackupsystemhasthecapability toshutdownthereactorfromanynormalorupsetoperating condition andsubsequently tomaintaintheshutdowncondition.
1~Remove's decay and sensible heat during and after plant shutdown.2.Injects water into the RPV following a LOCA to reflood the, core independently of other core.cooling systems.3.Removes heat from the primary containment following a LOCA, to limit the increase in primary containment pressure.This is accomplished by cooling and recirculating" the suppres'sion pool water.and by spraying the drywell and suppression pool air spaces with suppression pool water.1.2.4.5 Reactor Water Cleanup System The RWCU system recirculates a portion of reactor coolant through a filter-demineralizer to remove particulate and dissolved.
1.2.1.3.8ProcessControlSyst:emDesignCriteriaPrincipal designcriteriaforprocesscontrolsystemsarelistedasfollows:NSSSProcessControlDesinCriteria1.Controlequipment isprovidedtoallowthereactortorespondautomatically toloadchangeswithindesignlimits.1.2-10 NineMilePointUnit2FSAR2.Controlsareprovidedtomanuallycontrolreactorpowerlevel.3.Controlofthenuclearsystemispossiblefrom-a--single"location.
impurities from the.reactor coolant.It also removes excess coolant from the reactor system under controlled conditions.
Nuclearsystemsprocesscontrolsandalarmsarearrangedtoallowtheoperatortorapidlyassessthecondition ofthenuclearsystemandtolocateprocesssystemmalfunctions.
1.2-17 Nine Mile Point Unit 2 FSAR 1.2.4.6 Nuclear Leak Detection System The nuclear leak detection and monitoring system consists of temperature, pressure, flow, and fission-product sensors with associated instrumentation and alarms.This system detects and annunciates leakage in the following.
5.Interlocks orotherautomatic equipment areprovidedasabackuptoprocedural controlstoavoidconditions r'equiring actuation ofnuclearsafetysystemsorengineered safeguards.
systems: 1~Main steam lines.2.Reactor water cleanup system.3.Residual heat removal system.4.Reactor core isolation cooling (RClC)system.5.Feedwater system.6.Emergency core cooling systems~7.Miscellaneous systems.Small leaks generally are detected by monitoring area temperatures, radiation levels, and dcain sump fillup and pumpout rates.Large leaks are also detected by changes in reactor water level, primary containment pressure and changes in flow rates in process lines.1.2.5 Electrical, Instrumentation, and Control Systems 1.2.5.1 Electrical Power System The plant electrical power system consists of the unit generator, the switchyard, and the unit auxiliary power distribution system.'I The unit generator is connected directly to the generator step-up.transformers and the normal station service transformer through isolated phase bus duct.The generator step-up transformers step up the output of the unit generator from 25 kV to a nominal 345-kV transmission system voltage.The normal station service transformer steps down the unit generator voltage from 25 to 13.8 kV and provides an onsite (ac)power source to the unit auxiliary power~distribution system.The switchyard has two separate and independent sections: the 345-kV switchyard and the 115-kV switchyard.
PowerConversion SstemsProcessControlDesinCriteriaControlequipment isprovidedtocontrolreactorpressurethroughout itsoperating range.2.Theturbineiscapableofresponding automatically tominorchangesinload.3.,Thefeedwater systemiscontrolled tomaintainthewaterlevelinthereactorvesselattheoptimumlevelrange.4Controlofthepowerconversion equipment ispossiblefromonelocation.
The output of the generator step-up.transformers is connected to the 345-kV switchyard which connects the unit Amendment 18 1.2-18 March 1985 Nine Mile Point Unit 2 FSAR generator to the outgoing transmission system.-The 115-kV switchyard receives power from two separate offsite power sources through'wo physically and electrically independent incoming circuits.'he two circuits feed'two separate reserve station service transformers and an auxiliary boiler transformer.
5.Interlocks orother,automatic equipment areprovidedasabackuptoprocedural controlstoavoidconditions requiring theactuation ofnuclearsafetysystemsorengineered safeguards.
The reser've station service transformers step down the offsite power from 115 to 13.8 and 4.16 kV, and provide two independent"offsite power sources for the unit auxiliary-power distribution system.The auxiliary boiler transformer steps down the offsite power from 115 to 13.8 and 4.16 kV.Its'3.8-kV winding supplies power to the auxiliary boiler and associated equipment; the 4.16-kV tertiary winding provides a backup source'or the emergency 4.16-kV buses.The unit auxiliary power distribution system feeds all unit auxiliary loads through 13.8-kV switchgear, 4.16-kV switchgear, 600-V load centers, 600-V motor control centers, and various ac and dc distribution panels.The system is divided'into'nuclear nonsafety-related and nuclear safety-related systems.The nuclear nonsafety-related auxiliary power'distribution system feeds all non-Class 1E unit auxiliary loads.'nder normal plant operating conditions, it is energized from the normal station service transformer..''
Electrical PowerSstemProcessControlDesinCriteriaThesafety-related (Class1E)electrical powersystemisdesignedasathree-division system,anytwooutofthreedivisions beingadequatetosafelyshutdowntheunit.2.Theprotection systemisdesignedtodetectandisolatefaultedequipment fromthesystemwithaminimumofdisturbance intheeventofanyfaultinthesystem.Amendment 211.2-11September 1985 NineMilePointUnit2FSAR3.Intheeventofalossofoffsitepowertheprotection systemisolatestheemergency busesfromtheoffsitesystemandinitiates thestartingofthestandbyacpowersources.4.IntheeventoflossofoffsitepowerandLOCAtheprotection systemisolatesthe:emergency busesfromtheoffsitesystemandthenormalelectrical system,andthestandbydieselgenerators arestartedandsequentially loadedbyaprogrammed controlsystemtoenergizeallsafety-related loads.5.Allelectrically-operated breakersarecontrollable fromthecontrolroom.6'.Meteringforgenerators, transformers, andotheressential circuitsisavailable inthecontrolroom.1.2.2SiteDescription 1.2.2.1SiteCharacteristics:
During'-startup and normal shutdown conditions, it.is energized from offsite power sources through reserve station service transformers' normal 125-V dc system, consisting of batteries, battery chargers, and distribution panels, provides a reliable source of power for protection, control, and instrumentation loads and dc motors under normal and emergency conditions of the plant.A i24-V dc system provides'a reliable source for the neutron monitoring system.The nuclear safety-related auxiliary power distribution system supplies all Class 1E unit auxiliary loads.This system is, divided into three independent divisions.
SiteLocationandSizeTheprojectsitecomprises approximately 364ha(900acres)andislocatedonthesouthshoreofLakeOntariointhetownofScriba,OswegoCounty,NY,onlandownedbytheNiagaraMohawkPowerCorporation (NMPC).TheNineMilePointNuclearStation-Unit2(Unit2)sharesthesitewithexistingUnit1;Unit2andsupportfacilities occupyabout18.2ha(45acres)ofthetotalsiteacreage.TheJamesA.FitzPatrick plant,ownedbytheNYPA,islocatedeastoftheprojectsite.Thecenterline-to-centerline distancebetweenUnit2andtheFitzPatrick plantreactorsisabout716m(2,350ft).ThedistancebetweentheNineMilePointUnit1andUnit2reactorcenterlines isabout274m(900ft).ThesiteplanisshownonFigure1.2-1.Allactivities atthesiteareunderthedirectcontrolofNMPC"'.1.2.2.2AccesstotheSiteTheprotected areaofthesiteisisolatedfromthesurrounding areabyfencing.Accesstothesiteiscontrolled atthegateofthemainentrancetotheplantbysecuritypersonnel.
Division I and Division II are independent redundant divisions and supply all nuclear safety-related auxiliary loads except the high pressure core spray (HPCS)system.The HPCS system ,and related equipment are supplied by Division.III..All three divisions are normally energized from the offsite power sources through reserve station service transformers.
Allothergatesarekeptlocked"'.
The auxiliary boiler transformer can be connected manually to act as a backup source for either the Division I or Division II supply.Each of the three divisions of the nuclear safety-related auxiliary power distribution systems has its own independent standby diesel generator.
USARRevision41.2-12October1992 NineMilePointUnit2FSAR1~2.2.3Description oftheSiteandEnvironsMostofthelandimmediately tothesouthandwestofthesiteispastureorinactivefarmland.
In the event of a LOCA and/or 1.2-19 Nine Mile Point Unit 2 FSAR.loss of offsite power, each division is energized from its,, own standby diesel generator.
Fortheregionwest,south,andeastofthesite,thecountryischaracterized byrollingterrainrisinggentlyupfromLakeOntariowhichliesimmediately tothenorthofthesite.Withinanapproximate 8-km(5-mi)radiusofUnit2,the1980population was3,468.Thepopulation forthissameareaisprojected tobe5,301in1990and7,213in2010.Thenearestdwellings areonLakeviewRoadapproximately 1.6km(1mi)fromthestation.TheOntarioBibleConference operatesasummercamponthelakefront adjacenttothewesternboundaryofthesite'swego, whichisthenearestcity,islocatedabout10km(6.2mi)southwest ofthesiteandhada1980population of19,793.Thenearestpopulation centerwithapopulation inexcessof25,000isthecityofSyracuse, approximately 53km(32.8mi)southeast ofthesite.Buffaloisapproximately 217km(135mi)westofthesite.Figure2.1-1showsthelocationofthesiterelativetothelargercitiesinNewYorkStatewhicharewithinthe80-km(50-mi)radiusofthesite.1.2.3Structures andEquipment Thebuildings andstructures essential tothesafeoperation andshutdownoftheplantaredesignedtowithstand extremeenvironmental andabnormalloadingconditions.
A 125-V emergency.
Thestructures and/orportionsthereofsodesignated aredesignedtoprovidetheprotection asrequiredfromtornadoes,
dc power;system feeds all safety-related dc,protection, control, and instrumentation loads and safety-related dc motors under normal.operation of the plant as well as during emergency.
: missiles, earthquakes, pipewhip,andinternalorexternalflooding.
Additional discussions ofdesignconsiderations arefoundinChapter3.Locations andorientation ofthestructures areshownonFigures1.2-1and1.2-2.Thegeneralarrangement ofpersonnel accessbetweenstructures isshownonFigures1.2-3through1.2-5.Thegeneralarrangement ofthemajorstructures andequipment isshownonFigures1.2-6through1.2-40.Theprincipal structures locatedatthesitearelistedbelowalongwiththebriefdescription ofthemajorequipment, withineachstructure.
Theprimarycontainment structure (Figures1.2-6'through 1.2-12)housesthereactorpressurevessel,reactor1.2-13 NineMilePointUnit,2FSARrecirculation pumpsandmotors,drywellcoolingsystemunit,coolers,safetyreliefvalves,accumulators, andotherequipment.
Thereactorbuildingandauxiliary bays(Figures-1.2-6throughl.2-12)enclosetheprimarycontainment structure.
Thesestructures housetheremaining portionsoftheNSSS,refueling andfuelstorageequipment, controlroddrive(CRD)hydraulic units,equipment forthereactorwatercleanupsystem(RWCU),equipment forthestandbyliquidcontrolsystem(SLCS),equipment forthereactorbuildingclosedloopcoolingwatersystem,andotherequipment.
Theradwastebuilding(Figures1.2-13and1.2-14)housesprimarily thetanksandequipment associated withtheliquidandsolidradwastesystems.Thecontrolbuilding(Figures1.2-15and1.2-16)housesthemaincontrolroom,standbyswitchgear, batteries andassociated instrumentation, cables,andequipment.
Thedieselgenerator building(Figures1.2-17and1.2-18)housesthreestandbydieselgenerators, dieseloilstoragetanks,andassociated controlsandinstrumentation.
Theturbinebuildingincluding heaterbay(Figures1'-19through1.2-25)housestheturbinegenerator, condensers, moistureseparator
: reheater, condensate demineralizer system,feedwater heaters,steamjetairejectors, reactorfeedpumps,turbinebuildingclosedloopcoolingwatersystem,andmiscellaneous tanksandequipment tosupportthepowerconversion systemandotherrelatedsystems.Thescreenwell building(Figures1.2-26through1.2-28)housesthecirculating waterpumpsandtheservicewaterpumpswithassociated equipment andinstrumentation.
Theintakeanddischarge tunnelsandintakestructures (Figures1.2-29'and1.2-30)areusedfortransporting servicewatertoandfromthelake.Theintaketunnelsalsosupplymakeupwaterforthecirculating watersystem.Themainstack(Figure1.2-31)isusedtoprovideelevatedreleaseofgasesfromtheoff-gas,standbygastreatment, andothersystems.Theoff-gasregeneration andcondensate demineralizer rooms(Figures1.2-19through1.2-25)housethecatalytic recombiners, off-gasfilter,condensate demineralizer, andrelatedequipment.
1.2-14 NineMilePointUnit2FSARThenormalswitchgear building(Figures1.2-32and1.2-33)housesthenormalswitchgear andassociated equipment.
Theauxiliary boilerbuilding(Figure1.2-34),locatednorthofthescreenwell
: building, housestheelectricboilersandaccessories tosupplysteamtotheplantduringshutdown.
Thestandbygastreatment buildingandrailroadaccessarea(Figures1~2-35and1.2-36)housethestandbygastreatment, filtersandassociated equipment andallowaccessforspentfuelshipping.
IThecondensate storagetankbuilding(Figure1.2-37)housesthecondensate storagetanksandassociated equipment.
Thenatural-draft coolingtower(Figures1.2-38and1.2-39)providesthenormalheat,sinkforheattransferred tothecirculating watersystemfromthemaincondensers.
Theauxiliary servicebuilding(Figures1.2-7and1.2-8),adjacenttothereactorbuilding, housestheHVACroomanddecontamination andshowerfacilities forpersonnel.
Thedecontamination area(Figures1.2-19through1.2-21,1.2-23,and1.2-24),immediately southoftheradwastebuilding, providesthefacilityfordecontamination oflargetoolsandequipment, andasampleroom.Italsohousescleansteamreboilers andrelatedequipment.
Thehydrogenstoragearea(forhydrogencoolingoftheturbinegenerator, Figure1.2-40)islocatedwestoftheoff-gasarea.Thehydrogenstoragebottlesaremountedonconcrete.padsandareinafencedarea.1.2.4NuclearSteamSupplySystemThenuclearsystemincludesadirect.-cycle, forcedcirculation, GEBWRthatproducessteamfordirectuseinthesteamturbine.Aheatbalanceshowingthemajorparameters ofthenuclearsystemforthewarranted powercondition isshownonFigure1.1-1.Thenuclearsteamsupplysystemisfurtherdiscussed inChapters4and5.1.2.4.1ReactorCoreandControlRodsThereactorfuelandcoredesignaredescribed inSe'ction2ofReference 5andSection1ofReference 6.Amendment 211.2-15September 1985 NineMilePointUnit2FSARExperience hasshownthatthecontrolrodsare.notsusceptible todistortion andhaveanaveragelifeexpectancy manytimestheresidence timeofafuelloading.1.2.4.2ReactorVesselandInternals Thereactorvesselcontainsthecoreandsupporting structures; thesteamseparators anddryers;thejetpumps;thecontrolrodguidetubes;thedistribution linesforthefeedwater, coresprays,andstandbyliquidcontrol;theincoreinstrumentation; andothercomponents.
Themainconnections tothevesselincludethesteamlines,coolantrecirculation lines,feedwater lines,CRDandincorenuclearinstrument
: housings, corespraylines,residualheatremovallines,standbyliquidcontrolline,coredifferential pressureline,jetpumppressuresensinglines,andwaterlevelinstrumentation.
Thereactorvesselisdesignedandfabricated inaccordance withapplicable codesforapressureof1,250psig.Thenominaloperating pressureinthesteamspaceabovetheseparators is1,020psia.Thevesselisfabricated oflow-alloysteelandiscladinternally withstainless steel(exceptforthetopheadnozzlesandnozzleweldzoneswhichareunclad).Thereactorcoreiscooledbydemineralized waterthatentersthelowerportionofthecoreandboilsasitflowsupwardaroundthefuelrods.Thesteamleavingthecoreisdriedbysteamseparators anddryerslocatedintheupperportionofthe.reactorpressurevessel(RPV).Thesteamisthendirectedtotheturbinethroughthemainsteamline'.Eachsteamlinehastwoisolation valvesinseries,oneoneithersideoftheprimarycontainment barrier.Amendment 211.2-16September 1985 NineMilePointUnit2FSAR1.2.4.3ReactorRecirculation SystemThereactorrecirculation systemconsistsoftworecirculation pumploopsexternaltotheRPV.These,loopsprovidethepipingpathforthedrivingflowofwatertotheRPV~jetpumps.Eachexternalloopcontainsonehighcapacitymotor-driven recirculation pump,twomotor-operated maintenance valves,andonehydraulically operatedflowcontrolvalve.Thevariablepositionhydraulic flowcontrolvalveoperatesinconjunction withalow.frequency motorgenerator settocontrolreactorpowerlevelthroughtheeffectsof'coolant flowrateonmoderator void.content.ThejetpumpsareRPVinternals.
Theyprovideacontinuous internalcirculation pathforthemajorportionofthecorecoolantflow.Thejetpumpsarelocatedintheannularregionbetweenthecoreshroudandthevesselinnerwall.Anyrecirculation linebreakstillallowscorefloodingtoapproximately two-thirds ofthecoreheight,theleveloftheinletofthejetpumps.1.2.4.4ResidualHeatRemovalSystemTheresidual, heatremoval(RHR)systemisasystemofpumps,heatexchangers, andpipingthatfulfillsthefollowing functions:
1~Remove'sdecayandsensibleheatduringandafterplantshutdown.
2.InjectswaterintotheRPVfollowing aLOCAtorefloodthe,coreindependently ofothercore.coolingsystems.3.Removesheatfromtheprimarycontainment following aLOCA,tolimittheincreaseinprimarycontainment pressure.
Thisisaccomplished bycoolingandrecirculating" thesuppres'sion poolwater.andbysprayingthedrywellandsuppression poolairspaceswithsuppression poolwater.1.2.4.5ReactorWaterCleanupSystemTheRWCUsystemrecirculates aportionofreactorcoolantthroughafilter-demineralizer toremoveparticulate anddissolved.
impurities fromthe.reactorcoolant.Italsoremovesexcesscoolantfromthereactorsystemundercontrolled conditions.
1.2-17 NineMilePointUnit2FSAR1.2.4.6NuclearLeakDetection SystemThenuclearleakdetection andmonitoring systemconsistsoftemperature,
: pressure, flow,andfission-product sensorswithassociated instrumentation andalarms.Thissystemdetectsandannunciates leakageinthefollowing.
systems:1~Mainsteamlines.2.Reactorwatercleanupsystem.3.Residualheatremovalsystem.4.Reactorcoreisolation cooling(RClC)system.5.Feedwater system.6.Emergency corecoolingsystems~7.Miscellaneous systems.Smallleaksgenerally aredetectedbymonitoring areatemperatures, radiation levels,anddcainsumpfillupandpumpoutrates.Largeleaksarealsodetectedbychangesinreactorwaterlevel,primarycontainment pressureandchangesinflowratesinprocesslines.1.2.5Electrical, Instrumentation, andControlSystems1.2.5.1Electrical PowerSystemTheplantelectrical powersystemconsistsoftheunitgenerator, theswitchyard, andtheunitauxiliary powerdistribution system.'ITheunitgenerator isconnected directlytothegenerator step-up.transformers andthenormalstationservicetransformer throughisolatedphasebusduct.Thegenerator step-uptransformers stepuptheoutputoftheunitgenerator from25kVtoanominal345-kVtransmission systemvoltage.Thenormalstationservicetransformer stepsdowntheunitgenerator voltagefrom25to13.8kVandprovidesanonsite(ac)powersourcetotheunitauxiliary power~distribution system.Theswitchyard hastwoseparateandindependent sections:
the345-kVswitchyard andthe115-kVswitchyard.
Theoutputofthegenerator step-up.transformers isconnected tothe345-kVswitchyard whichconnectstheunitAmendment 181.2-18March1985 NineMilePointUnit2FSARgenerator totheoutgoingtransmission system.-The115-kVswitchyard receivespowerfromtwoseparateoffsitepowersourcesthrough'wo physically andelectrically independent incomingcircuits.
'hetwocircuitsfeed'twoseparatereservestationservicetransformers andanauxiliary boilertransformer.
Thereser'vestationservicetransformers stepdowntheoffsitepowerfrom115to13.8and4.16kV,andprovidetwoindependent "offsitepowersourcesfortheunitauxiliary
-powerdistribution system.Theauxiliary boilertransformer stepsdowntheoffsitepowerfrom115to13.8and4.16kV.Its'3.8-kV windingsuppliespowertotheauxiliary boilerandassociated equipment; the4.16-kVtertiarywindingprovidesabackupsource'or theemergency 4.16-kVbuses.Theunitauxiliary powerdistribution systemfeedsallunitauxiliary loadsthrough13.8-kVswitchgear, 4.16-kVswitchgear, 600-Vloadcenters,600-Vmotorcontrolcenters,andvariousacanddcdistribution panels.Thesystemisdivided'into'nuclearnonsafety-related andnuclearsafety-relatedsystems.Thenuclearnonsafety-related auxiliary power'distribution systemfeedsallnon-Class 1Eunitauxiliary loads.'ndernormalplantoperating conditions, itisenergized fromthenormalstationservicetransformer..''
During'-startupandnormalshutdownconditions, it.isenergized fromoffsitepowersourcesthroughreservestationservicetransformers' normal125-Vdcsystem,consisting ofbatteries, batterychargers, anddistribution panels,providesareliablesourceofpowerforprotection, control,andinstrumentation loadsanddcmotorsundernormalandemergency conditions oftheplant.Ai24-Vdcsystemprovides'areliablesourcefortheneutronmonitoring system.Thenuclearsafety-related auxiliary powerdistribution systemsuppliesallClass1Eunitauxiliary loads.Thissystemis,dividedintothreeindependent divisions.
DivisionIandDivisionIIareindependent redundant divisions andsupplyallnuclearsafety-related auxiliary loadsexceptthehighpressurecorespray(HPCS)system.TheHPCSsystem,andrelatedequipment aresuppliedbyDivision.III..Allthreedivisions arenormallyenergized fromtheoffsitepowersourcesthroughreservestationservicetransformers.
Theauxiliary boilertransformer canbeconnected manuallytoactasabackupsourceforeithertheDivisionIorDivisionIIsupply.Eachofthethreedivisions ofthenuclearsafety-related auxiliary powerdistribution systemshasitsownindependent standbydieselgenerator.
IntheeventofaLOCAand/or1.2-19 NineMilePointUnit2FSAR.lossofoffsitepower,eachdivisionisenergized fromits,,ownstandbydieselgenerator.
A125-Vemergency.
dcpower;systemfeedsallsafety-related dc,protection, control,andinstrumentation loadsandsafety-related dcmotorsundernormal.operation oftheplantaswellasduringemergency.
conditions.
conditions.
,Thesystemisdividedintothree,independent divisions eachconsisting ofitsownbattery,primaryandbackupbatterychargers, switchgear, motorcontrolcenters,anddistribution panels.Eachdivisionfeedsthedc.loadsassociated withthe.corresponding divisions ofthenuclearsafety-related auxiliary powerdistribution system.tChapter8describes theelectrical, powersystemindetail.1.2.5.2NuclearSystemProcessControlandInstrumentation ReactorManualControlSstemThereactormanualcontrolsystem(RMCS)providesthemeansbywhichcontrolrodsarepositioned fromthecontrolroomforpowercontrol.Thesystemoperatesvalvesineachhydraulic controlunittochangecontrolrodposition.
, The system is divided into three, independent divisions each consisting of its own battery, primary and backup battery chargers, switchgear, motor control centers, and distribution panels.Each division feeds the dc.loads associated with the.corresponding divisions of the nuclear safety-related auxiliary power distribution system.t Chapter 8 describes the electrical, power system in detail.1.2.5.2 Nuclear System Process Control and Instrumentation Reactor Manual Control S stem The reactor manual control system (RMCS)provides the means by which control rods are positioned from the control room for power control.The system operates valves in each hydraulic control unit to change control rod position.One control rod can be manipulated at a time.The RMCS includes the logic that restricts abnormal control rod movement (rod block)under certain conditions as a backup to procedural controls.Recirculation Flow Control S stem P f During normal power operation, a variable position discharge valve is used'to control flow.Adjusting this valve changes the coolant flow rate through the core and thereby changes the core power level.Neutron Monitorin S stem!'he neutron monitoring system (NMS)is a system of incore neutron detectors and out-of-core electronic monitoring equipment.
Onecontrolrodcanbemanipulated atatime.TheRMCSincludesthelogicthatrestricts abnormalcontrolrodmovement(rodblock)undercertainconditions asabackuptoprocedural controls.
The system provides indication of neutron flux, which'an be correlated to thermal power level for the entire range of flux conditions that can exist in the core.The source range monitors (SRMs)and the" intermediate range monitors (IRMs)provide flux level indications during reactor startup and low-power operation.
Recirculation FlowControlSstemPfDuringnormalpoweroperation, avariablepositiondischarge valveisused'tocontrolflow.Adjusting thisvalvechangesthecoolantflowratethroughthecoreandtherebychangesthecorepowerlevel.NeutronMonitorin Sstem!'heneutronmonitoring system(NMS)isasystemofincoreneutrondetectors andout-of-core electronic monitoring equipment.
The local power range monitors (LPRMs)and average power range monitors (APRMs)allow assessment of local and overall flux conditions during power range operation.
Thesystemprovidesindication ofneutronflux,which'anbecorrelated tothermalpowerlevelfortheentirerangeoffluxconditions thatcanexistinthecore.Thesourcerangemonitors(SRMs)andthe"intermediate rangemonitors(IRMs)providefluxlevelindications duringreactorstartupandlow-power operation.
The traversing incore probe (TIP)'system provides a'eans to calibrate the USAR Revision 0 1.2-20 April 1989 Nine Mile Point Unit 2 FSAR individual LPRM.sensors.The NMS provides inputs to the RMCS to initiate rod blocks if preset flux limits are exceeded, and inputs to the reactor protection system to initiate a scram if other limits are exceeded.Refuelin Interlocks A system of interlocks that restrict movement of refueling equipment and control rods when the reactor is in the refueling and startup modes is provided to prevent an inadvertent criticality during refueling operations.
Thelocalpowerrangemonitors(LPRMs)andaveragepowerrangemonitors(APRMs)allowassessment oflocalandoverallfluxconditions duringpowerrangeoperation.
The interlocks back up procedural controls that have the same objective.
Thetraversing incoreprobe(TIP)'systemprovidesa'eanstocalibrate theUSARRevision01.2-20April1989 NineMilePointUnit2FSARindividual LPRM.sensors.
The interlocks affect the refueling platform, refueling platform hoists, fuel grapple, and control rods.Reactor Vessel Instrumentation reactor vessel head ann Process Com uter S stem In addition to instrumentation for the nuclear safety systems and engineered safety features, instrumentation is provided to monitor and transmit information that can be used to assess conditions existing inside the reactor vessel and the physical condition of the vessel itself.This instrumentation monitors reactor vessel pressure, water level, coolant temperature, reactor core differential pressure, coolant flow rates, and er seal ring leakage.An online process computer is provided to monitor and log process variables and to make certain analytical computations.
TheNMSprovidesinputstotheRMCStoinitiaterodblocksifpresetfluxlimitsareexceeded, andinputstothereactorprotection systemtoinitiateascramifotherlimitsareexceeded.
The nuclear measurement analysis and control rod worth minimizer (NUMAC RNM)prevents rod withdrawal under low-power conditions if the rod to be withdrawn is not in accordance with a preplanned pattern.The effect of the rod block is to limit the reactivity worth of the control rods by enforcing adherence to the preplanned rod pattern.Chapter 7 describes these systems in detail.1.2.5.3 Power Conversion Systems Process Control and Instrumentation Pressure Re lator and Turbine Generator Control The pressure regulator maintains control of the turbine control and turbine bypass valves to allow proper generator and reactor response to system load-demand changes while maintaining the nuclear system pressure essentially constant.USAR Revision 3 1.2-21 October 1991 Nine Mile Point Unit 2 FSAR The turbine generator speed-load controls can initiate rapid closure of the turbine control valves (rapid opening of the turbine bypass valves)to prevent turbine overspeed on loss of the generator electric load.Feedwater Control S stem The feedwater control system automatically controls the flow of feedwater into the reactor pressure.vessel to maintain the water within the vessel at predetermined levels.A three-element control system (main steam flow rate, feedwater flow rate, and reactor vessel water level)is used to accomplish this function.Chapter 10 describes the system in greater detail.1.2.6 Radioactive Waste System The disposal of radioactive wastes from the site is managed by waste systems designed to meet all applicable regulatory
RefuelinInterlocks Asystemofinterlocks thatrestrictmovementofrefueling equipment andcontrolrodswhenthereactorisintherefueling andstartupmodesisprovidedtopreventaninadvertent criticality duringrefueling operations.
>9[requirements, including 10CFR20, 10CFR60, 10CFR61, General Design Criterion 60, and Regulatory Guide 1.21.There are three interrelated radioactive waste treatment systems: radioactive liquid waste, radioactive gaseous waste, and radioactive solid waste.These systems are described in Chapter 11.The radioactive liquid waste (LWS)system collects and processes radioactive waste liquids generated during plant operation and refueling, either for recycle within the plant or for discharge offsite.The process operations available to treat the liquid wastes are filtration, evaporation, demineralization, and decantation.
Theinterlocks backupprocedural controlsthathavethesameobjective.
Process descriptions and flow charts illustrate the number and sequence of.processing steps to be applied to each type of liquid waste.Gaseous radwaste from the main condenser is processed through a recombiner to remove hydrogen, after which the gas is cooled, then dried.Waste gas is then passed through a charcoal bed and filter system, which holds up radioactive components and removes particulate matter before release.Contaminated drywell and building ventilation exhausts are processed by the standby gas treatment and ventilation systems.The radioactive solid waste system provides holdup, packaging, and storage facilities for eventual offsite shipment and ultimate disposal of solid radioactive waste material.The process operations consist of volume Amendment 19 1.2-22 May 1985 Nine Mile Point Unit 2 FSAR reduction and solidification with asphalt of radioactive wastes such as LWS evaporator concentrates, spent resins, and filter sludges.Dry radioactive wastes such as contaminated paper, clothing, and tools are compacted and packaged.After processing, the solid waste materials are stored for additional decay and then'shipped offsite for appropriate disposal.Shielding, as required during the processing and shipment of the solid wastes, is included in the planned operation of the solid waste system.A description and flow diagram of the processing and handling sequences for the solid wastes generated onsite is provided in Chapter 11.1.2'Fuel Handling and Storage Systems 1.2.7'New Fuel Storage The new fuel facility is designed to prevent inadvertent criticality and load buckling of the new fuel assemblies.
Theinterlocks affecttherefueling
Both the new fuel storage vault and storage racks are designed to comply with Category I requirements.
: platform, refueling platformhoists,fuelgrapple,andcontrolrods.ReactorVesselInstrumentation reactorvesselheadannProcessComuterSstemInadditiontoinstrumentation forthenuclearsafetysystemsandengineered safetyfeatures, instrumentation isprovidedtomonitorandtransmitinformation thatcanbeusedtoassessconditions existinginsidethereactorvesselandthephysicalcondition ofthevesselitself.Thisinstrumentation monitorsreactorvesselpressure, waterlevel,coolanttemperature, reactorcoredifferential
The new fuel storage vault is designed with sufficient drainage to preclude flooding.The vault is also equipped with a monitoring system to warn of radiation level increases above normal operating conditions.
: pressure, coolantflowrates,andersealringleakage.Anonlineprocesscomputerisprovidedtomonitorandlogprocessvariables andtomakecertainanalytical computations.
t The design of the new fuel storage racks limits keff 50.90 in the dry condition and keff 60.95 in a flooded condition.
Thenuclearmeasurement analysisandcontrolrodworthminimizer (NUMACRNM)preventsrodwithdrawal underlow-power conditions iftherodtobewithdrawn isnotinaccordance withapreplanned pattern.Theeffectoftherodblockistolimitthereactivity worthofthecontrolrodsbyenforcing adherence tothepreplanned rodpattern.Chapter7describes thesesystemsindetail.1.2.5.3PowerConversion SystemsProcessControlandInstrumentation PressureRelatorandTurbineGenerator ControlThepressureregulator maintains controloftheturbinecontrolandturbinebypassvalvestoallowpropergenerator andreactorresponsetosystemload-demand changeswhilemaintaining thenuclearsystempressureessentially constant.
1.2.7.2 Spent Fuel Storage The spent fuel storage racks are designed to maintain spent fuel in a space geometry that prevents criticality in normal and abnormal conditions.
USARRevision31.2-21October1991 NineMilePointUnit2FSARTheturbinegenerator speed-load controlscaninitiaterapidclosureoftheturbinecontrolvalves(rapidopeningoftheturbinebypassvalves)topreventturbineoverspeed onlossofthegenerator electricload.Feedwater ControlSstemThefeedwater controlsystemautomatically controlstheflowoffeedwater intothereactorpressure.vesseltomaintainthewaterwithinthevesselatpredetermined levels.Athree-element controlsystem(mainsteamflowrate,feedwater flowrate,andreactorvesselwaterlevel)isusedtoaccomplish thisfunction.
The racks are capable of withstanding maximum uplift forces generated without effect on the subcritical array.The design of the spent fuel racks will limit keff 50.95 in normal and abnormal storage conditions.
Chapter10describes thesystemingreaterdetail.1.2.6Radioactive WasteSystemThedisposalofradioactive wastesfromthesiteismanagedbywastesystemsdesignedtomeetallapplicable regulatory
There is sufficient shielding, a cooling system, and radiation monitoring to prevent overheating and excessive personnel exposure.The spent fuel storage pool and racks are corrosion resistant, and adhere to Category I requirements.
>9[requirements, including 10CFR20,10CFR60,10CFR61,GeneralDesignCriterion 60,andRegulatory Guide1.21.Therearethreeinterrelated radioactive wastetreatment systems:radioactive liquidwaste,radioactive gaseouswaste,andradioactive solidwaste.Thesesystemsaredescribed inChapter11.Theradioactive liquidwaste(LWS)systemcollectsandprocesses radioactive wasteliquidsgenerated duringplantoperation andrefueling, eitherforrecyclewithintheplantorfordischarge offsite.Theprocessoperations available totreattheliquidwastesarefiltration, evaporation, demineralization, anddecantation.
1.2-23 Nine Mile Point Unit 2 FSAR 1.2.7.3 Fuel Handling System The fuel handling equipment includes the following:
Processdescriptions andflowchartsillustrate thenumberandsequenceof.processing stepstobeappliedtoeachtypeofliquidwaste.Gaseousradwastefromthemaincondenser isprocessed througharecombiner toremovehydrogen, afterwhichthegasiscooled,thendried.Wastegasisthenpassedthroughacharcoalbedandfiltersystem,whichholdsupradioactive components andremovesparticulate matterbeforerelease.Contaminated drywellandbuildingventilation exhaustsareprocessed bythestandbygastreatment andventilation systems.Theradioactive solidwastesystemprovidesholdup,packaging, andstoragefacilities foreventualoffsiteshipmentandultimatedisposalofsolidradioactive wastematerial.
1.Fuel inspection stand.2~Fuel preparation machine.3.125-ton crane.4.Refueling platform.5~General purpose grapple.6;Jib cranes.7.Other related tools for fuel and reactor servicing.
Theprocessoperations consistofvolumeAmendment 191.2-22May1985 NineMilePointUnit2FSARreduction andsolidification withasphaltofradioactive wastessuchasLWSevaporator concentrates, spentresins,andfiltersludges.Dryradioactive wastessuchascontaminated paper,clothing, andtoolsarecompacted andpackaged.
All equipment conforms to applicable codes and standards.
Afterprocessing, thesolidwastematerials arestoredforadditional decayandthen'shippedoffsiteforappropriate disposal.
1.2.7.4 Spent Fuel Pool Cooling and Cleanup System The spent fuel cooling and cleanup (SFC)system provides removal of decay heat from the stored spent fuel and maintains specified water temperature, purity, clarity, and level.This process prevents the spent fuel from overheating
Shielding, asrequiredduringtheprocessing andshipmentofthesolidwastes,isincludedintheplannedoperation ofthesolidwastesystem.Adescription andflowdiagramoftheprocessing andhandlingsequences forthesolidwastesgenerated onsiteisprovidedinChapter11.1.2'FuelHandlingandStorageSystems1.2.7'NewFuelStorageThenewfuelfacilityisdesignedtopreventinadvertent criticality andloadbucklingofthenewfuelassemblies.
'nd the buildup of excessive radioactive materials in the cooling water, thereby minimizing radiation levels.The system includes.two heat exchangers, each of which is capable of removing the full decay heat from a normal refueling offload of spent fuels A cross connection to the RHR system provides additional emergency backup cooling and cooling during a full core offload.Chapter'gives further details of the fuel handling and storage system.1.2.8 Power Conversion System Chapter 10 provides a detailed discussion of the following equipment systems.1.2.8.1 Turbine Generator The turbine is an 1,800-rpm tandem-compound, six-flow, single-stage reheat unit with an electrohydraulic governor control.The turbine generator has an emergency trip system for turbine overspeed.
BoththenewfuelstoragevaultandstorageracksaredesignedtocomplywithCategoryIrequirements.
The output of the turbine generator Amendment 21 1.2-24 September 1985 Nine Mile Point Unit 2 FSAR is 1,165, 663 kWe at turbine guarantee conditions with 2.0 in Hg abs backpressure and 0 percent makeup.The generator is a direct driven, three-phase, 60-Hzt 25)000 Vf 1,800-rpm hydrogen inner-cooled, synchronous generator rated at 1,348,400 kVA at 0.90 power factor, 0.58 short-circuit ratio at maximum hydrogen pressure of 75 psig.1.2.8.2 Main Steam System The main steam system delivers steam from the nuclear boiler system through four 26-/28-in OD steam lines to the turbine generator, turbine bypass valves, steam jet air ejectors, off-gas preheaters, steam seal evaporator, and radwaste steam reboiler.1.2.8.3 Main Condenser The main condenser maintains 2.0 in Hg abs when operating at turbine guarantee conditions with 67.97 F circulating water inlet temperature.
Thenewfuelstoragevaultisdesignedwithsufficient drainagetoprecludeflooding.
The condenser includes provisions for accepting steam bypassed around the turbine generator.
Thevaultisalsoequippedwithamonitoring systemtowarnofradiation levelincreases abovenormaloperating conditions.
Deaeration of condensate is accomplished in the condenser.
tThedesignofthenewfuelstoragerackslimitskeff50.90inthedrycondition andkeff60.95inafloodedcondition.
1.2.8.4 Main Condenser Air Removal System The main condenser air removal system, using air ejectors for normal operation and vacuum hogging pumps for startup, evacuates gases from the main turbine and condenser during plant startup and maintains the condenser essentially free of gases during operation.
1.2.7.2SpentFuelStorageThespentfuelstorageracksaredesignedtomaintainspentfuelinaspacegeometrythatpreventscriticality innormalandabnormalconditions.
This system handles all inleakage of noncondensable gases through the turbine seals, condensate, feedwater, and steam systems, and noncondensables that are generated in the reactor by disassociation of water.1.2.8.5 Turbine Gland Sealing System The turbine gland sealing system provides mildly radioactive steam to the seals of the turbine throttle valve stem glands and the turbine shaft glands.The sealing steam is supplied by a clean steam reboiler using condensate.
Theracksarecapableofwithstanding maximumupliftforcesgenerated withouteffectonthesubcritical array.Thedesignofthespentfuelrackswilllimitkeff50.95innormalandabnormalstorageconditions.
The unit auxiliary boiler provides an auxiliary steam supply for startup and when reactor heating steam is not available.
Thereissufficient shielding, acoolingsystem,andradiation monitoring topreventoverheating andexcessive personnel exposure.
The steam packing exhauster collects and condenses the air and steam mixture and discharges the air and other noncondensables to the plant exhaust duct to the atmosphere, using a motor-driven exhauster.
Thespentfuelstoragepoolandracksarecorrosion resistant, andadheretoCategoryIrequirements.
USAR Revision 3 1.2-25 October 1991 Nine Mile Point Unit 2 FSAR 1.2.8.6 Steam Bypass System and Pressure Control System A turbine bypass system is provided which passes steam directly to the main condenser under control of the pressure regulator.
1.2-23 NineMilePointUnit2FSAR1.2.7.3FuelHandlingSystemThefuelhandlingequipment includesthefollowing:
Steam is bypassed to the condenser whenever the reactor steaming rate exceeds the load passed to the turbine generator.
1.Fuelinspection stand.2~Fuelpreparation machine.3.125-toncrane.4.Refueling platform.
The capacity of the turbine bypass system is 25 percent of the turbine rated steam flow.The pressure regulation system provides main turbine control valve and bypass valve flow demands to maintain a nearly constant reactor pressure during normal plant operation.
5~Generalpurposegrapple.6;Jibcranes.7.Otherrelatedtoolsforfuelandreactorservicing.
It also provides demands to the recirculation system to adjust power levels by changing reactor recirculation flow rates.l.2.8.7 Circulating Water System The circulating water system provides the condenser with a continuous supply of cooling water.The circulating water system is a pumped closed loop system utilizing an air-cooled natural-draft cooling tower as a heat sink.Six one-sixth capacity circulating water pumps are provided to pump cooling water from the cooling tower basin through the main condenser and back to the top of the cooling tower.Makeup water is provided from?ake Ontario by the service water system.1.2.8.8 Condensate and Feedwater Systems The condensate and feedwater systems supply condensate from the condenser hotwell to the RPV~The condensate is pumped by two of the three condensate pumps through the full flow condensate demineralizer system, the intercooler of the air ejectors, and the steam packing exhauster to the condensate booster pumps.The condensate booster pumps pump the flow through three strings consisting of two drain coolers and five stages of low pressure heaters each.In addition, three heater drain pumps provide approximately one-third of the feedwater flow requirements.
Allequipment conformstoapplicable codesandstandards.
The last low pressure heaters discharge to the suction of three parallel motor-driven reactor feedwater pumps.The discharge of the reactor feedwater pumps passes through three one-third capacity parallel heaters and into the RPV.The feedwater flow is controlled by varying the feedwater flow control valve position.1.2.8.9 Condensate Demineralizer System A full flow, deep bed condensate demineralizer system complete with regeneration facilities, instrumentation, and 1.2-26 Nine Mile Point Unit 2 FSAR semiautomatic controls is designed to ensure a constant supply of high quality water to the reactor.1.2.9 Nuclear Safety Systems and Engineered Safety Features Chapters 3, 4, 5, 6,=7, 9, and 10 give further details for)ie the following equipment and systems.1.2.9.1 Reactor Protection System The reactor protection system (RPS)initiates a rapid, automatic shutdown (scram)of the reactor.It acts in time to prevent fuel cladding damage and any nuclear system process barrier damage following abnormal operational transients.
1.2.7.4SpentFuelPoolCoolingandCleanupSystemThespentfuelcoolingandcleanup(SFC)systemprovidesremovalofdecayheatfromthestoredspentfuelandmaintains specified watertemperature, purity,clarity,andlevel.Thisprocesspreventsthespentfuelfromoverheating
The RPS overrides all operator actions and process controls and is based on a fail-safe design philosophy that allows appropriate protective action even if a single failure occurs.1 1.2.9.2 Neutron Monitoring System The neut"on monitoring system is a system of incore neutron detectors and oat-of-core electronic monitoring equipment.
'ndthebuildupofexcessive radioactive materials inthecoolingwater,therebyminimizing radiation levels.Thesystemincludes.
The system provides indication of neutron flux, which can be correlated to thermal-power level for the entire range of flu".conditions that can exist in the core.The SRMs and tne IRMs provide flux lev'el'indications during reactor ste.tup and low power operation.
twoheatexchangers, eachofwhichiscapableofremovingthefulldecayheatfromanormalrefueling offloadofspentfuelsAcrossconnection totheRHRsystemprovidesadditional emergency backupcoolingandcoolingduringafullcoreoffload.Chapter'givesfurtherdetailsofthefuelhandlingandstoragesystem.1.2.8PowerConversion SystemChapter10providesadetaileddiscussion ofthefollowing equipment systems.1.2.8.1TurbineGenerator Theturbineisan1,800-rpm tandem-compound, six-flow, single-stage reheatunitwithanelectrohydraulic governorcontrol.Theturbinegenerator hasanemergency tripsystemforturbineoverspeed.
The LPRMs and~'iPRMs allow assessment of local and overall flux conditions during power range operation.
Theoutputoftheturbinegenerator Amendment 211.2-24September 1985 NineMilePointUnit2FSARis1,165,663kWeatturbineguarantee conditions with2.0inHgabsbackpressure and0percentmakeup.Thegenerator isadirectdriven,three-phase, 60-Hzt25)000Vf1,800-rpm hydrogeninner-cooled, synchronous generator ratedat1,348,400 kVAat0.90powerfactor,0.58short-circuit ratioatmaximumhydrogenpressureof75psig.1.2.8.2MainSteamSystemThemainsteamsystemdeliverssteamfromthenuclearboilersystemthroughfour26-/28-in ODsteamlinestotheturbinegenerator, turbinebypassvalves,steamjetairejectors, off-gaspreheaters, steamsealevaporator, andradwastesteamreboiler.
The TIP system provides=a means to calibrate the individual LPRM sensors.The NMS provides inputs to the RMCS to initiate rod blocks if preset flux limits are exceeded, and inputs to the RPS to initiate a scram if other limits are exceeded.1.2.9'Control Rod Drive System When a scram is initiated by the RPS, the CRD system inserts negative reactivity necessary to shut down the reactor.Each control rod is individually controlled by'a hydraulic control unit (HCU).When a scram signal is received, high pressu're water stored in an accumulator in the HCU or reactor pressure forces the control"rod into the core.1.2.9.4 Control Rod Drive Housing Supports CRD housing supports are located underneath the reactor vessel near the control rod housings.The supports limit the travel of'control rod in the event that a control rod housing is ruptured.The supports prevent a nuclear Amendment 18 1.2<<27 March 1985 Nine Mile Point Unit 2 FSAR excursion as a result of a housing failure and thus protect the fuel barrier.1.2.9.5 Control Rod Velocity Limiter A control rod velocity limiter is attached to each control rod to limit the velocity at which a control rod can fall out of the core should it become detached from the CRD.This action limits the rate of reactivity insertion resulting from a rod drop accident.The limiters contain no moving parts.1.2.9'Nuclear System Pressure Relief System A pressure relief syst: em consisting of safety/relief valves (SRV),mounted on the main steam lines is provided to prevent excessive pressure inside the nuclear.system from operational transients or accidents.
1.2.8.3MainCondenser Themaincondenser maintains
The SRV discharge steam is directed to the suppression pool within the primary containment.
 
1.2.9.7 Reactor Core Isolation Cooling System The RCIC system provides makeup water to the RPV when the vessel is isolated.The RCIC system uses a steam-driven turbine-pump unit and automatically operates to maintain adequate water level in the RPV for events defined in Section 5.4.6.1.1.2.9.8 Emergency Core Cooling Systems Four ECCSs are provided to maintain fuel cladding below the temperature.
==2.0 inHgabswhenoperating==
limit in 10CFR50.46 in the event of a breach in the RCPB that results in a loss of reactor coolant.The systems are as follows.Hi h Pressure Core S ra HPCS The HPCS system provides and maintains an adequate coolant inventory inside the RPV to limit fuel cladding temperatures in the event of breaks in the RCPB.The system is initiated by either high pressure in the drywell or low water level in the vessel.It operates independently of all other systems over the entire range of pressure differences from greater than normal operating pressure to zero.The HPCS cooling decreases vessel pressure to enable the low pressure cooling systems to function.The HPCS system pump motor is powered by an onsite diesel generator if.offsite power is not available.
atturbineguarantee conditions with67.97Fcirculating waterinlettemperature.
The system may also be used as a backup for the RCIC system.1.2-28 Nine Mile Point Unit 2 FSAR Automatic De ressurization S stem ADS The ADS rapidly reduces RPV pressure in a LOCA situation in which the HPCS system fails to maintain the RPV water level.The depressurization provided by the system enables the low pressure ECCS to deliver cooling water to the RPV.The ADS uses some of the relief valves that are part of the nuclear system pressure relief system.The automatic relief valves are arranged to open on conditions indicating both that a break in the RCPB has occurred and that the HPCS system is not delivering sufficient cooling water to the RPV to maintain the water level above a preselected value.Set points are discussed in Section 5.2.2.The ADS is not activated unless either the low pressure core spray (LPCS)or low pressure coolant injection (LPCI)pumps are operating.
Thecondenser includesprovisions foraccepting steambypassedaroundtheturbinegenerator.
This is to ensure that adequate coolant is available to maintain reactor water level after the depressurization.
Deaeration ofcondensate isaccomplished inthecondenser.
Low Pressure Core S ra The LPCS system consists of one independent pump and valves and piping to deliver cooling water to a spray sparger over the core.The system is actuated by either low water level in the reactor vessel or high pressure in the drywell, but, water is delivered to the core only after RPV pressure'is reduced.This system provides the capability to cool the fuel by spraying.water into each fuel channel.The LPCS loop functioning in conjunction with the ADS or HPCS can provide sufficient fuel cladding cooling following a LOCA.Low Pressure Coolant In ection LPCI is an operating mode of the RHR system, but is discussed here because the LPCI mode acts as an engineered safety feature in conjunction with the other ECCSs.LPCI uses the pump loops of the RHR to inject cooling water into the RPV.LPCI is actuated by either low water level in the reactor vessel'or high pressure in the drywell, but water is delivered to the core only after RPV pressure is reduced.LPCI operation provides the capability of core reflooding, following a LOCA, in time to maintain the fuel cladding below the prescribed temperature limit.1.2.9.9 Containment Systems Primar Containment The primary containment is a Mark II design that incor-porates a drywell pressure suppression system and utilizes a 1.2-29 Nine Nile Point Unit 2 FSAR large reservoir of water to function as a heat sink to absorb energy.1.Functional Desi n The primary containment is a steel lined reinforced concrete structure.
1.2.8.4MainCondenser AirRemovalSystemThemaincondenser airremovalsystem,usingairejectorsfornormaloperation andvacuumhoggingpumpsforstartup,evacuates gasesfromthemainturbineandcondenser duringplantstartupandmaintains thecondenser essentially freeofgasesduringoperation.
It consists of a conical drywell chamber above a cylindrical suppression pool chamber separated by a drywell floor.This floor contains a piping system which would direct drywell steam into the suppression chamber reservoir in the event of a LOCA.2.Heat Removal The containment heat removal system is summarized in Section 1.2.9.14.3.Containment S ra The containment spray system consists of two redundant subsystems, each with its own full-capacity spray header.Each subsystem is supplied from a separate redundant RHR subsystem.
Thissystemhandlesallinleakage ofnoncondensable gasesthroughtheturbineseals,condensate, feedwater, andsteamsystems,andnoncondensables thataregenerated inthereactorbydisassociation ofwater.1.2.8.5TurbineGlandSealingSystemTheturbineglandsealingsystemprovidesmildlyradioactive steamtothesealsoftheturbinethrottlevalvestemglandsandtheturbineshaftglands.Thesealingsteamissuppliedbyacleansteamreboilerusingcondensate.
4.Combustible Gas Control The containment combusti-ble gas control system is summarized in Section 6.2.5.1.2.9.10 Containment and Reactor Vessel Isolation Control System The primary containment and RPV isolation control system automatically initiates closure of isolation valves to close off all process lines that are potential leakage paths for radioactive material to the environs.This action is taken upon indication of a breach in the RCPB.1.2.9.11 Nain Steam Isolation Valves 28 Although all pipelines that both penetrate the primary containment and offer a potential release path for radioactive material have redundant isolation capabilities, the main steam lines, because of their large size and large mass flow rates, are given special isolation consideration.
Theunitauxiliary boilerprovidesanauxiliary steamsupplyforstartupandwhenreactorheatingsteamisnotavailable.
Automatic isolation valves are provided in each main steam line (MSIVs).Each is closed by spring force and pneumatic force and opened by pneumatic force.These valves fulfill the following objectives:
Thesteampackingexhauster collectsandcondenses theairandsteammixtureanddischarges theairandothernoncondensables totheplantexhaustducttotheatmosphere, usingamotor-driven exhauster.
Prevent excessive damage to the fuel barrier by limiting the loss of reactor coolant from the RPV resulting from either a major leak from the steam piping outside the primary containment or a Amendment, 28 1.2-30 Nay 1987 Nine Mile Point Unit 2 FSAR malfunction of the pressure control system resulting in excessive steam flow from the RPV.2.Limit, the release of radioactive materials by isolating the RCPB in case of a gross release of radioactive materials from the fuel to the reactor cooling water and steam.3.Limit the release of radioactive materials by closing the containment barrier in case of a major leak from the nuclear system inside the containment.
USARRevision31.2-25October1991 NineMilePointUnit2FSAR1.2.8.6SteamBypassSystemandPressureControlSystemAturbinebypasssystemisprovidedwhichpassessteamdirectlytothemaincondenser undercontrolofthepressureregulator.
1.2.9.12 Main Steam Flow Restrictors A venturi-type flow restrictor is installed in each steam line.These devices limit the loss of coolant from the RPV before the MSIVs are closed in case of a main steam line break outside the pr'imary containment.
Steamisbypassedtothecondenser wheneverthereactorsteamingrateexceedstheloadpassedtotheturbinegenerator.
1~2.9.13 Main Steam Radiation Monitoring System The main steam radiation monitoring system consists of four gamma radiation monitors located externally to the main steam lines just.outside the primary containment in the main steam tunnel.The monitors are designed to detect a gross release of fission products from the fuel.On detection of high radiation, the trip signals generated by the monitors are used by the RPS to initiate a reactor scram and to close the MSIVs.1.2.9.14 Residual Heat Removal System The RHR system is placed in operation to limit the temperature of the water in the suppression'ool and of the atmospheres in the drywell and suppression ch'amber following a design basis LOCA, to control the pool temp'erature during normal operation of the SRVs and the RCIC system, and to reduce the pool temperature following an isolation transient.
Thecapacityoftheturbinebypasssystemis25percentoftheturbineratedsteamflow.Thepressureregulation systemprovidesmainturbinecontrolvalveandbypassvalveflowdemandstomaintainanearlyconstantreactorpressureduringnormalplantoperation.
In the containment cooling mode of operation, the RHR main system pumps take suction from the suppression pool and pump the water through the RHR.heat.'e'xchangers Amendment 28 1.2-31 May 1987 Nine Mile Point Unit 2 FSAR where cooling takes place by transferring heat to the service water.The coolant is then discharged back to the suppression pool, the drywell spray header, the suppression chamber spray header, or the RPV.1.2.9.15 Ventilation Exhaust Radiation Monitoring System Permanently installed process and area radiation monitors provide indications and alarms on airborne radiation in the reactor building ventilation system, drywell atmosphere, fuel storage and refueling areas, and control room atmosphere.
Italsoprovidesdemandstotherecirculation systemtoadjustpowerlevelsbychangingreactorrecirculation flowrates.l.2.8.7Circulating WaterSystemThecirculating watersystemprovidesthecondenser withacontinuous supplyofcoolingwater.Thecirculating watersystemisapumpedclosedloopsystemutilizing anair-cooled natural-draft coolingtowerasaheatsink.Sixone-sixth capacitycirculating waterpumpsareprovidedtopumpcoolingwaterfromthecoolingtowerbasinthroughthemaincondenser andbacktothetopofthecoolingtower.Makeupwaterisprovidedfrom?akeOntariobytheservicewatersystem.1.2.8.8Condensate andFeedwater SystemsThecondensate andfeedwater systemssupplycondensate fromthecondenser hotwelltotheRPV~Thecondensate ispumpedbytwoofthethreecondensate pumpsthroughthefullflowcondensate demineralizer system,theintercooler oftheairejectors, andthesteampackingexhauster tothecondensate boosterpumps.Thecondensate boosterpumpspumptheflowthroughthreestringsconsisting oftwodraincoolersandfivestagesoflowpressureheaterseach.Inaddition, threeheaterdrainpumpsprovideapproximately one-third ofthefeedwater flowrequirements.
Additionally, connections are provided in the reactor building ventilation system ductwork for continuous airborne monitors (CAMs).1,.2.9.16 Standby Gas Treatment System The standby gas treatment system (SGTS)processes exhaust.air from various plant systems to limit the release of airborne radioactivity, maintaining offsite dose rates below the specified limits.During a design basis accident the SGTS system is automatically actuated.When high radiation levels are sensed in any exhaust system connected to the SGTS system it is automatically placed in operation.
Thelastlowpressureheatersdischarge tothesuctionofthreeparallelmotor-driven reactorfeedwater pumps.Thedischarge ofthereactorfeedwater pumpspassesthroughthreeone-third capacityparallelheatersandintotheRPV.Thefeedwater flowiscontrolled byvaryingthefeedwater flowcontrolvalveposition.
The SGTS consists of two identical, parallel but physically separated air filter train assemblies.
1.2.8.9Condensate Demineralizer SystemAfullflow,deepbedcondensate demineralizer systemcompletewithregeneration facilities, instrumentation, and1.2-26 NineMilePointUnit2FSARsemiautomatic controlsisdesignedtoensureaconstantsupplyofhighqualitywatertothereactor.1.2.9NuclearSafetySystemsandEngineered SafetyFeaturesChapters3,4,5,6,=7,9,and10givefurtherdetailsfor)iethefollowing equipment andsystems.1.2.9.1ReactorProtection SystemThereactorprotection system(RPS)initiates arapid,automatic shutdown(scram)ofthereactor.Itactsintimetopreventfuelcladdingdamageandanynuclearsystemprocessbarrierdamagefollowing abnormaloperational transients.
Each'ssembly is capable of handling the maximum design air flow rate.1.2'.17 Safety-Related Electrical Power Systems A standby power supply system is provided for the operation of emergency systems and engineered safety features during and following the shutdown of the reactor when the preferred power supply is not available.
TheRPSoverrides alloperatoractionsandprocesscontrolsandisbasedonafail-safe designphilosophy thatallowsappropriate protective actionevenifasinglefailureoccurs.11.2.9.2NeutronMonitoring SystemTheneut"onmonitoring systemisasystemofincoreneutrondetectors andoat-of-core electronic monitoring equipment.
The standby power supply system consists of three standby diesel generators.
Thesystemprovidesindication ofneutronflux,whichcanbecorrelated tothermal-power levelfortheentirerangeofflu".conditions thatcanexistinthecore.TheSRMsandtneIRMsprovidefluxlev'el'indications duringreactorste.tupandlowpoweroperation.
One generator is dedicated to each of the three divisions of the safety-related electric power distribution system feeding each'lass 1E load group.Any two of the three standby diesel generators have sufficient, capacity to start and supply all needed engineered safety features and emergency shutdown loads in case of a LOCA and/or loss of offsite power.The standby diesel generator fuel oil storage tanks are sized to hold a 7-day supply of fuel oil based on the engine running continuously at full load.A LOCA and/or loss of offsite power signal initiates start of the standby diesel generators and the generators pick up the loads in a programmed sequence.Standby diesel generators are independent, and feed separate load groups through separate, physically and electrically isolated distribution systems'.2-32 Nine Mile Point Unit 2 FSAR Failure of any one unit will not jeopardize the capability of the remaining standby'iesel generators to start and run the required shutdown system and engineered safety feature loads.A 125-V emergency dc power system feeds all safety-related dc protection, control and instrumentation loads, and safety-related dc motors under normal operation of the plant as well as during emergency conditions.
TheLPRMsand~'iPRMsallowassessment oflocalandoverallfluxconditions duringpowerrangeoperation.
The system is divided into three redundant divisions each consisting of its own battery, primary and backup battery chargers, switchgears/motor control centers, and distribution panels.Each division feeds dc loads associated with corresponding divisions of the safety-related electric power distribution system.Batteries and battery chargers are redundant and feed separate load groups through separate and isolated distribution systems, and failure of any one unit will not jeopardize the capability of remaining units to feed associated loads.1.2.9'8 Standby Liquid Control System Although not intended to provide prompt reactor shutdown, as the control rods are, the SLCS provides a redundant, independent, and alternate way to bring the nuclear fission reaction to subcriticality and to maintain subcriticality as the reactor cools.The system makes possible an orderly and safe shutdown in the event that not enough control rods can be inserted into the reactor core to accomplish shutdown in th'e normal manner.The system is sized to counteract the positive reactivity effect from rated power to the cold shutdown condition.
TheTIPsystemprovides=ameanstocalibrate theindividual LPRMsensors.TheNMSprovidesinputstotheRMCStoinitiaterodblocksifpresetfluxlimitsareexceeded, andinputstotheRPStoinitiateascramifotherlimitsareexceeded.
1.2.9.19 Safe Shutdown from Outside the Control Room In the event that the control room becomes inaccessible, the reactor can be brought from power range operation to cold shutdown conditions by use of neccessary controls located in the remote shutdown room.1.2.9.20 Main Control Room Heating, Ventilating and Air Conditioning System The main control room HVAC system provides and maintains an environment necessary for the safety and comfort of control room personnel during shutdown of the plant and in the event of a LOCA.1.2.9.21 Redundant Reactivity Control System The redundant reactivity control system (RRCS)determines if there is an existing transient that exceeds certain RPV Amendment 23 1.2-33 December 1985 Nine Mile Point Unit 2 FSAR pressure and wate'r level parameters and immediately activates ATWS prevention equipment.
1.2.9'ControlRodDriveSystemWhenascramisinitiated bytheRPS,theCRDsysteminsertsnegativereactivity necessary toshutdownthereactor.Eachcontrolrodisindividually controlled by'ahydraulic controlunit(HCU).Whenascramsignalisreceived, highpressu're waterstoredinanaccumulator intheHCUorreactorpressureforcesthecontrol"rodintothecore.1.2.9.4ControlRodDriveHousingSupportsCRDhousingsupportsarelocatedunderneath thereactorvesselnearthecontrolrodhousings.
, If the logic has determined, that a controlled shutdown is not occurring, the RRCS activates ATWS mitigation equipment..
Thesupportslimitthetravelof'controlrodintheeventthatacontrolrodhousingisruptured.
Amendment 18 1.2-33a March 1985 Nine Mile Point Unit 2 FSAR THIS PAGE INTENTiONALLY BLANK Amendment 18 1.2-33b March 1985 Nine Mile Point Unit 2 FSAR 1.2.10 Cooling Water and Auxiliary Systems Chapter 9 provides a detailed discussion of these systems.1.2.10.1 Reactor Building Closed Loop Cooling Water System The RBCLCW system is a demineralized water, closed-circuit heat transfer system that consists of three 50-percent capacity pumps and heat exchangers, along with appropriate controls and instrumentation to ensure adequate cooling capacity for reactor plant auxiliary systems and components during normal plant operations'eat removed from components by the RBCLCW system is transferred, to the service water system.1.2.10'Turbine Building Closed Loop Cooling Water System The TBCLCW system is a demineralized water, closed-circuit heat transfer system that consists of three 50-percent capacity pumps and heat exchangers, along with appropriate controls and instrumentation to ensure adequate cooling capacity for the turbine building and radwaste building auxiliary systems and components, during normal plant operation.
ThesupportspreventanuclearAmendment 181.2<<27March1985 NineMilePointUnit2FSARexcursion asaresultofahousingfailureandthusprotectthefuelbarrier.1.2.9.5ControlRodVelocityLimiterAcontrolrodvelocitylimiterisattachedtoeachcontrolrodtolimitthevelocityatwhichacontrolrodcanfalloutofthecoreshoulditbecomedetachedfromtheCRD.Thisactionlimitstherateofreactivity insertion resulting fromaroddropaccident.
Heat removed from components by the TBCLCW water system is transferred to the service water system.1.2.10.3 Service Water System The service water syst: em provides cooling water to various essential and nonessential components throughout the plant.Essential components are serviced by two 100-percent redundant subsystems.
Thelimiterscontainnomovingparts.1.2.9'NuclearSystemPressureReliefSystemApressurereliefsyst:emconsisting ofsafety/relief valves(SRV),mounted onthemainsteamlinesisprovidedtopreventexcessive pressureinsidethenuclear.systemfromoperational transients oraccidents.
T2;e nonessential components will be automatically isolated upon receipt of a LOCA signal coincident with a loss of offsite power.The service water pumps take their suction from Lake Ontario via the screenwell complex and intake tunnels.After passing through'he system, the discharge is returned to the lake and to the circulating water system as makeup.1.2.10.4 Ultimate Heat, Sink The ultimate heat sink is Lake Ontario, which provides water to the intake/discharge tunnels and is available at the screenwell building for plant use.1.2.10.5 Plant Chilled Water System The plant chilled water system consists of two subsystems, one serving the turbine, normal switchgear, and radwaste buildings, and one serving the control building.The 1.2-34 Nine Mile Point Unit 2 FSAR subsystems provide space cooling by distributing chilled water through cooling coils located in air moving units.The control building subsystem is an essential system designed to provide chilled water for cooling during all modes of plant operation.
TheSRVdischarge steamisdirectedtothesuppression poolwithintheprimarycontainment.
Each subsystem contains mechanical refrigeration water chillers, circulation pumps, piping valves, cooling coils, accessories, instrumentation, and controls.1.2.10.6 Heating, Ventilating, and Air Conditioning Systems Individual heating, ventilating, and air conditioning systems are provided throughout the plant to maintain indoor temperature and humidity design conditions as required for optimum performance o f plant equipment and, where applicable, for human comfort.1.2.10.7 Process Sampling The process sampling system consists of the reactor plant, turbine plant, and radwaste sampling subsystems.
1.2.9.7ReactorCoreIsolation CoolingSystemTheRCICsystemprovidesmakeupwatertotheRPVwhenthevesselisisolated.
These subsystems are composed of the necessary piping, valves, coolers, instrumentation, and analyzers to draw and analyze samples of various plant process streams.Representative samples are taken automatically and/or manually for online and laboratory analyses of pH, conductivity, turbidity, oxygen, hydrogen, gaseous activity, fission product activity, dissolved gas concentration, and various metallic concentrations (such as copper, iron, and silica).'1.2.10.8 Condensate Makeup and Drawoff System The condensate makeup and drawoff system consists of two storage tanks, piping, and instrumentation.
TheRCICsystemusesasteam-driven turbine-pump unitandautomatically operatestomaintainadequatewaterlevelintheRPVforeventsdefinedinSection5.4.6.1.1.2.9.8Emergency CoreCoolingSystemsFourECCSsareprovidedtomaintainfuelcladdingbelowthetemperature.
It receives drawoff water from and supplies makeup water to the main condenser and fuel pool, and provides makeup of reactor coolant inventory for the RCIC and HPCS systems.Water in the condensate storage tanks is replenished from the makeup water treatment system.1.2.10.9 Water Treatment and Makeup Water Systems The water treatment system is composed of a water filter, an activated carbon filter, an'acid exchanger unit, a'orced-draft degasifier, a base anion exchanger, and a mixed-bed ion exchange demineralizer.
limitin10CFR50.46 intheeventofabreachintheRCPBthatresultsinalossofreactorcoolant.Thesystemsareasfollows.HihPressureCoreSraHPCSTheHPCSsystemprovidesandmaintains anadequatecoolantinventory insidetheRPVtolimitfuelcladdingtemperatures intheeventofbreaksintheRCPB.Thesystemisinitiated byeitherhighpressureinthedrywellorlowwaterlevelinthevessel.Itoperatesindependently ofallothersystemsovertheentirerangeofpressuredifferences fromgreaterthannormaloperating pressuretozero.TheHPCScoolingdecreases vesselpressuretoenablethelowpressurecoolingsystemstofunction.
The system'purifies lake water supplied from the service water system and delivers it to the demineralized water storage tanks.1.2-35 Nine Mile Point Unit 2 FSAR The makeup water system provides demineralized makeup water from the storage tanks for the power conversion system and the TBCLCW and RBCLCW systems.In addition, the makeup water system satisfies various miscellaneous plant requirements for demineralized water, including the suppression pool and the spent fuel pool.1.2'0.10 Domestic Water and Sanitary Drains and Disposal Systems Domestic Water S stem Domestic water for drinking and to satisfy the flow and pressure requirements of all installed plumbing fixtures is supplied from an existing city main.Water quality is in accordance with applicable standards promulgated by the State of New York.Sanitar Drains and Dis osal S stem Raw sanitary waste from Unit 2 is directed to the Nine Mile Point Unit 1 sanitary waste treatment plant.This plant conforms to all applicable local, state, and federal discharge limitations.
TheHPCSsystempumpmotorispoweredbyanonsitedieselgenerator if.offsitepowerisnotavailable.
1.2.10.11 Compressed Air Systems The compressed air systems are composed of a service and instrument air system and a breathing air system.Service and Instrument Air S stem Three air compressors, each discharging through an aftercooler, a filter, and an air receiver into a common header, supply all the service and instrument.
ThesystemmayalsobeusedasabackupfortheRCICsystem.1.2-28 NineMilePointUnit2FSARAutomatic Deressurization SstemADSTheADSrapidlyreducesRPVpressureinaLOCAsituation inwhichtheHPCSsystemfailstomaintaintheRPVwaterlevel.Thedepressurization providedbythesystemenablesthelowpressureECCStodelivercoolingwatertotheRPV.TheADSusessomeofthereliefvalvesthatarepartofthenuclearsystempressurereliefsystem.Theautomatic reliefvalvesarearrangedtoopenonconditions indicating boththatabreakintheRCPBhasoccurredandthattheHPCSsystemisnotdelivering sufficient coolingwatertotheRPVtomaintainthewaterlevelaboveapreselected value.Setpointsarediscussed inSection5.2.2.TheADSisnotactivated unlesseitherthelowpressurecorespray(LPCS)orlowpressurecoolantinjection (LPCI)pumpsareoperating.
air required by the plant.The service air is taken directly from the common header.The instrument air is passed through one of two 100-percent capacity air dryers and then through one of two 100-percent capacity air filters before delivery to the various plant instruments.
Thisistoensurethatadequatecoolantisavailable tomaintainreactorwaterlevelafterthedepressurization.
Breathin Air S stem A single air compressor discharges through an aftercooler to a receiver.Air from this receiver is filtered to comply with OSHA requirements for breathing air.1.2-36 Nine Nile Point Unit 2 FSAR 1.2.10.12 Auxiliary Steam System An auxiliary steam system furnishes a separate and independent steam supply.Process steam.is generated in high voltage, electrode boilers and distribut d throughout the plant by an auxiliary steam header.Auxiliary steam is required for main turbine shaft sealing steam during startup and for the radwaste building during plant shutdown.1.2.10.13 Standby Diesel Generator Fuel Oil Storage and Transfer System The standby diesel generator fuel oil storage and transfer system supplies fuel oil for operation of the standby diesel generators.
LowPressureCoreSraTheLPCSsystemconsistsofoneindependent pumpandvalvesandpipingtodelivercoolingwatertoasprayspargeroverthecore.Thesystemisactuatedbyeitherlowwaterlevelinthereactorvesselorhighpressureinthedrywell,but,waterisdelivered tothecoreonlyafterRPVpressure'isreduced.Thissystemprovidesthecapability tocoolthefuelbyspraying.
This system is an essential system and is capable of supplying fuel oil during all modes of plant operation, including loss of offsite power coincident with a LOCA.1.2..10.14 Fire Protection System The fire protection system consists of fire hydrants, hose stations, and automatic sprinkler and deluge systems.Where required, automatic or manually actuated carbon dioxide, foam, or Halon fire suppression systems are provided.Automatic fire detectors are provided in selected areas.Portable fire extinguishers and fire hose reels are located throughout the plant.1.2.10.15 Communication Systems The station communication systems are designed to provide reliable communication between all essential areas of the station and to locations remote from the station during normal and emergency conditions and under maximum potential noise levels.This is achieved through five different communication systems as follows: 1.A dial telephone system for voice communication between selected-office areas and selected locations inside and outside the station.The dial telephone system is connected to the telephone tie system for offsite communication including communication with local law enforcement authorities and the local fire department.
waterintoeachfuelchannel.TheLPCSloopfunctioning inconjunction withtheADSorHPCScanprovidesufficient fuelcladdingcoolingfollowing aLOCA.LowPressureCoolantInectionLPCIisanoperating modeoftheRHRsystem,butisdiscussed herebecausetheLPCImodeactsasanengineered safetyfeatureinconjunction withtheotherECCSs.LPCIusesthepumploopsoftheRHRtoinjectcoolingwaterintotheRPV.LPCIisactuatedbyeitherlowwaterlevelinthereactorvessel'or highpressureinthedrywell,butwaterisdelivered tothecoreonlyafterRPVpressureisreduced.LPCIoperation providesthecapability ofcorereflooding, following aLOCA,intimetomaintainthefuelcladdingbelowtheprescribed temperature limit.1.2.9.9Containment SystemsPrimarContainment Theprimarycontainment isaMarkIIdesignthatincor-poratesadrywellpressuresuppression systemandutilizesa1.2-29 NineNilePointUnit2FSARlargereservoir ofwatertofunctionasaheatsinktoabsorbenergy.1.Functional DesinTheprimarycontainment isasteellinedreinforced concretestructure.
2.A portable radio communication system for communication between station personnel and NNPC personnel located outside the station in case the dial telephone system between the station and the 1.2-37 Nine Mile Point Unit 2 FSAR points outside the station becomes inoperable.
Itconsistsofaconicaldrywellchamberaboveacylindrical suppression poolchamberseparated byadrywellfloor.Thisfloorcontainsapipingsystemwhichwoulddirectdrywellsteamintothesuppression chamberreservoir intheeventofaLOCA.2.HeatRemovalThecontainment heatremovalsystemissummarized inSection1.2.9.14.
The radios are powered by rechargeable batteries and are independent of any electrical system of the plant.3.A page party/public address (PP/PA)communication system with five party channels and one page channel for communication between all buildings and locations within the plant, even under extremely noisy conditions.
3.Containment SraThecontainment spraysystemconsistsoftworedundant subsystems, eachwithitsownfull-capacity sprayheader.Eachsubsystem issuppliedfromaseparateredundant RHRsubsystem.
This is also-used for the emergency alarm and evacuation system and is powered from an uninterruptible power supply (UPS).A separate.maintenance and calibration communication (M/CC)system for use in areas requiring communication for testing, instrument calibration, maintenance, and for use during construction and startup.5.One of the channels of the M/CC system is capable of being operated as a sound-powered communication (SPC)system.This system can be used in case of a total loss of electric power to the PP/PA and M/CC systems.This system requires no plant electric power and works through M/CC system wiring.The design of the communication systems permits routine surveillance and testing without disrupting normal communication facilities.
4.Combustible GasControlThecontainment combusti-blegascontrolsystemissummarized inSection6.2.5.1.2.9.10Containment andReactorVesselIsolation ControlSystemTheprimarycontainment andRPVisolation controlsystemautomatically initiates closureofisolation valvestocloseoffallprocesslinesthatarepotential leakagepathsforradioactive materialtotheenvirons.
The paging system is electrically
Thisactionistakenuponindication ofabreachintheRCPB.1.2.9.11NainSteamIsolation Valves28Althoughallpipelines thatbothpenetrate theprimarycontainment andofferapotential releasepathforradioactive materialhaveredundant isolation capabilities, themainsteamlines,becauseoftheirlargesizeandlargemassflowrates,aregivenspecialisolation consideration.
.supervised, permitting immediate corrective action to be taken if the line becomes inoperative.
Automatic isolation valvesareprovidedineachmainsteamline(MSIVs).Eachisclosedbyspringforceandpneumatic forceandopenedbypneumatic force.Thesevalvesfulfillthefollowing objectives:
1.2.10.16 Tighting Systems The station lighting systems are designed to-provide adequate lighting in all necessary areas of the station during both emergency and normal operating conditions.
Preventexcessive damagetothefuelbarrierbylimitingthelossofreactorcoolantfromtheRPVresulting fromeitheramajorleakfromthesteampipingoutsidetheprimarycontainment oraAmendment, 281.2-30Nay1987 NineMilePointUnit2FSARmalfunction ofthepressurecontrolsystemresulting inexcessive steamflowfromtheRPV.2.Limit,thereleaseofradioactive materials byisolating theRCPBincaseofagrossreleaseofradioactive materials fromthefueltothereactorcoolingwaterandsteam.3.Limitthereleaseofradioactive materials byclosingthecontainment barrierincaseofamajorleakfromthenuclearsysteminsidethecontainment.
This is achieved through the following lighting subsystems:
1.2.9.12MainSteamFlowRestrictors Aventuri-type flowrestrictor isinstalled ineachsteamline.ThesedeviceslimitthelossofcoolantfromtheRPVbeforetheMSIVsareclosedincaseofamainsteamlinebreakoutsidethepr'imarycontainment.
1.Normal station lighting system.2~Emergency lighting system.3.Essential lighting system.4.Egress lighting system.The normal station lighting system provides adequate lighting in all areas of the station under normal operating conditions.
1~2.9.13MainSteamRadiation Monitoring SystemThemainsteamradiation monitoring systemconsistsoffourgammaradiation monitorslocatedexternally tothemainsteamlinesjust.outsidetheprimarycontainment inthemainsteamtunnel.Themonitorsaredesignedtodetectagrossreleaseoffissionproductsfromthefuel.Ondetection ofhighradiation, thetripsignalsgenerated bythemonitorsareusedbytheRPStoinitiateareactorscramandtoclosetheMSIVs.1.2.9.14ResidualHeatRemovalSystemTheRHRsystemisplacedinoperation tolimitthetemperature ofthewaterinthesuppression'ool andoftheatmospheres inthedrywellandsuppression ch'amberfollowing adesignbasisLOCA,tocontrolthepooltemp'erature duringnormaloperation oftheSRVsandtheRCICsystem,andtoreducethepooltemperature following anisolation transient.
This is fed from the station normal 600-V load 1.2-38 Nine Mile Point Unit 2 FSAR centers through the main lighting dry-type distribution transformers, panels.distribution panels, and subdistribution The emergency lighting system provides adequate lighting required for operating the safety-related equipment during emergency conditions in the control room, diesel generator rooms, emergency'switchgear areas, and relay and computer room.This is treated as a Class 1E system except for the lighting fixtures.The lighting fixtures are seismically supported.
Inthecontainment coolingmodeofoperation, theRHRmainsystempumpstakesuctionfromthesuppression poolandpumpthewaterthroughtheRHR.heat.'e'xchangers Amendment 281.2-31May1987 NineMilePointUnit2FSARwherecoolingtakesplacebytransferring heattotheservicewater.Thecoolantisthendischarged backtothesuppression pool,thedrywellsprayheader,thesuppression chambersprayheader,ortheRPV.1.2.9.15Ventilation ExhaustRadiation Monitoring SystemPermanently installed processandarearadiation monitorsprovideindications andalarmsonairborneradiation inthereactorbuildingventilation system,drywellatmosphere, fuelstorageandrefueling areas,andcontrolroomatmosphere.
The emergency lighting system is divided into'three separate divisions corresponding to Divisions I, II, and III of the plant emergency ac distribution system and is fed from the corresponding Class 1E load centers/motor control centers through the main lighting distribution panels,.dry-type distribution transformers, and subdistribution panels.In case of a loss of offsite power, the emergency lighting system is fed from the standby diesel generators through manually operated circuit breakers.The emergency lighting system fixtures are constantly energized.
Additionally, connections areprovidedinthereactorbuildingventilation systemductworkforcontinuous airbornemonitors(CAMs).1,.2.9.16StandbyGasTreatment SystemThestandbygastreatment system(SGTS)processes exhaust.airfromvariousplantsystemstolimitthereleaseofairborneradioactivity, maintaining offsitedoseratesbelowthespecified limits.DuringadesignbasisaccidenttheSGTSsystemisautomatically actuated.
The essential lighting system provides partial lighting for certain cri'tical areas of the station requiring continuous lighting such as the control room, relay and computer room, standby diesel generator rooms, and emergency switchgear rooms'he essential lighting system receives power from the station normal UPS system and is fed through dry-type distribution transformers and subdistribution panels.The essential lighting fixtures powered by the UPS system are constantly energized.
Whenhighradiation levelsaresensedinanyexhaustsystemconnected totheSGTSsystemitisautomatically placedinoperation.
The egress lighting system provides adequate lighting for all egress signs inside the plant.This is designed as a separate system specifically for the inside building egress emergency conditions in accordance with OSHA requirements.
TheSGTSconsistsoftwoidentical, parallelbutphysically separated airfiltertrainassemblies.
The egress lighting system receives power from the station normal UPS system as part of the essential lighting distribution system.The egress lighting fixtures are constantly energized.
Each'ssemblyiscapableofhandlingthemaximumdesignairflowrate.1.2'.17Safety-Related Electrical PowerSystemsAstandbypowersupplysystemisprovidedfortheoperation ofemergency systemsandengineered safetyfeaturesduringandfollowing theshutdownofthereactorwhenthepreferred powersupplyisnotavailable.
The 8-hr battery pack lighting provides illumination in all areas required for operation of any safe shutdown equipment and in access and egress routes thereto in case of a fire.23 Fluorescent, incandescent, and high pressure sodium lamps are used for station lighting.Fluorescent lamps are used for all offices and for most of the operating areas such as the control room, relay and computer room, and emergency and normal switchgear rooms.Incandescent lamps are used in the primary containment, primary containment access hatches, main steam tunnel, new fuel storage vault, spent fuel pool filter room, and in all other areas where lighting is infrequently required.High pressure sodium lamps are used Amendment 23 1.2-39 December 198S Nine Mile Point.Unit 2 FSAR for all high bay lighting such as in the turbine building and reactor building general areas.1.2-40 Nine Mile Point Unit 2 FSAR 1.2.ll References Niagara Mohawk Power Corporation.
Thestandbypowersupplysystemconsistsofthreestandbydieselgenerators.
Preliminary Safety Analysis Report, Volume I, Nine Mile Point Nuclear Station-Unit 2, June 1972.2.3.Niagara Mohawk Power Corporation.(Construction Permit Stage), Nine Station-Unit 2, June 1972.I Oswego County Planning Board.Plan, August 1976.Environmental Report Mile Point Nuclear Preliminary Land Use Gulf 6 Western Topical Report.GGW-FSD 2538, Nuclear Main Steam Isolation Valve Systems, January 1979.5.General Electric Licensing Topical Report.General Electric Standard Application for Reactor Fuel.NEDE-24011-P-A (latest approved revision)~6~General Electric Licensing Topical Report.General Electric Standard Application for Reactor Fuel (U.ST Supplement), NEDE-24011-P-A-US (latest approved r'evision).
Onegenerator isdedicated toeachofthethreedivisions ofthesafety-related electricpowerdistribution systemfeedingeach'lass 1Eloadgroup.Anytwoofthethreestandbydieselgenerators havesufficient, capacitytostartandsupplyallneededengineered safetyfeaturesandemergency shutdownloadsincaseofaLOCAand/orlossofoffsitepower.Thestandbydieselgenerator fueloilstoragetanksaresizedtoholda7-daysupplyoffueloilbasedontheenginerunningcontinuously atfullload.ALOCAand/orlossofoffsitepowersignalinitiates startofthestandbydieselgenerators andthegenerators pickuptheloadsinaprogrammed sequence.
Amendment 21 1.2-41 September 1985}}
Standbydieselgenerators areindependent, andfeedseparateloadgroupsthroughseparate, physically andelectrically isolateddistribution systems'.2-32 NineMilePointUnit2FSARFailureofanyoneunitwillnotjeopardize thecapability oftheremaining standby'iesel generators tostartandruntherequiredshutdownsystemandengineered safetyfeatureloads.A125-Vemergency dcpowersystemfeedsallsafety-related dcprotection, controlandinstrumentation loads,andsafety-related dcmotorsundernormaloperation oftheplantaswellasduringemergency conditions.
Thesystemisdividedintothreeredundant divisions eachconsisting ofitsownbattery,primaryandbackupbatterychargers, switchgears/motor controlcenters,anddistribution panels.Eachdivisionfeedsdcloadsassociated withcorresponding divisions ofthesafety-related electricpowerdistribution system.Batteries andbatterychargersareredundant andfeedseparateloadgroupsthroughseparateandisolateddistribution systems,andfailureofanyoneunitwillnotjeopardize thecapability ofremaining unitstofeedassociated loads.1.2.9'8StandbyLiquidControlSystemAlthoughnotintendedtoprovidepromptreactorshutdown, asthecontrolrodsare,theSLCSprovidesaredundant, independent, andalternate waytobringthenuclearfissionreactiontosubcriticality andtomaintainsubcriticality asthereactorcools.Thesystemmakespossibleanorderlyandsafeshutdownintheeventthatnotenoughcontrolrodscanbeinsertedintothereactorcoretoaccomplish shutdowninth'enormalmanner.Thesystemissizedtocounteract thepositivereactivity effectfromratedpowertothecoldshutdowncondition.
1.2.9.19SafeShutdownfromOutsidetheControlRoomIntheeventthatthecontrolroombecomesinaccessible, thereactorcanbebroughtfrompowerrangeoperation tocoldshutdownconditions byuseofneccessary controlslocatedintheremoteshutdownroom.1.2.9.20MainControlRoomHeating,Ventilating andAirConditioning SystemThemaincontrolroomHVACsystemprovidesandmaintains anenvironment necessary forthesafetyandcomfortofcontrolroompersonnel duringshutdownoftheplantandintheeventofaLOCA.1.2.9.21Redundant Reactivity ControlSystemTheredundant reactivity controlsystem(RRCS)determines ifthereisanexistingtransient thatexceedscertainRPVAmendment 231.2-33December1985 NineMilePointUnit2FSARpressureandwate'rlevelparameters andimmediately activates ATWSprevention equipment.
,Ifthelogichasdetermined, thatacontrolled shutdownisnotoccurring, theRRCSactivates ATWSmitigation equipment..
Amendment 181.2-33aMarch1985 NineMilePointUnit2FSARTHISPAGEINTENTiONALLY BLANKAmendment 181.2-33bMarch1985 NineMilePointUnit2FSAR1.2.10CoolingWaterandAuxiliary SystemsChapter9providesadetaileddiscussion ofthesesystems.1.2.10.1ReactorBuildingClosedLoopCoolingWaterSystemTheRBCLCWsystemisademineralized water,closed-circuit heattransfersystemthatconsistsofthree50-percent capacitypumpsandheatexchangers, alongwithappropriate controlsandinstrumentation toensureadequatecoolingcapacityforreactorplantauxiliary systemsandcomponents duringnormalplantoperations'eat removedfromcomponents bytheRBCLCWsystemistransferred, totheservicewatersystem.1.2.10'TurbineBuildingClosedLoopCoolingWaterSystemTheTBCLCWsystemisademineralized water,closed-circuit heattransfersystemthatconsistsofthree50-percent capacitypumpsandheatexchangers, alongwithappropriate controlsandinstrumentation toensureadequatecoolingcapacityfortheturbinebuildingandradwastebuildingauxiliary systemsandcomponents, duringnormalplantoperation.
Heatremovedfromcomponents bytheTBCLCWwatersystemistransferred totheservicewatersystem.1.2.10.3ServiceWaterSystemTheservicewatersyst:emprovidescoolingwatertovariousessential andnonessential components throughout theplant.Essential components areservicedbytwo100-percent redundant subsystems.
T2;enonessential components willbeautomatically isolateduponreceiptofaLOCAsignalcoincident withalossofoffsitepower.TheservicewaterpumpstaketheirsuctionfromLakeOntarioviathescreenwell complexandintaketunnels.Afterpassingthrough'hesystem,thedischarge isreturnedtothelakeandtothecirculating watersystemasmakeup.1.2.10.4UltimateHeat,SinkTheultimateheatsinkisLakeOntario,whichprovideswatertotheintake/discharge tunnelsandisavailable atthescreenwell buildingforplantuse.1.2.10.5PlantChilledWaterSystemTheplantchilledwatersystemconsistsoftwosubsystems, oneservingtheturbine,normalswitchgear, andradwastebuildings, andoneservingthecontrolbuilding.
The1.2-34 NineMilePointUnit2FSARsubsystems providespacecoolingbydistributing chilledwaterthroughcoolingcoilslocatedinairmovingunits.Thecontrolbuildingsubsystem isanessential systemdesignedtoprovidechilledwaterforcoolingduringallmodesofplantoperation.
Eachsubsystem containsmechanical refrigeration waterchillers, circulation pumps,pipingvalves,coolingcoils,accessories, instrumentation, andcontrols.
1.2.10.6Heating,Ventilating, andAirConditioning SystemsIndividual heating,ventilating, andairconditioning systemsareprovidedthroughout theplanttomaintainindoortemperature andhumiditydesignconditions asrequiredforoptimumperformance ofplantequipment and,whereapplicable, forhumancomfort.1.2.10.7ProcessSamplingTheprocesssamplingsystemconsistsofthereactorplant,turbineplant,andradwastesamplingsubsystems.
Thesesubsystems arecomposedofthenecessary piping,valves,coolers,instrumentation, andanalyzers todrawandanalyzesamplesofvariousplantprocessstreams.Representative samplesaretakenautomatically and/ormanuallyforonlineandlaboratory analysesofpH,conductivity, turbidity, oxygen,hydrogen, gaseousactivity, fissionproductactivity, dissolved gasconcentration, andvariousmetallicconcentrations (suchascopper,iron,andsilica).'1.2.10.8 Condensate MakeupandDrawoffSystemThecondensate makeupanddrawoffsystemconsistsoftwostoragetanks,piping,andinstrumentation.
Itreceivesdrawoffwaterfromandsuppliesmakeupwatertothemaincondenser andfuelpool,andprovidesmakeupofreactorcoolantinventory fortheRCICandHPCSsystems.Waterinthecondensate storagetanksisreplenished fromthemakeupwatertreatment system.1.2.10.9WaterTreatment andMakeupWaterSystemsThewatertreatment systemiscomposedofawaterfilter,anactivated carbonfilter,an'acidexchanger unit,a'orced-draftdegasifier, abaseanionexchanger, andamixed-bed ionexchangedemineralizer.
Thesystem'purifies lakewatersuppliedfromtheservicewatersystemanddeliversittothedemineralized waterstoragetanks.1.2-35 NineMilePointUnit2FSARThemakeupwatersystemprovidesdemineralized makeupwaterfromthestoragetanksforthepowerconversion systemandtheTBCLCWandRBCLCWsystems.Inaddition, themakeupwatersystemsatisfies variousmiscellaneous plantrequirements fordemineralized water,including thesuppression poolandthespentfuelpool.1.2'0.10DomesticWaterandSanitaryDrainsandDisposalSystemsDomesticWaterSstemDomesticwaterfordrinkingandtosatisfytheflowandpressurerequirements ofallinstalled plumbingfixturesissuppliedfromanexistingcitymain.Waterqualityisinaccordance withapplicable standards promulgated bytheStateofNewYork.SanitarDrainsandDisosalSstemRawsanitarywastefromUnit2isdirectedtotheNineMilePointUnit1sanitarywastetreatment plant.Thisplantconformstoallapplicable local,state,andfederaldischarge limitations.
1.2.10.11Compressed AirSystemsThecompressed airsystemsarecomposedofaserviceandinstrument airsystemandabreathing airsystem.ServiceandInstrument AirSstemThreeaircompressors, eachdischarging throughanaftercooler, afilter,andanairreceiverintoacommonheader,supplyalltheserviceandinstrument.
airrequiredbytheplant.Theserviceairistakendirectlyfromthecommonheader.Theinstrument airispassedthroughoneoftwo100-percent capacityairdryersandthenthroughoneoftwo100-percent capacityairfiltersbeforedeliverytothevariousplantinstruments.
BreathinAirSstemAsingleaircompressor discharges throughanaftercooler toareceiver.
AirfromthisreceiverisfilteredtocomplywithOSHArequirements forbreathing air.1.2-36 NineNilePointUnit2FSAR1.2.10.12Auxiliary SteamSystemAnauxiliary steamsystemfurnishes aseparateandindependent steamsupply.Processsteam.isgenerated inhighvoltage,electrode boilersanddistribut dthroughout theplantbyanauxiliary steamheader.Auxiliary steamisrequiredformainturbineshaftsealingsteamduringstartupandfortheradwastebuildingduringplantshutdown.
1.2.10.13 StandbyDieselGenerator FuelOilStorageandTransferSystemThestandbydieselgenerator fueloilstorageandtransfersystemsuppliesfueloilforoperation ofthestandbydieselgenerators.
Thissystemisanessential systemandiscapableofsupplying fueloilduringallmodesofplantoperation, including lossofoffsitepowercoincident withaLOCA.1.2..10.14 FireProtection SystemThefireprotection systemconsistsoffirehydrants, hosestations, andautomatic sprinkler anddelugesystems.Whererequired, automatic ormanuallyactuatedcarbondioxide,foam,orHalonfiresuppression systemsareprovided.
Automatic firedetectors areprovidedinselectedareas.Portablefireextinguishers andfirehosereelsarelocatedthroughout theplant.1.2.10.15Communication SystemsThestationcommunication systemsaredesignedtoprovidereliablecommunication betweenallessential areasofthestationandtolocations remotefromthestationduringnormalandemergency conditions andundermaximumpotential noiselevels.Thisisachievedthroughfivedifferent communication systemsasfollows:1.Adialtelephone systemforvoicecommunication betweenselected-officeareasandselectedlocations insideandoutsidethestation.Thedialtelephone systemisconnected tothetelephone tiesystemforoffsitecommunication including communication withlocallawenforcement authorities andthelocalfiredepartment.
2.Aportableradiocommunication systemforcommunication betweenstationpersonnel andNNPCpersonnel locatedoutsidethestationincasethedialtelephone systembetweenthestationandthe1.2-37 NineMilePointUnit2FSARpointsoutsidethestationbecomesinoperable.
Theradiosarepoweredbyrechargeable batteries andareindependent ofanyelectrical systemoftheplant.3.Apageparty/public address(PP/PA)communication systemwithfivepartychannelsandonepagechannelforcommunication betweenallbuildings andlocations withintheplant,evenunderextremely noisyconditions.
Thisisalso-usedfortheemergency alarmandevacuation systemandispoweredfromanuninterruptible powersupply(UPS).Aseparate.maintenance andcalibration communication (M/CC)systemforuseinareasrequiring communication fortesting,instrument calibration, maintenance, andforuseduringconstruction andstartup.5.OneofthechannelsoftheM/CCsystemiscapableofbeingoperatedasasound-powered communication (SPC)system.ThissystemcanbeusedincaseofatotallossofelectricpowertothePP/PAandM/CCsystems.ThissystemrequiresnoplantelectricpowerandworksthroughM/CCsystemwiring.Thedesignofthecommunication systemspermitsroutinesurveillance andtestingwithoutdisrupting normalcommunication facilities.
Thepagingsystemiselectrically
.supervised, permitting immediate corrective actiontobetakenifthelinebecomesinoperative.
1.2.10.16 TightingSystemsThestationlightingsystemsaredesignedto-provideadequatelightinginallnecessary areasofthestationduringbothemergency andnormaloperating conditions.
Thisisachievedthroughthefollowing lightingsubsystems:
1.Normalstationlightingsystem.2~Emergency lightingsystem.3.Essential lightingsystem.4.Egresslightingsystem.Thenormalstationlightingsystemprovidesadequatelightinginallareasofthestationundernormaloperating conditions.
Thisisfedfromthestationnormal600-Vload1.2-38 NineMilePointUnit2FSARcentersthroughthemainlightingdry-typedistribution transformers, panels.distribution panels,andsubdistribution Theemergency lightingsystemprovidesadequatelightingrequiredforoperating thesafety-related equipment duringemergency conditions inthecontrolroom,dieselgenerator rooms,emergency'switchgear areas,andrelayandcomputerroom.ThisistreatedasaClass1Esystemexceptforthelightingfixtures.
Thelightingfixturesareseismically supported.
Theemergency lightingsystemisdividedinto'threeseparatedivisions corresponding toDivisions I,II,andIIIoftheplantemergency acdistribution systemandisfedfromthecorresponding Class1Eloadcenters/motor controlcentersthroughthemainlightingdistribution panels,.dry-typedistribution transformers, andsubdistribution panels.Incaseofalossofoffsitepower,theemergency lightingsystemisfedfromthestandbydieselgenerators throughmanuallyoperatedcircuitbreakers.
Theemergency lightingsystemfixturesareconstantly energized.
Theessential lightingsystemprovidespartiallightingforcertaincri'tical areasofthestationrequiring continuous lightingsuchasthecontrolroom,relayandcomputerroom,standbydieselgenerator rooms,andemergency switchgear rooms'heessential lightingsystemreceivespowerfromthestationnormalUPSsystemandisfedthroughdry-typedistribution transformers andsubdistribution panels.Theessential lightingfixturespoweredbytheUPSsystemareconstantly energized.
Theegresslightingsystemprovidesadequatelightingforallegresssignsinsidetheplant.Thisisdesignedasaseparatesystemspecifically fortheinsidebuildingegressemergency conditions inaccordance withOSHArequirements.
TheegresslightingsystemreceivespowerfromthestationnormalUPSsystemaspartoftheessential lightingdistribution system.Theegresslightingfixturesareconstantly energized.
The8-hrbatterypacklightingprovidesillumination inallareasrequiredforoperation ofanysafeshutdownequipment andinaccessandegressroutestheretoincaseofafire.23Fluorescent, incandescent, andhighpressuresodiumlampsareusedforstationlighting.
Fluorescent lampsareusedforallofficesandformostoftheoperating areassuchasthecontrolroom,relayandcomputerroom,andemergency andnormalswitchgear rooms.Incandescent lampsareusedintheprimarycontainment, primarycontainment accesshatches,mainsteamtunnel,newfuelstoragevault,spentfuelpoolfilterroom,andinallotherareaswherelightingisinfrequently required.
HighpressuresodiumlampsareusedAmendment 231.2-39December198S NineMilePoint.Unit2FSARforallhighbaylightingsuchasintheturbinebuildingandreactorbuildinggeneralareas.1.2-40 NineMilePointUnit2FSAR1.2.llReferences NiagaraMohawkPowerCorporation.
Preliminary SafetyAnalysisReport,VolumeI,NineMilePointNuclearStation-Unit2,June1972.2.3.NiagaraMohawkPowerCorporation.
(Construction PermitStage),NineStation-Unit2,June1972.IOswegoCountyPlanningBoard.Plan,August1976.Environmental ReportMilePointNuclearPreliminary LandUseGulf6WesternTopicalReport.GGW-FSD2538,NuclearMainSteamIsolation ValveSystems,January1979.5.GeneralElectricLicensing TopicalReport.GeneralElectricStandardApplication forReactorFuel.NEDE-24011-P-A (latestapprovedrevision)
~6~GeneralElectricLicensing TopicalReport.GeneralElectricStandardApplication forReactorFuel(U.STSupplement),
NEDE-24011-P-A-US (latestapprovedr'evision).
Amendment 211.2-41September 1985}}

Revision as of 23:22, 7 July 2018

Forwards Rev 5 to Updated SAR Nine Mile Point Nuclear Station Unit 2 & Nine Mile Point Unit 2 Safety Evaluation Summary Rept 1993.
ML17059A086
Person / Time
Site: Nine Mile Point 
Issue date: 10/29/1993
From: SYLVIA B R
NIAGARA MOHAWK POWER CORP.
To:
NRC OFFICE OF INFORMATION RESOURCES MANAGEMENT (IRM)
Shared Package
ML17059A087 List:
References
NMP2L-1448, NUDOCS 9311040048
Download: ML17059A086 (266)


Text

NU NINE EAR LE POINT ATION-UNIT 2

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES GENERAL TABLE OF CONTENTS Page T=Table F=FicFure Page Page Amendment T=Table Amendment T=Table Amendment Number F=FicFure Number F=FicFure Number i ii iii iv R04 ROO ROO R03 R03 USAR Revision 4 EP i October 1992 J

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 1 PAGES Page T=Table F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 1-3.1-3.3.1-iii 1-iv 1-V 1-Vi 1-V1i 1-Vi11 1-ix 1-x 1.1-1 1.1-2 1~1 3 F 1.1-1 1~2 1 1~2 2 1 e 2 3 1.2-4 1.2-5 1.2-6 1\2 7 1.2-8 1.2-9 1.2-10 1.2-11 1.2-12 1.2-13 1.2-14 1.2-15 1.2-16 1'-17 1.2-18 1.2-19 1.2-20 1~2-21 1.2-22 1~2 23 1.2-24 1.2-25 1.2-26 1 e 2 27 1.2-28 1.2-29 1.2-30 A24 A24 A24 A24 ROO AOO R02 R04 R02 R03 A19 AOO A24 A21 AOO AOO A21 AOO AOO AOO AOO AOO AOO AOO A21 R04 AOO AOO A21 A21 AOO A18 AOO ROO R03 A19 AOO A21 R03 AOO A18 AOO AOO A28 1.2-31 1'-32 1~2 33 1~2 33a 1.2-33b 1.2-34 1.2-35 1.2-36 1e2-37 1.2-38 1.2-39 1.2-40 1.2-41 F 1.2-1 F 1.2-2 F 1.2-3 F 1.2-4 F 1.2-5 F 1.2-6 Sh 1 F 1.2-6 Sh 2 F 1.2-7 Sh 1 F 1.2-7 Sh 2 F 1.2-8 Sh 1 F 1.2-8 Sh 2 F 1.2-9 Sh 1 F 1.2-9 Sh 2 F 1.2-10 Sh 1 F 1.2-10 Sh 2 F 1.2-11 Sh 1 F 1.2-11 Sh 2 F 1.2-11 Sh 3 F 1.2-11 Sh 4 F 1.2-12 F 1.2-13 Sh 1 F 1.2-13 Sh 2 F 1.2-13 Sh 3 F 1'-14 F 1 2-15 Sh 1 F 1.2-15 Sh 2 F 1.2-15 Sh 3 F 1'-15 Sh 4 F 1'-16 F 1.2-17 Sh 1 F 1.2-17 Sh 2 F 1.2-17 Sh 3 F 1.2-17 Sh 4 A28 AOO A23 A18 A18 AOO AOO AOO AOO AOO A23 AOO A21 R03 R04 A26 A26 A26 ROO R02 R02 R01 R03 A26 R03 R01 R01 R02 R03 ROO ROO ROO ROO ROO A26 ROO ROO R04 R04 R04 R04 ROO ROO ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 1.2-17 1.2-17 1.2-18 1.2-19 1.2-19 1.2-20 1.2-20 1.2-21 1.2-21 1.2-22 1.2-22 1 2-23 1 2-23 1.2-24 1.2-25 1.2-26 1.2-26 1-2-27 1.2-27 1.2-28 1.2-29 1.2-29 1.2-29 1.2-30 1.2-31 1.2-32 1~2 32 1 e 2 3 2 1e233 1.2-34 1.2-35 1.2-36 1~2 3 7 1 e 2 3 7 1.2-38 1.2-39 1.2-40 Sh 5 Sh 6 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 1 1~3 1 T 1~3 1 T 1 e 3 1 T 1.3-1 T 1~3 1 T 1~3 2 T 1.3-2 T 1~3 3 ROO ROO ROO R02 R03 A26 ROO R04 ROO A26 A26 A26 A26 ROO A26 R02 R02 R02 R02 R03 AOO AOO R04 AOO ROO ROO ROO R04 ROO ROO A26 A26 A26 A26 AOO AOO A23 ROO A21 A21 AOO A21 AOO ROO A21 USAR Revision 4 EP 1-1 October 1992 e

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table Amendment F=Ficrure Number Page T=Table F=Picpure Amendment Number Page T=Table F=FicFure Amendment Number T 1.3-3 T 1.3-3 T 1.3-4 T 1.3-5 T 1.3-5 T 1.3-6 T 1.3-7 T 1.3-8 T 1.3-8 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 T 1.3-9 1.4-1 1.4-2 1.4-3 1.4-4 1.4-5 1.4-6 1.4-7 1.4-8 T 1.4-1 T 1.4-1 1.5-1 1.5-2 1.5-3 1.5-4 1.5-5 1~6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 T 1.6-1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 10a Sh 1 Sh 2 Sh 1 Sh la Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 A28 AOO AOO A20 AOO A28 A04 A21 A23 A04 A18 A28 A18 A18 A18 AOO A23 AOO A23 A23 AOO AOO A04 AOO AOO AOO AOO AOO A21 A23 AOO AOO AOO AOO AOO AOO A28 A28 Alo A19 Alo Alo A19 T 1.6-1 T 1.6-1 T 1 6-1 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1 e 7 1 T 1.7-1 T 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1 e 7 1 T 1.7-1 T 1.7-1 T 1~7 1 T 1.7-1 T 1.7-1 T 1~7-1 T 1.7-1 T 1~7 1 T 1.7-1 T 1~7 1 T 1~7 1 T 1.7-1 T 1~7 1 T 1~7-1 T 1\7 1 T l.7-1 T l.7-1 T 1.7-1 T 1.7-1 T 1~7 1 T 1~7 1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1.7-1 T 1~7-1 T 1 e 7 1 sh Sh Sh 6a 7 8 Sh 1 Sh 2 Sh3..Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 19a Sh 20 Sh 21 Sh 22 Sh 23 Sh 23a Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 A19 Rol Alo ROO A23 A23 A23 Aol Aol Aol Aol Aol Aol Aol Aol Aol AOl Aol Aol Aol Aol A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 T 1 7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1-7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1 7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-1 Sh T 1.7-2 Sh T 1.7-2 Sh T 1.7-2 Sh T 1.7-2 Sh F 1.7-1a F 1.7-1b F 1.7-1c F 1.7-1d F 1.7-le 40 41 42 43 44 44a 45 46 47 48 49 50 51 52 53 53a 54 55 55a 55b 55c 55d 55e 55f 55g 56 56a 57 57a 58 58a 59 59a 60 60a 60b 60c 1 2 3 4 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A09 A09 A09 A09 A09 A09 A09 A09 A09 A09 A23 A23 A23 A23 A23 A23 A23 A23 A24 A23 ROO ROO ROO ROO ROO ROO ROO ROO R03 USAR Revision 4 EP 1-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number F F F F 1~7 2 l.7-3 1~7 3 1.7-4 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1~8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1.8-1 T 1~8-1 T 1.8-1 Sh Sh Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh, 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 20a Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 3la Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 AOO ROO ROO ROO AOO AOO AOO A04 AOO A23 AOO A12 AOO AOO A05 A03 AOO AOO AOO AOO AOO Rol AOO A03 A18 A19 AOO AOO AOO R02 AOO AOO AOO AOO ROO AOO ROO ROO AOO A23 AOO AOO AOO A18 ROO T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1 8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh 38a 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 SSa 56 S6a 56b 57 57a 58 59 60 60a 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 ROO ROO ROO AOO AOO AOO A28 AOO AOO A05 R03 AOO A21 R03 AOO AOO AOO A07 A07 A24 A24 ROO ROO A18 A26 AOO A28 A08 AOO Rol AOO Rol R02 R02 R02 AOO AOO AOO AOO A08 AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1 8-1 1 8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1.8-1 1~8-1 1.8-1 1.8-1 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 89a Sh 89b Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 102a Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 108a Sh 109 Sh 110 Sh 111 Sh 112 Sh 113 Sh 114 Sh 115 Sh 116 Sh 117 Sh 118 Sh 119 Sh 120 AOO AOO AOO A05 AOO A22 A13 AOO AOO AOO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO A18 ROO AOO AOO ROO ROO AOO AOO AOO AOO Rol ROO ROO All A28 ROO AOO R03 A04 AOO AOO AOO A08 A27 A20 USAR Revision 4 EP 1-3 October 1992 A g f s I, Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh.T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1 8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1.8-1 Sh T 1~8-1 Sh T 1.8-1 Sh T 1.8-1 Sh 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 155a 156 157 158 159 160 160a 161 162 163 164 AOO R02 AOO AOO AOO AOO AOO AOO AOO ROO AOO A07 AOO AOO AOO AOO ROO A03 A03 AOO AOO AOO AOO AOO A03 AOO AOO A21 R02 AOO AOO A15 AOO AOO A17 A17 A07 A07 AOO AOO ROO ROO Rol ROO AOO ROO ROO A28 A28 AOO ROO T 1 8-1 Sh 165 T 1.8-1 Sh 166 T 1.8-1 Sh 167 T 1.8-1 Sh 168 T 1.8-1 Sh 169 T 1.8-1 Sh 169 T 1.8-1a Sh 1 T 1.8-1a Sh 2..T 1.8-1a Sh 3 T 1.8-1a Sh 4 T 1.8-1a Sh 5 T 1.8-1a Sh 6 T 1.8-1a Sh 7 T 1.8-1a Sh 8 T 1.8-1a Sh 9 T 1.8-1a Sh 10 T 1.8-1a Sh 11 T 1.8-1a Sh 12 T 1.8-1a Sh 13 T 1.8-1a Sh 14 T 1.8-1a Sh 15 T 1.8-1a Sh 16 T 1.8-1a Sh 17 T 1.8-2 Sh 1 T 1.8-2 Sh 2 T 1.8-2 Sh 3 T 1.8-2 Sh 4 T 1.8-2 Sh 5 T 1.8-2 Sh 5a T 1.8-2 Sh 6 T 1.8-2 Sh 7 T 1.8-2 Sh 7a T 1.8-2 Sh 8 T 1.8-2 Sh 9 T 1.8-2 Sh 10 T 1.8-2 Sh 10a T 1.8-2 Sh lob T 1.8-2 Sh 10c T 1.8-2 Sh 11 T 1.8-2 Sh lla T 1.8-2 Sh 12 T 1.8-2 Sh 13 T 1.8-2 Sh 13a=T 1.8-2 Sh 14 F 1.8-1 a ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO AOO AOO AOO AOO A07 All A28 A14 AOO A14 AOO A07 A07 A07 AOO A07 AOO AOO Rol AOO ROO 1.9-1 T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1'Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh T 1.9-1 Sh Att 1.9-1 Att 1.9-2 Att 1.9-3 Att 1.9-4 Att 1.9-5 Att 1.9-6 Att 1.9-7 Att 1.9-8 Att 1.9-9 Att 1.9-10 Att 1.9-11 Att 1.9-12 Att 1.9-13 Att 1.9-13 Att 1.9-13 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-14 Att 1.9-15 Att 1.9-16 Att 1.9-17 Att 1.9-18 Att 1.9-19 Att 1.9-20 Att 1.9-21 Att 1.9-22 Att 1.9-23 Att 1.9-24 Att 1.9-25 Att 1.9-26 Att 1.9-27 1 2 3 4 5 6 7 8 9 10 11 Sh Sh Sh Sh Sh Sh Sh Sh Sh Aol A07 R03 Aol A18 ROO A23 Rol A26 Aol Aol Aol A07 Aol Aol Aol Aol Aol Aol Aol Aol Aol Aol A05 Aol Aol R03 Aol A12 2aA12 2bA12 Aol R03 A27 Aol Aol A25 Aol Aol Aol Aol Aol Aol Aol Aol Aol USAR Revision 4 EP 1-4 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Firure Number Sh Sh Sh Sh Sh Sh Att 1.9-53 Att'1.9-54 Att 1.9-55 Att 1.9-56 Att 1.9-57 Att 1.9-58 Att 1.9-59 Att 1.9-60 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-61 Att 1.9-62 Att 1.9-63 Att 1.9-64 Sh Sh Sh sh sh Sh Att 1.9-28 Att 1.9-29 Att 1.9-30 Att 1.9-30 Att 1.9-31 Att 1.9-32 Att 1.9-33 Att 1.9-34 Att 1.9-35 Att 1.9-36 Att 1.9-37 Att 1.9-37 Att 1.9-38 Att 1.9-39 Att 1.9-40 Att 1.9-41 Att 1.9-42 Att 1.9-42 Att 1.9-43 Att 1.9-44 Att 1.9-45 Att 1.9-46 Att 1.9-47 Att 1.9-48 Att 1.9-49 Att 1.9-50 Att 1.9-51 Att 1.9-52 Att 1.9-52a A01 ROO 1 A01 2 A01 A01 A01 A01 A01 A18 A01 1 A27 2 A01 A01 A01 R01 A22 1 A05 2 A26 A01 A01 A01 A05 A23 A01 A01 A01 A23 A23 R04 A01 A18 A01 A18 A01 A01 A01 A01 1 ROO 1aROO 1bA27 2 A27 3 A27 4 ROO A21 A01 A01 Att 1.9-65 Att 1.9-66 Att 1.9-67 Att 1.9-68 Sh Att 1.9-68 Sh Att 1.9-69 Att 1.9-70 Att 1.9-71 Sh Att 1.9-71 Sh Att 1.9-72 Att 1.9-73 Att 1.9-74 Att 1.9-75 Att 1.9-76 Att 1.9-77 Att 1.9-78 Att 1.9-79 Att 1.9-80 Att 1.9-81 Att 1.9-82 Att 1.9-83 1.10-1 1.10-2 1.10-3 1.10-3a 1.10-3b 1.10-4 1'0-5 1.10-6 1.10-6a 1.10-6b 1.10-7 1.10-8 1.10-9 1.10-9a 1.10-9b 1.10-10 1.10-11 1'0-12 1.10-13 1.10-13a 1.10-13b 1.10-14 1.10-15 1.10-16 A01 A01 A01 1 A01 2 A01 A26 A25 1 A01 2 A01 A01 A01 A01 A01 A01 A01 A27 A01 ROO A01 A01 A01 AOO A09 A23 A23 A09 A09 AOO R04 A25 A25 A23 R03 R03 A17 A14 R03 A23 AOO R03 R03 A09 AOO AOO R02 1.10-17 1.10-18 1.10-19 1.10-19a 1.10-19b 1.10-20 1.10-21 1.10-22 1.10-23 1.10-24 1.10-25 1.10-26 1.10-27 1.10-27a 1.10-27b 1.10-28 1.10-29 1.10-30 1.10-30a 1.10-30b 1.10-31 1 10-32 1.10-33 1.10-33a 1.10-33b 1.10-34 1.10-35 1.10-35a 1.10-35b 1.10-36 1.10-37 1.10-38 1.10-39 1.10-40 1.10-41 1.10-42 1.10-43 1.10-44 1.10-45 1.10-46 1.10-46a 1.10-46b 1.10-47 1.10-47a 1.10-47b 1.10-48 AOO ROO R03 R03 A09 AOO AOO AOO AOO R03 A23 A17 A23 A23 A23 R03 R03 A23 A23 A14 AOO AOO R04 R04 A14 A23 A14 A14 A14 A23 A23 R03 ROO AOO AOO AOO AOO AOO AOO A03 ROO A03 A23 A23 A14 A23 USAR Revision EP 1-5 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 1.10-49 1.10-50 1.10-51 1.10-51a 1.10-51b 1.10-52 1.10-53 1.10-54 1.10-55 1.10-56 1.10-57 1.10-57a 1.10-57b 1.10-58 1.10-58a 1.10-58b 1.10-59 1.10-60 1.10-61 1.10-62 1.10-63 1.10-64 1.10-64a 1.10-64b 1.10-64c 1.10-64d 1.10-64e 1.10-64f 1.10-64fa 1.10-64fb 1.10-64g 1.10-64ga 1.10-64gb 1.10-64h 1.10-64i 1.10-64ia 1.10-64ib 1.10-64j 1.10-64]Q 1.10-64L 1.10-64m 1.10-64n 1.10-64o 1e10-64P T II.B.3-1 T II.B.3-1 Sh Sh AOO AOO A05 A05 A05 AOO AOO AOO AOO A23 A13 A13 A13 A13 A13 A13 A25 A07 R01 A23 A07 A26 A07 A20 A23 A23 A10 ROO A10 A10 A10 A10 A10 A27 A28 A10 A10 A07 A10 A10 A23 A23 A07 A07 ROO ROO T II~B.3-2 F II-B.3-1 Sh F II.B.3-1 Sh F ZI.B.3-1a F ZI.B.3-2 F II'.3-3 F II.B.3-4 F II.B.3-5 F II.B.3-6 1.10-65 1.10-66 1.10-67 1.10-68 1.10-69 1.10-69a 1.10-69b 1.10-69b.1 1.10-69b.2 1.10-69c 1.10-69d 1.10-69e 1.10-69f 1.10-69g 1.10-69h 1.10-69i 1.10-69j 1e10-69]%1.10-69L 1.10-69m 1.10-69n 1.10-70 1.10-70a 1.10-70b 1.10-71 1.10-72 1.10-73 1.10-73a 1.10-73a1 1.10-73a2 1.10-73b 1.10-73c 1.10-73ca 1.10-73cb 1.10-73d 1.10-73e 1.10-73f ROO 1 A23 2 A23 ROO A07 A20 A20 A20 A20 A23 A23 AOO A13 ROO A23 A23 A23 A23 A15 A15 A15 A15 A15 A15 A15 A15 A15 R03 A15 A15 A10 A10 A10 AOO AOO A04 A23 A23 A23 A23 A28 A08 A08 A24 A23 A22 1.10-73g 1.10-73h 1.10-73i 1.10-73j 1.10-73ja 1.10-73jb 1e10-73)(1.10-73L 1.10-73m T II.E.4'-1 Sh 1 T II.E.4.2-1 Sh 1a T II E.4'-1 Sh 2 T II E.4-2-1 Sh 3 1.10-73n 1.10-74 1.10-75 1.10-76 1.10-77 1.10-78 1.10-79 1.10-80 1.10-80a 1.10-80b 1.10-81 1.10-82 1.10-83 1.10-84 1.10-84a 1.10-84b 1.10-84c 1.10-84d 1.10-85 1.10-85.1 1.10-85.2 1.10-85a 1.10-85a1 1.10-85a2 1.10-85b 1.10-85c 1.10-85d 1.10-85e 1.10-85f A23 A22 A22 A22 A23 A08 A23 A22 A22 A24 A24 A08 A08 A04 A23 AOO A23 AOO AOO AOO R01 A13 A13 A23 AOO AOO R03 ROO ROO ROO ROO A23 A23 A23 A23 A23 A23 R03 R03 R03 A15 R03 USAR Revision EP 1-6 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number le10-85g 1elo-854 1.10-86 1.10-87 1.10-88 1.10-89 1.10-90 1.10-90a 1~10-90b 1 10-91 1.10-92 1.10-92a 1.10-92b 1.10-93 1.10-94 1.10-95 1.10-96 1.10-97 1.10-98 1.10-99 1.10-99a 1.10-99b 1~10-99c 1-10-99d 1.10-100 1.10-101 1.10-102 1.10-103 1.10-104 1.10-105 1.10-106 1 10-107 1.10-108 1.10-109 1.10-110 1-10-111 1.10-112 1-10-113 1.10-114 1.10-115 1-10-116 1-10-117 1-10-118 1.10-119 1.10-120 1.10-121 A23 A15 A27 AOO A23 AOO R03 ROO A09 A27 Alo Alo Alo R02 AOO A27 A27 ROO A23 A19 A19 R04 R04 R04 AOO A27 AOO AOO A13 AOO AOO Rol R01 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 R01 1.10-122 1.10-123 1.10-124 1.10-125 1.10-126 1.10-127 1.10-128 1.10-129 1.10-130 1.10-131 1.10-132 1.10-133 1.11-1 T 1~11-1 T 1.11-1 T 1.11-1 T 1.11-1 T 1.11-1 T 1.11-1 1~12-1 1.12-2 1.12-3 1~12-4 1.12-5 1~12-6 1.12-6a 1.12-6b 1~12-7 1.12-8 1.12-9 1.12-10 1.12-11 1.12-1la 1.12-11b 1.12-12 1.12-13 1.12-14 1.12-15 1.12-16 1.12-17 1.12-18 1.12-19 1.12-20 1.12-21 Sh 1 S?1 2 Sh 3 Sh 4 S11 5 S?1 6 AOO Rol A23 A18 A15 AOO AOO AOO AOO AOO R04 R04 AOO AOO AOO Rol R03 R03 R03 A03 A03 A03 A03 A03 A18 A18 A18 A03 A03 A03 A03 R03 R04 R04 A03 R03 A23 A23 A03 A28 A03 A03 A03 A28 1.12-22 1.12-23 1.12-24 1~12-25 1.12-26 1.12-27 1 12-28 1.12-29 1.12-30 1.12-31 1 12-32 1.12-32a 1~12-32b 1012-33 1.12-34 1.12-35 1.12-36 1~12 37 1 12-38 1~12-39 1.12-40 1.12-41 1.12-42 1~13-1 1.13-2 1~13 3 1.13-4 1.13-5 1.13-6 1~13-7 1.13-8 1.13-9 1.13-10 1.13-11 1.13-12 1.13-13 1.13-14 1.13-15 1.13-16 1.13-17 1.13-18 1.13-19 1.13-20 1~13-21 1~13-22 A03 A03 A03 A03 A03 A03 A03 A03 A03 A03 R02 R02 R02 A04 A04 A04 A04 A27 A04 A04 A04 A04 A04 R04 A09 A09 A09 R04 R04 R04 R04 A09 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 USAR Revision 4 EP 1-7 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 1 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment, F=FicFure Number F=FicFure Number F=FicFure Number 1~13 23 1.13-24 R04 A09 USAR Revision 4 EP 1-8 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 2 PAGES Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F FicFure Number 2 3.2-ii 2-iia 2-iib 2-lil 2-iiia 2-iiib 2-3.V 2-V 2-V3.2-Vll 2-viia 2-viib 2-Vii3.2-vi3.ia 2-viiib 2-lx 2-X 2-Xi 2-xia 2-xib 2-X3.3.2-xiia 2-xiib 2-Xlll 2-xiiia 2-xiiib 2-XiV 2-XV 2-XV3.2-XVi 3.2-XViii 2-xviiia 2-xviiib 2-Xlx 2-xixa 2-xixb 2-XX 2-XXi 2-xxia 2-xxib 2-XX3.3.2-XX3.i 3.2-XX3.V 2-XXV 2-XXV3.R04 A24 A24 A24 ROO A24 A24 ROO A24 AOO A24 A24 A24 R04 ROO A14 A07 R02 A24 ROO A03 A24 A24 A24 A24 A24 A15 ROO AOO AOO AOO A05 ROO A05 A26 A26 A03 A24 A13 A13 A13 AOO A24 A24 A24 A24 2-xxvia 2-xxvib 2-XXV1 1 2-XXVi i 3.2-XX3.X 2 XXX 2-XXX3.2-XXXi3.2.1-1 2~1 2 2~1 3 2~1 3a 2.1-3b 2.1-4 2.1-5 2.1-6 2.1-6a 2.1-6b 2~1 7 2~1 7a 2.1-7b 2.1-8 2.1-9 T 2'-1 T 2'-2 T 2~1 3 T 2.1-4 T 2.1-5 T 2.1-6 T 2.1-7 T 2'-8 T 2.1-9 T 2.1-10 T 2'-11 T 2.1-12 T 2'-13 T 2.1-14 T 2.1-15 T 2.1-16 T 2~1 17 T 2.1-18 T 2'-19 T 2.1-20 T 2.1-21 T 2.1-22 A26 A11 A24 A24 A24 A24 A24 A24 ROO R04 ROO A04 A04 ROO A07 A07 A07 A07 ROO ROO A11 A11 A07 R04 A28 A28 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO A07 A07 A07 A07 F 2.1-1 F 2.1-2 F 2.1-3 F 2.1-4 F 2.1-5 F 2.1-6 F 2.1-7 F 2.1-8 F 2.1-9 F F 1-10 F 2'-11.F 2'-12 F 2'-13 F 2'-14 F 2.1-15 F 2.1-16 F 2.1-17 F 2.1-18 F 2.1-19 F 2.1-20 2~2 1 2~2 2 2~2 3 2~2-4 2'-5 2.2-5a 2.2-5b 2.2-6 2~2 7 2.2-8 2'-9 2.2-10 2.2-11 T 2.2-1 T 2.2-2 T 2.2-3 T 2.2-4 S?1 1 T 2.2-4 S11 2 T 2'-4 S11 3 T 2.2-5 Sh 1 T 2.2-5 Sll 2 T 2'-6 T 2.2-7 T 2.2-8 T 2.2-9 A13 ROO ROO A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO A11 A19 R02 R02 A26 A03 A03 ROO R02 R04 R04 R02 A03 ROO A25 AOO R02 A25 A25 AOO R02 ROO AOO R02 R02 A28 USAR Revision 4 EP 2-1 October 1992 E

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=F icFFre Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 2.2-1 2~3 1 2~3 2 2~3 3 2.3-4 2'-5 2.3-5a 2.3-5b 2.3-6 2~3 7 2~3-8 2.3-8a 2'-8b 2.3-8c 2'-Sd 2'-9 2.3-10 2.3-10a 2.3-10b 2'-11 2.3-11a 2-3-11b 2'-12 2~3 1 3 2.3-14 2.3-15 2.3-16 2~3 17 2'-18 2.3-19 2.3-19a 2'-19b 2-3-20 2 3-21 2~3 22 2~3 23 2'-24 2.3-25 2.3-26 2.3-26a 2.3-26b 2~3 27 2.3-28 2'-29 2.3-30 A09 AOO AOO AOO AOO A05 A05 A05 A23 AOO A22 A22 A19 A22 A19 A10 A10 A05 A05 A05 A05 A05 AOO AOO AOO AOO AOO A26 AOO A05 A05 A05 A03 AOO AOO AOO A26 A19 A03 A03 A03 A26 A26 AOO AOO 2~3 3 1 2~3 32 2~3 3 2 a 2.3-32b 2~3 3 3 2~3 33a 2.3-33b 2.3-34 2.3-34a 2'-34b 2'-35 2.3-35a 2.3-35b 2.3-36 2~3 37 2'-38 2'-39 2.3-40 2.3-41 2'-42 2'-43 2'-44 2.3-45 2'-46 2.3-47 2'-48 2'-49 2.3-50 2'-51 2.3-51a 2.3-51b 2.3-52 2.3-53 2'-54 2'-55 2 3-56 2'-57 2'-58 2'-59 2.3-60 2'-61 2.3-62 2.3-62a 2'-62b T 2~3 1 T 2~3 2 A03 R02 ROO ROO A23 A23 A23 ROO A13 A13 A13 A13 A13 A13 AOO A26 A23 A23 A26 A13 A23 A13 A13 A23 ROO A03 AOO AOO A23 A23 A23 AOO AOO ROO AOO AOO AOO AOO A10 A13 A13 A19 R02 A19 AOO AOO T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2~3 3 2.3-4 Sh 1 2.3-4 Sh 2 2.3-4a 2.3-5 Sh 1 2.3-5 Sh 2 2.3-5a Sh 1 2.3-5a Sh 2 2.3-6 2~3 7 2~3 1 2~3 2 2~3 3 2.3-4 2.3-5 2.3-6 2~3 7 2.3-8 2.3-9 2.3-10 2~3 1 1 2.3-12 2~3 13 2.3-14 2.3-15 2.3-16 2~3 17 2.3-18 2.3-19 2.3-20 2~3 2 1 2~3 2 2 2~3 23 2.3-24 2.3-25 2.3-26 2~3 27 2.3-28 2.3-29 2.3-30 2.3-31 2~3 32 2~3 33 2.3-34 2.3-35 2.3-36 AOO AOO AOO R01 AOO AOO ROO ROO A05 A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-2 October 1992

'8 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table~F=F're Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficrure Number F 2.3-37 F 2.3-38 F 2.3-39 F 2.3-40 F 2.3-40a F 2.3-41 F 2.3-42 F 2'-43 F 2'-44 F 2.3-45 F 2.3-46 2.4-1 2'4-2 2.4-3 2.4-3a 2.4-3b 2'-4 2'-4a 2.4-4b 2'-5 2.4-5a 2'-5b 2.4-6 2'-7 2.4-8 2.4-9 2.4-10 2.4-11 2.4-12 2.4-12a 2.4-12b 2.4-13 2'-13a 2.4-13b 2.4-14 2.4-14a 2.4-14b 2.4-15 2.4-15a 2'-15b 2.4-16 2.4-16a 2.4-16b 2.4-17 2.4-18 AOO AOO AOO A05 A05 A03 A03 A03 A03 A03 A03 AOO AOO A03 A03 A03 ROO ROO ROO A26 A26 A26 A25 R04 AOO AOO A26 AOO ROO ROO ROO ROO A26 A26 A26 A26 A26 R04 ROO ROO ROO ROO A23 R04 R04 2.4-19 2.4-20 2.4-21 2.4-22 2.4-23 2.4-24 2.4-25 2.4-26 2.4-27 2'-28 2.4-29 2 4-30 2.4-31 2.4-32 2.4-33 2'-34 2.4-35 2.4-36 2'-36a 2.4-36b 2.4-37 2.4-38 2.4-39 2.4-40 2.4-41 2'-42 2.4-43 2.4-44 T 2.4-1 T 2.4-2 T 2.4-3 T 2'-4 T 2.4-5 T 2.4-6 T 2.4-7 T 2.4-8 T 2.4-9 T 2.4-10 T 2.4-10 T 2.4-10 T 2.4-11 T 2.4-11 T 2.4-11 T 2.4-11 T 2.4-12 T 2.4-13 S?1 1 Sh 2 Sh 3 S?1 1 Sh 2 S?1 3 Sh 4 A03 AOO A26 R01 A25 AOO AOO AOO AOO A27 AOO AOO AOO AOO AOO AOO AOO A19 A19 A19 A26 AOO AOO A05 A26 AOO AOO A25 AOO AOO A26 AOO AOO AOO AOO AOO A04 AOO AOO AOO A03 A03 A03 A03 A03 A03 T 2.4-14 T 2.4-15 T 2'-15 F 2.4-1 F 2.4-2 F 2.4-3 F 2.4-4 F 2.4-5 F 2.4-6 F 2.4-7, F 2.4-8a F 2.4-8b F 2.4-9 F 2.4-10 F 2'-11 F 2'-12 F 2'-13 F 2.4-14 F 2'-15 F 2.4-16 F 2.4-17 F 2'-18 2.5-1 2.5-1a 2.5-1b 2.5-2 2.5-3 2.5-4 2.5-5 2.5-5a 2.5-5b 2.5-6 2.5-7 2.5-8 2.5-9 2.5-10 2.5-11 2.5-12 2.5-13 2.5-14 2.5-15 2.5-16 2.5-17 2.5-18 2.5-19 Sh S?1 A03 R02 R02 ROO A08 AOO A26 AOO A26 AOO ROO ROO AOO A08 AOO AOO AOO AOO AOO A03 A03 A26 A04 A25 A04 AOO AOO AOO A28 A28 A28 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-3 October 1992 b'

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F FicFure Number 2.5-20 2.5-21 2.5-22 2.5-22a 2.5-22b 2.5-23 2.5-24 2.5-25 2.5-26 2.5-27 2.5-28 2'-29 2.5-30 2.5-31 2.5-32 2.5-33 2.5-34 2.5-35 2.5-36 2.5-37 2.5-38 2.5-39 2.5-40 2.5-41 2.5-42 2.5-43 2.5-44 2.5-45 2.5-46 2.5-47 2.5-48 2.5-49 2.5-50 2.5-51 2.5-52 2.5-53 2.5-54 2.5-55 2.5-56 2.5-57 2.5-58 2.5-59 2.5-60 2.5-61 2.5-62 2.5-63 AOO AOO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO AOO ROO AOO A04 ROO 2.5-64 2.5-65 2.5-66 2.5-67 2.5-68 2.5-69 2.5-70 2.5-71 2.5-72 2.5-73 2.5-74 2.5-75 2.5-76 2.5-77 2.5-78 2.5-79 2.5-80 2.5-81 2.5-82 2.5-83 2.5-84 2.5-85 2.5-86 2.5-87 2.5-88 2.5-89 2.5-90 2.5-91 2.5-92 2.5-93 2.5-94 2.5-95 2.5-96 2.5-97 2.5-98 2.5-99 2.5-100 2.5-101 2.5-102 2.5-103 2'-104 2.5-105 2.5-106 2.5-107 2.5-108 2.5-109 ROO ROO AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO AOO ROO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2.5-110 2.5-111 2.5-112 2.5-113 2.5-114 2.5-115 2.5-116 2.5-117 2.5-118 2.5-119 2.5-120 2.5-121 2.5-122 2.5-123 2.5-124 2.5-125 2.5-126 2.5-127 2.5-128 2.5-129 2'-130 2.5-131 2.5-132 2.5-133 2.5-134 2.5-135 2.5-136 2.5-137 2.5-138 2.5-139 2.5-140 2.5-141 2'-142 2.5-143 2.5-144 2.5-145 2.5-146 2.5-147 2.5-148 2.5-149 2'-150 2.5-151 2.5-152 2.5-153 2.5-154 2.5-155 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO ROO AOO ROO AOO AOO ROO A28 AOO AOO AOO AOO A04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-4 October 1992

'

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 2.5-156 2.5-157 2.5-158 2.5-159 2.5-160 2.5-161 2.5-162 2.5-163 2.5-164 2.5-165 2.5-166 2.5-167 2.5-167a 2.5-167b 2.5-167c 2.5-167d 2.5-168 2.5-168a 2.5-168b 2.5-168c 2.5-168d 2.5-169 2.5-170 2.5-171 2.5-171a 2.5-171b 2.5-172 2.5-173 2.5-173a 2.5-173b 2.5-174 2.5-174a 2.5-174b 2.5-174c 2.5-174d 2.5-175 2.5-176 2.5-176a'2.5-176b 2.5-177 2.5-177a 2.5-177b 2.5-177c 2.5-177d 2.5-178 2.5-178a AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A05 ROO A05 A05 A18 A05 A05 A05 A05 AOO AOO R01 ROO A05 AOO ROO ROO ROO ROO A15 A15 A15 A15 A11 A11 A05 A05 A05 A18 ROO ROO ROO A18 A12 2.5-178b 2.5-178c 2.5-178d 2.5-179 2.5-180 2.5-181 2.5-182 2.5-183 2.5-184 2.5-185 2.5-186 2.5-187 2.5-188 2.5-189 2.5-190 2'-191 2.5-192 2.5-192a 2.5-192b 2.5-193 2.5-194 2.5-194.1 2'-194.2 2.5-194a 2.5-194b 2.5-194c 2.5-194d 2.5-194e 2.5-194f 2.5-194g 2.5-194?1 2.5-194i 2.5-194j 2.5-194k 2.5-194L 2.5-195 2.5-196 2.5-197 2.5-198 2.5-199 2.5-200 2.5-201 2.5-202 2.5-203 2.5-204 2.5-205 A12 ROO A12 A12 ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A15 R04 A11 AOO ROO A24 A24 A14 A27 A26 A26 A19 A14 A14 A14 A14 A14 A26 A26 A14 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2.5-206 2.5-207 2.5-208 2.5-209 2.5-210 2.5-211 2'-212 2 5-213 2'-214 2.5-215 2.5-216 2'-217 2 5-218 2.5-219 2.5-220 T 2.5-1 T 2.5-2 S11 1 T 2.5-2 S?1 2 T 2.5-2 Sh 3 T 2.5-2 S11 4 T 2'-2 Sh 5 T 2.5-2 S?1 6 T 2.5-3 S?1 1 T 2.5-3 SB 2 T 2.5-3 S11 3 T 2.5-4 T 2.5-5 Sh 1 T 2.5-5 S?1 2 T 2.5-5 S11 3 T 2.5-6 T 2.5-7 T 2.'5-8 T 2.5-9 S?1 1 T 2.5-9 Sh 2 T 2.5-10 T 2.5-11 T 2.5-12 Sh 1 T 2.5-12 S11 2 T 2.5-13 T 2.5-14 T 2.5-15 T 2.5-16 S?1 1 T 2.5-16 S?I 2 T 2.5-17 T 2.5-18 S?I 1 T 2.5-18 Sh 2 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A13 ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-5 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=Ficrure Amendment Number Page T=Table F=F icFu re Amendment Number Page T=Table Amendment F=FicFure Number T 2.5-18 T 2'-18 T 2.5-19 T 2.5-20 T 2.5-21 T 2.5-21 T 2'-21 T 2.5-21 T 2'-21 T 2.5-22 T 2.5-22 T 2.5-23 T 2.5-23 T 2.5-24 T 2.5-25 T 2.5-26 T 2.5-27 T 2.5-28 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-29 T 2.5-30 T 2.5-31 T 2.5-32 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-33 T 2.5-34 T 2.5-35 T 2.5-36 T 2.5-37 T 2.5-38 T 2.5-39 T 2'-40 T 2.5-41 T 2.5-42 T 2.5-43 T 2.5-43 T 2.5-44 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 T 2.5-28A AOO AOO AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A21 A06 A06 A06 A06 A06 A06 A06 AOO AOO AOO AOO AOO AOO AOO AOO A22 AOO A05 A05 A05 A05 A05 A05 A05 A18 A09 A11 T 2.5-45 T 2.5-45A T 2.5-46 T 2.5-46A T 2.5-46B T 2.5-46C T 2.5-47 T 2.5-48A T 2.5-48B T 2.5-48C T 2.5-49 T 2.5-50 F 2.5-1 F 2.5-2 F 2.5-3 F 2.5-4 F 2.5-5 F 2.5-6 F 2.5-7 F 2.5-8 F 2.5-9 F 2.5-10 F 2.5-11 F 2.5-12 F 2.5-13 F 2.5-14 F 2.5-15 F 2.5-16 F 2.5-17 F 2.5-18 F 2'-19 F 2.5-20 F 2.5-21 F 2.5-22 F 2.5-23 F 2.5-24 F 2.5-25 F 2.5-26 F 2.5-27 F 2.5-28 F 2.5-28A F 2.5-29 F 2.5-30 F 2.5-31 F 2.5-32 F 2.5-33 A18 A19 A18 A14 A17 A17 A14 A14 A14 A17 A17 A22 AOO AOO AOO AOO AOO AOO A06 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A06 A13 AOO AOO AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2.5-34 2.5-35 2.5-36 2.5-37 2.5-38 2.5-39 2.5-40 2.5-41 2.5-42 2.5-43 2.5-44 2.5-45 2.5-46 2.5-47 2.5-48 2.5-49 2.5-50 2.5-51 2.5-52 2.5-53 2.5-54 2.5-55 2.5-56 2.5-57 2.5-58 2.5-59 2.5-60 2.5-61 2.5-62 2.5-63 2.5-64 2.5-65 2.5-66 2.5-67 2.5-68 2.5-69 2.5-70 2.5-71 2.5-72 2.5-73 2.5-74 2.5-75 2.5-76 2.5-77 2.5-78 2.5-79 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-6 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2.5-80 2.5-81 2.5-82 2.5-83 2.5-84 2.5-85 2.5-86 2.5-87 2.5-88 2.5-89 2.5-90 2'-91 2.5-92 2.5-93 2'-94 2.5-95 2.5-96 2.5-96A 2.5-96B 2.5-96C 2.5-96D 2.5-96E 2.5-96F 2.5-97 2.5-98 2.5-99 2.5-100 2.5-101 2.5-102 2.5-102A 2.5-102B 2.5-103 2.5-104 2.5-105 2.5-105A 2.5-105B 2.5-105C 2.5-105D 2.5-105E 2.5-105F 2.5-105G 2.5-105H 2.5-105I 2.5-105J 2.5-106 2.5-107 AOO AOO AOO AOO A06 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A05 A05 A05 A27 A27 AOO AOO AOO AOO AOO AOO A05 A05 AOO AOO AOO A05 A05 A05 A05 A05 A05 A05 A05 A05 A11 AOO AOO F 2.5-108 F 2.5-109 F 2.5-110 F 2.5-111 F 2.5-112 F 2.5-113 F 2.5-114 F 2.5-115 Sh F 2.5-115 Sh F 2.5-116 F 2.5-117 Sh F 2.5-117 Sh F 2.5-118 F 2.5-119 Sh F 2.5-119 Sh F 2.5-119 Sh F 2.5-119 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-120 Sh F 2.5-121 Sh F 2.5-121 Sh F 2.5-121 Sh F 2.5-122 F 2.5-123 F 2.5-124 F 2.5-125 F 2.5-126 F 2.5-127 F 2.5-127a.F 2.5-127b F 2.5-128 F 2.5-129 F 2.5-130 F 2.5-131 F 2.5-132 F 2.5-133 F 2.5-134 F 2.5-135 F 2.5-136 F 2.5-137 F 2.5-138 F 2.5-139 F 2.5-140 F 2.5-141 1 2 1 2 1 2 3 4 1 2 3 4 1" 2 3 AOO AOO A05 A05 AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A22 A09 A09 A23 A05 A05 A05 A05 A05 A05 A11 A12 A12 A12 A12 A12 A12 F 2'-142 F 2.5-143 F 2.5-144 F 2.5-145 F 2.5-146 F 2.5-147 F 2 5-148 F 2.5-149 F 2 5-150 F 2.5-151 F 2.5-152 F 2.5-153 F 2.5-154 F 2.5-155 F 2.5-156 F 2.5-157 F 2.5-158 F 2.5-159 F 2.5-160 F 2.5-161 F 2.5-162 F 2.5-163 F 2.5-164 F 2.5-165 F 2.5-166 F 2.5-167 F 2.5-168 F 2.5-169 F 2.5-170 F 2.5-171 F 2.5-172 F 2.5-173 F 2.5-174 F 2.5-175 F 2.5-176 F 2.5-177 F 2.5-178 F 2.5-179 F 2.5-180 F 2'-181 F 2.5-182 F 2.5-183 F 2.5-184 F 2.5-185 F 2.5-186 F 2.5-187 A12 A12 A12 A12 A12 A12 A12 A12 A28 A13 A13 A13 A22 A22 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 USAR Revision 4 EP 2-7 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F FicFure Amendment Number F 2.5-188 F 2.5-189 F 2.5-190 F 2.5-191 F 2.5-192 F 2.5-192 F 2.5-193 F 2.5-193 F 2.5-194 F 2.5-195 F 2.5-196 F 2.5-197 F 2.5-197 F 2.5-197 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-198 F 2.5-199 F 2.5-199 F 2 5-199 F 2.5-199 F 2.5-199 F 2.5-200 F 2.5-200 F 2.5-201 F 2.5-201 F 2.5-201 F 2.5-202 F 2.5-203 F 2.5-204 F 2.5-205 F 2.5-206 F 2.5-207 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 F 2.5-208 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 A27 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 A14 F 2.5-209 F 2.5-210 F 2.5-210 F 2.5-210 F 2.5-210 F 2.5-211 F 2.5-211 F 2.5-212 F 2.5-212 F 2.5-212 App 2A 2A-1 2A-2 2A-3 2A-4 2A-5 T 2A-1 Sh T 2A-1 Sh T 2A-1 Sh T 2A-1 Sh F 2A-1 App 2B 2B-i 2B-ii 2B-iii 2B-iv T 2B-1 T 2B-2 T 2B-2A T 2B-2B T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-3 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh T 2B-4 Sh Sh 1 Sh 2 Sh 3 Sh 4 Sh 1.Sh 2 Sh 1 Sh 2 Sh 3 1 2 3 4 5 6 7 8 9 1 2 3 4 5 A23 A26 A26 A26 A26 A26 A26 A26 A26 A26 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A02 AOO A05 A05 A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 T 2B-4 T 2B-4 T 2B-4 T 2B-4 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-5 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision EP 2-8 October 1992 I.

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table g~F'ue Amendment Number T 2B-6 Sh 34 T 2B-6 Sh 35 T 2B-6 Sh 36 T 2B-6 Sh 37 T 2B-6 Sh 38 T 2B-6 Sh 39 T 2B-6 Sh 40 T 2B-6 Sh 41 T 2B-6 Sh 42 T 2B-6 Sh 43 T 2B-6 Sh 44 T 2B-6 Sh 45 T 2B-6 Sh 46 T 2B-6 Sh 47 T 2B-6 Sh 48 T 2B-6 Sh 49 T 2B-6 Sh 50 T 2B-6 Sh 51 T 2B-6 Sh 52 T 2B-6 Sh 53 T 2B-6 Sh 54 T 2B-6 Sh 55 T 2B-6 Sh 56 T 2B-6 Sh 57 T 2B-6 Sh 58 T 2B-6 Sh 59 T 2B-6 Sh 60 T 2B-6 Sh 61 T 2B-6 Sh 62 T 2B-6 Sh 63 T 2B-6 Sh 64 T 2B-6 Sh 65 T'2B-6 Sh 66 T 2B-6 Sh 67 T 2B-6 Sh 68 T 2B-6 Sh 69 T 2B-6 Sh 70 T 2B-6 Sh 71 T 2B-6 Sh 72 T 2B-6 Sh 73 T 2B-6 Sh 74 T 2B-6 Sh 75 T 2B-6 Sh 76 T 2B-6 Sh 77 T 2B-6 Sh 78 T 2B-6 Sh 79 AOO AOO AOO AOO AOO AOO AOO'OO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-6 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-.7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 Sh Sh Sh Sh Sh 18 19 20 21 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-9 October 1992 I

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F Ficiure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F FicFure Amendment Number T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-7 T 2B-8 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 T 2B-8 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-10 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER-2 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T 2B-8 Sh 94 T 2B-8 Sh 95 T 2B-8 Sh 96 T 2B-8 Sh 97 T 2B-8 Sh 98 T 2B-8 Sh 99 T 2B-8 Sh 100 T 2B-8 Sh 101 T 2B-8 Sh 102 T 2B-8 Sh 103 T 2B-8 Sh 104 T 2B-8 Sh 105 T 2B-8 Sh 106 T 2B-8 Sh 107 T 2B-8 Sh 108 T 2B-9 T 2B-10 Sh 1 T 2B-10 Sh 2 T 2B-10 Sh 3 T 2B-10 Sh 4 T 2B-10 Sh 5 T 2B-10 Sh 6 T 2B-10 Sh 7 T 2B-10 Sh 8 T 2B-11 T 2B-12 T 2B-13 T 2B-14 Sh 1 T 2B-14 Sh 2 T 2B-14 Sh 3 T 2B-15 Sh 1 T 2B-15 Sh 2 T 2B-15 Sh 3 T 2B-16 Sh 1 T 2B-16 Sh 2 T 2B-16 Sh 3 T 2B-17 Sh 1 T 2B-17 Sh 2 T 2B-17 Sh 3 T 2B-17 Sh 4 T 2B-17 Sh 5 T 2B-17 Sh 6 T 2B-17 Sh 7 T 2B-17 Sh 8 T 2B-17 Sh 9 T 2B-17 Sh 10 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T 2B-17 T 2B-17 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-18 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-19 T 2B-20 T 2B-21 T 2B-22 T 2B-23 T 2B-24 T 2B-25 T 2B-25 T 2B-26 T 2B-27 T 2B-28 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-29 T 2B-30 T 2B-31 T 2B-32 T 2B-33 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh Sh Sh Sh Sh Sh Sh Sh sh AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 A05 A05 A05 A05 A05 AOO AOO AOO AOO T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-33 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-34 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-35 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-36 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-11 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=PicFure Amendment Number T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 T 2B-37 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T.T T T T T T T T T T T T T T T T T T T T T T 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62, Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO.AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-37 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 101 102 103 104 105 106 107 108 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-12 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=Ficpure Amendment Number Page T=Table F=Ficrure Amendment Number T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 T 2B-38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-38 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92.Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 AOO AOO AOO AOO AOO AOO AOO Sh 12 AOO Sh 13 AOO Sh 14 AOO Sh 15 AOO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 2B-39 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57 Sh 58 Sh 59 Sh 60 Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 67 Sh 68 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-13 October 1992 I

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFFre Number Page T=Table Amendment F=FicFure Number Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 74 Sh 75 Sh 76 Sh 77 Sh 78 Sh 79 Sh 80 Sh 81 Sh 82 Sh 83 Sh 84 Sh 85 Sh 86 Sh 87 Sh 88 Sh 89 Sh 90 Sh 91 Sh 92 Sh 93 Sh 94 Sh 95 Sh 96 Sh 97 Sh 98 Sh 99 Sh 100 Sh 101 Sh 102 Sh 103 Sh 104 Sh 105 Sh 106 Sh 107 Sh 108 Sh T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-39 T 2B-40 T 2B-41 T 2B-42 T 2B-42A T 2B-43 T 2B-44 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO A05 AOO AOO T 2B-44 Sh 2 T 2B-45 T 2B-46 T 2B-47 T 2B-48 Sh 1 T 2B-48 Sh 2 T 2B-49 T 2B-50 T 2B-51 Sh 1 T 2B-51 Sh 2 T 2B-52 T 2B-52A T 2B-53 T 2B-54 Sh 1 T 2B-54 Sh 2 App 2C 2C-1 2C-2 2C-3 2C-4 T 2C-1 F 2C-1 F 2C-2 F 2C-3 App 2D 2D-i 2D-1 2D-2 2D-3 2D-4 2D-5 2D-6 2D-7 2D-8 2D-9 F 2D-1 F 2D-2 F 2D-3 App 2E 2E-1 2E-2 2E-3 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO App 2F 2F-i 2F-ia 2F-ib 2F-ii T 2F-1 Sh 1 T 2F-1 Sh 2 T 2F-1 Sh 3 T 2F-2 Sh 1 T 2F-2 Sh 2 T 2F-2a Sh 1 T 2F-2a Sh 2 T 2F-2b T 2F-2c Sh 1 T 2F-2c Sh 2 T 2F-3 T 2F-4 T 2F-5 T 2F-6 Sh 1 T 2F-6 Sh 2 T 2F-6 Sh 3 T 2F-6 Sh 4 T 2F-6 Sh 5 T 2F-6 Sh 6 T 2F-6 Sh 7 T 2F-6 Sh 8 T 2F-6 Sh 9 T 2F-6 Sh 10 T 2F 6 Sh 11 T 2F-6 Sh 12 T 2F-7 Sh 1 T 2F-7 Sh 2 T 2F-7 Sh 3 T 2F-7 Sh 4 T 2F-7 Sh 5 T 2F-7 Sh 6 T 2F-7 Sh 7 T 2F-7 Sh 8 T 2F-7 Sh 9 T 2F-8 T 2F-9 T 2F-10 T 2F-11 Sh 1 T 2F-11 Sh 2 T 2F-11 Sh 3 T 2F-11 Sh 4 AOO A23 A23 A23 AOO'23 A23 A23 A13 A13 A23 A23 A23 A23 A23 A23 AOO A13 AOO AOO AOO A23 AOO A23 A23 A23 A23 A23 A23 A23 A24 AOO AOO AOO AOO AOO AOO AOO AOO A23 AOO AOO AOO AOO A23 A23 USAR Revision 4 EP 2-14 October 1992 I w Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number T 2F-11 Sh 5 T 2F-11 Sh 6 T 2F-11 Sh 7 T 2F-11 Sh 8 T 2F-11 Sh 9 App 2G 2G-i T 2G-1 T 2G-2 T 2G-3 T 2G-4 T 2G-5 T 2G-6 T 2G-7 T 2G-7a T 2G-8 T 2G-9 App 2H 2H-i 2H-ia 2H-ib 2H-ii 2H-iii 2H-iv 2H-v 2H-vi 2H-vii 2H-1 2H Notes Sh 1 2H Notes Sh 2 2H Notes Sh 3 F 2H-1 F 2H-1A F 2H-2 F 2H-3 F 2H-4 F 2H-5 F 2H-6 F 2H-7 F 2H-8 F 2H-9 F 2H-10 F 2H-ll F 2H-12 A23 A23 A23 A23 A23 AOO A23 AOO AOO AOO AOO AOO A23 A23 A23 A23 A04 AOO A09 A09 A09 AOO AOO AOO AOO AOO A09 AOO AOO AOO AOO AOO A09 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F 2H-13 F 2H-14 F 2H-15 F 2H-16 F 2H-17 F 2H-18 F 2H-19 F 2H-20 F 2H-21 F 2H-22 F 2H-23 F 2H-24 F 2H-25 F 2H-26 F 2H-27 F 2H-28 F 2H-29 F 2H-30 F 2H-31 Sh 1 F 2H-31 Sh 2'F 2H-32 F 2H-33 F 2H-34 F 2H-35 F 2H-36 F 2H-37 F 2H-38 F 2H-39 F 2H-40 F 2H-41 F 2H-42 F 2H-43 F'2H-44 F 2H-45 F 2H-46 F 2H-47 F 2H-48 F 2H-49 F 2H-50 F 2H-51 F 2H-52 F 2H-53 F 2H-54 Sh 1 F 2H-54 Sh 2 F 2H-55 F 2H-56 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F F F F F F F F F F F F F.F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2H-57 2H-58 2H-59 2H-60 2H-61 2H-62 2H-63 2H-64 2H-65 2H-66 2H-67 2H-68 2H-69 2H-70 2H-71 2H-72 2H-73 2H-74 2H-75 2H-76 2H-76 2H-77 2H-78 2H-79 2H-80 2H-81 2H-82 2H-83 2H-84 2H-85 2H-86 2H-87 2H-87 2H-88 2H-89 2H-90 2H-91 2H-92 2H-93 2H-94 2H-95 2H-96 2H-97 2H-98 2H-99 2H-100 Sh Sh Sh Sh AOO AOO AOO AOO-AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A09 A09 A09 A09 A09 USAR Revision 4 EP 2-15 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Ficrure Number F 2H-101 App 2I DSZ 2Z-i 2I-ii 2I-lii 2I-iv 2I-v 2I-1 2I-2 2I-3 2I-4 2I-5 2I-6 2I-7 2I-8 2I-9 2I-10 2I-11 2I-12 2I-13 2I-14 2I-15 2I-16 2I-17 2I-3,8 2I-19 2I-20 2I-21 2I-22 2I-23 2I-24 2I-25 2I-26 2I-27 2I-28 2Z-29 2I-30 2I-31 2I-32 2I-33 2I-34 2I-35 2I-36 2I-37 A09 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2I-38 2Z-39 2I-40 2I-41 2I-42 2I-43 2I-44 2I-45 2I-46 2I-47 2Z-48 2I-49 2I-50 2I-51 2I-52 2I-53 2I-54 2I-55 2I-56 2I-57 2I-58 2I-59 2I-60 2I-61 2I-62 2I-63 2I-64 2I-65 2Z-66 2Z-67 2I-68 2I-69 2I-70 2I-71 2I-72 2I-73 2Z-74 2I-75 2I-76 2I-77 2I-78 2I-79 2I-80 2I-81 2I-82 2I-83 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO 2I-84 2I-85 2I-86 2I-87 2I-88 2I-89 2I-90 2I-91 2I-92 2I-93 2I-94 2Z-95 2Z-96 2I-97 2I-98 2I-99 2Z-100 2Z-101 2I-102 2I-103 2I-104 2I-105 2Z-106 2I-107 2I-108 2Z-109 2I-110 2I-111 2I-112 2Z-113 2I-114 2I-115 2I-116 2I-117 2I-118 2I-119 2I-120 2I-121 2I-122 2I-123 2I-124 2I-125 2I-126 2I-127 2I-128 2I-129 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-16 October 1992 U ,d'1 b 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 2I-130 2I-131 2I-132 2I-133 2I-134 2I-135 2I-136 2I-137 2I-138 2I-139 2I-140 2I-141 2I-142 2I-143 2I-144 App 2J 2J-i 2J-1 2J-2 2J-3 2J-4 2J-5 2J-6 2J-7 2J-8 2J-9 2J-10 2J-11 2J-12 App 2K 2K-i 2K-ii 2K-iii 2K-iv 2K-v 2K-vi 2K-vii 2K-viii F 2K-1 F 2K-2 F 2K-3 F 2K-4A F 2K-4B F 2K-5A AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F 2K-5B F 2K-6A F 2K-6B F 2K-6C F 2K-7A F 2K-7B F 2K-7C F 2K-8A F 2K-8B F 2K-8C F 2K-9A F 2K-9B F 2K-9C F 2K-10A F 2K-10B F 2K-11A F 2K-11B F 2K-12A F 2K-12B F 2K-12C F 2K-12D F 2K-12E F 2K-12F F 2K-13A F 2K-13B F 2K-13C F 2K-13D F 2K-13E F 2K-13F F 2K-14A F 2K-14B F 2K-14C F 2K-15 F 2K-16A F 2K-16B F 2K-17A F 2K-17B F 2K-17C F 2K-18A F 2K-18B F 2K-18C F 2K-19A F 2K-19B F 2K-19C F 2K-20A F 2K-20B AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2K-20C 2K-21A 2K-21B 2K-21C 2K-22A 2K-22B 2K-22C 2K-23A 2K-23B 2K-23C 2K-24A 2K-24B 2K-24C 2K-24D 2K-24E 2K-24F 2K-25A 2K-25B 2K-25C 2K-25D 2K-25E 2K-25F 2K-26A 2K-26B 2K-26C 2K-26D 2K-26E 2K-26F 2K-27A 2K-27B 2K-27C 2K-27D 2K-27E 2K-27F 2K-28A 2K-28B 2K-28C 2K-28D 2K-28E 2K-28F 2K-29A 2K-29B 2K-29C 2K-29D 2K-29E 2K-29F AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 2-17 October 1992

'

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table Amendment F=FicFure Number Page T=Table F=Picpure Page Amendment T=Table Amendment Number F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 2K-30A 2K-30B 2K-30C 2K-30D 2K-30E 2K-30F 2K-31A 2K-31B 2K-31C 2K-31D 2K-31E 2K-31F 2K-32A 2K-32B 2K-32C 2K-32D 2K-32E 2K-32F 2K-33A 2K-33B 2K-33C 2K-34A 2K-34B 2K-34C 2K-35A 2K-35B 2K-35C 2K-36A 2K-36B 2K-36C 2K-37A 2K-37B 2K-37C 2K-37D 2K-37E 2K-37F 2K-38A 2K-38B 2K-38C 2K-38D 2K-38E 2K-38F 2K-39A 2K-39B 2K-39C 2K-39D AOO AOO AOO AOO AOO AOO ,AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO App 2L.2L-i 2L-ii 2L-iii 2L-1~2L-2 T 2L-1 T 2L-1 T 2L-2 T 2L-2 T 2L-3 T 2L-3 T 2L-4 T 2L-4 T 2L-5 T 2L-5 T 2L-6 T 2L-6 T 2L-7 T 2L-7 S?1 1 Sh 2 Sh 1 S11 2 Sh 1 S?1 2 S?1 1 S11 2 S?1 1 SH 2 S11 1 Sh 2 Sh 1 S11 2 F 2K-39E F 2K-39F F 2K-40A F 2K-40B F 2K-40C F 2K-41A F 2K-41B F 2K-42A F 2K-42B F 2K-43A F 2K-43B F 2K-44A F 2K-44B F 2K-45A F 2K-45B F 2K-45C F 2K-45D F 2K-46A F 2K-46B F 2K-46C F 2K-46D F 2K-47A F 2K-47B F 2K-47C F 2K-47D AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO T T T T T T T T T T T T T T T T T T T T F F AOO A07 A07 AOO A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 AOO T AOO T AOO T 2L 8 Sjl 1 2L-8 SN 2 2L-9 S?1 1 2L-9 S?1 2 2L-10 2L-11 2L-12 2L-13 2L-14 2L-15 2L-16 2L-17 2L-18 2L-19 2L-20 2L-21 2L-22 2L-23 2L-24 2L-25 2L-26 2L-27 2L-28 2L-1 2L-2 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A07 A13 USAR Revision 4 EP 2-18 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FBFure Amendment Number Page T=Table F=FicFure Amendment Number App 2M Table of Contents NRC Site Visit (7 pg)NRC Meeting Field Notebook 76-2 (2 Meeting at Site (4 pg)Affidavit-Douglas E.Isler Affidavit-John J.Markham Affidavit-John H.Peck (2 pg)Figure 1 Figure 2 Figure 3 Figure 4 App 2N 2N-1 2N-2 2N-3/4 2N-5/6 (F 230.3-1)2N-7 2N-8 2N-9 2N-10 2N-11 2N-12 2N-13 2N-14 2N-15 2N-16 2N-17 2N-18 2N-19 2N-20 2N-21 2N-22 2N-23/24 2N-25/26 (F 231.10-1)2N-27/28 2N-29/30 (F 231.11-1)2N-31 2N-32 2N-33 2N-34 pe)A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 2N-35 2N-36 2N-37 2N-38 2N-39 2N-40 2N-41'N-42 2N-43 2N-44 2N-45/46 2N-47/48 (T 2N-49 2N-50 2N-51 2N-52 2N-53 2N-54 2N-55 2N-56 2N-57/58 (T 2N-59/60 (T 2N-61/62 (T 2N-63/64 (T F 241.16-1 F 241.16-2 F 241.16-3 F 241.16-4 F 241.16-5 F 241.16-6 F 241'6-7 F 241.16-8 F 241.16-9 F 241.16-10 F 241.16-11 F 241.16-12 F 241.16-13 F 241.16-14 F 241.16-15 F 241.16-16 F 241.16-17 F 241.16-18 F 241.16-19 F 241.16-20 F 241.16-21 F 241.16-22 241.2-1)241.16-1)241.16-2, 241 16-2, 241.16-2, Sh Sh Sh 1)2)3)ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 2-19 October 1992 I~

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number F 241.16-23 F 241.16-24 F 241.16-25 F 241.16-26a F 241.16-26b F 241.16-27a F 241.16-27b F 241.16-27c F 241.16-28a F 241.16-28b F 241.16-29 F 241.16-30.

F 241.16-31a F 241 16-31b F 241.16-32a F 241.16-32b F 241.16-32c F 241.16-33 F 241'6-34 F 241.16-35 F 241.16-36 F 241.16-37 F 241.16-38 F 241.16-39 F 241.16-40 F 241.16-41 F 241.16-42 F 241.16-43 F 241.16-44 F 241.16-45 F 241.16-46 App 2P 2P-1 2P-2 2P-3 2P-4 2P-5 2P-6 2P-7/8 (T 451.13-1)2P-9/10 (T 451.13-2)2P-11/12 (T 451.13-3)2P-13/14 (T 451.13-4)2P-15 2P-16 2P-17/18 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 2P-19/20 2P-21/22 2P-23/24 2P-25 2P-26 2P-27 2P-28 2P-29 2P-30 2P-31 2P-32 2P-33/34 2P-35/36 2P-37/38 2P-39/40 2P-41/42 2P-43/44 2P-45/46 2P-47/48 2P-49/50 2P-51/52 2P-53/54 2P-55/56 2P-57/58 2P-59/60 2P-61/62 2P-63/64 2P-65/66 App 2Q 2Q-1 2Q-2 2Q-3 2Q-4 2Q-5 2Q-6 2Q-7 2Q-8 0Q-9 2Q-10 2Q-11 2Q-12 2Q-13 2Q-14 2Q-15 2Q-16 (F 451.14-1)(F 451.14-2)(F 451.14-3)(T 451.15-1)(T 451.15-2)(T 451.15-3)(T 451.15-4)'(T 451.15-5, (T 451.15-5, (T 451'5-5, (T 451.15-5, (T 451'5-6, (T 451.15-6, (T 451.15-6, (T 451.15-6, (T 451.15-7, (T 451.15-7, (T 451.15-7, (T 451 15-7, Sh 1)Sh 2)Sh 3)Sh 4)Sh 1)Sh 2)Sh 3)Sh 4)Sh 1)Sh 2)Sh 3)Sh 4)ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO RO,O ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO.ROO ROO ROO ROO USAR Revision 4 EP 2-20 October 1992

~I 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 2 Page T=Table F=FicFFre Page Amendment T=Table Number F=FicFure Amendment Number 2Q-17 2Q-18 2Q-19 2Q-20 2Q-21 2Q-22 T GI-1 ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 2-21 October 1992 I't Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=F icFFre Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 3 i 3-ii 3-iii 3-iV 3-V 3-Vl 3-Vil 3-Vlli 3-ix 3-X 3-Xi 3 Xii 3-xiia 3-xiib 3 Xiii 3-XiV 3-XV 3-XV1 3-XV11 3-XVlll 3-XiX 3-XX 3-XXi 3-XXii 3-XXiii 3-Xxlv 3-xxiva 3-xxivb 3-XXV 3-XXVi 3-XXVii 3-XXViii 3-Xxlx 3-XXX 3 XXXi 3-XXXii 3-xxxiia 3-xxxiib 3-XXXiii 3-xxxiiia 3-xxxiiib 3-XXXiV 3-xxxiva 3-xxxivb 3-XXXV 3-XXXVi AOO AOO AOO A09 A25 ROO R03 AOO ROO R04 A19 A24 A24 A24 R04 A08 ROO ROO R04 A28 A28 R04 A24 A24 ROO A07 A07 A07 AOO R04 A12 A12 A12 A12 A12 A12 A21 A12 ROO A25 A05 A24 A23 A05 ROO A28 3-XXXVli 3-XXXVl il 3-XXXlX 3-xl 3-xla 3-xlb 3-xli 3-xli1 3-xli2 3-xiii 3-Xllll 3-xliv 3-xliva 3-xlivb 3-xlv 3-xlvi 3-xlvii 3-xlviii 3-xlix 3~1 1 3~1 2 3~1 3 3.1-4 3.1-5 3.1-6 3~1 7 3.1-8 3.1-9 3.1-10 3.1-11 3.1-12 3~1 1 3 3\113a 3.1-13b 3.1-14 3.1-15 3.1-16 3~1 1 7 3.1-18 3.1-19 3.1-20 3~1 2 1 3~1 2 2 3.1-23 3.1-24 A24 A24 A24 A24 A12 A12 R02 R02 A21 AOO A24 ROO ROO A18 R04 R04 ROO ROO R04 AOO AOO AOO AOO A18 A12 AOO AOO AOO AOO AOO AOO A28 A19 A19 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A28 3.1-25 3.1-26 3~1 27 3.1-28 3.1-29 3.1-30 3~1 3 1 3~1 32 3~1 33 3.1-34 3.1-35 3.1-36 3~1 37 3.1-38 3.1-39 3.1-40 3.1-41 3.1-42 3.1-43 3.1-44 3.1-45 3.1-46 3.1-47 3.1-48 3.1-49 3.1-50 3.1-51 3.1-52 3.1-53 3.1-54 3.1-55 3.1-56 3.1-57 3.1-58 3.1-59 3.1-60 3.1-61 3.1-62 3.1-63 3.1-64 3'-65 3.1-66 3.1-67 3.1-68 3.1-69 3.1-70 AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 AOO AOO AOO AOO AOO AOO AOO AOO A19 AOO A19 AOO A27 AOO AOO AOO AOO A28 AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-1 October 1992 1

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=F icp ur e Number 3'71 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3~2 1 3~2 1 3.2-1 3~2 1 3~2 1 3~2 1 3 e 2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3.2-1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 1 3~2 2 3~2 3 T 3~2 1 T 3'-1 3~2 1 3 e 2 1 Sh 1 Sh 2 Sh 3 Sh 3a Sh 4 Sh 5 Sh 5a Sh 6 Sh 7 Sh 8 Sh 9 Sh 9a Sh 10 Sh 10a Sh 11 Sh 11a Sh 12 Sh 12a Sh 13 Sh 13a Sh 14 Sh 14a Sh 15 Sh 15a Sh 16 Sh 16a Sh 17 Sh 17a Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 26a Sh 26b Sh 26c Sh 26d AOO A26 A15 A09 A28 R01 A27 A19 ROO A19 A26 A26 A26 A23 A27 A26 ROO R03 A26 A19 ROO ROO R03 ROO A27 A26 A27 R01 R04 ROO ROO ROO AOO A20 A07 AOO ROO A07 R04 R04 R04 R01 ROO R01 ROO T 3.2-1 T 3.2-1 T 3~2 1 T 3~2 1 T 3~2 2 T 3.2-2 T 3~2 3 T 3.2-4 T 3.2-4 F 3.2-1 Sh 26e Sh 26f Sh 26g Sh 26h Sh 1 Sh 2 Sh 1 Sh 2 3 e 3 1 3~3 2 3~3 3 3.3-4 3.3-5 3.3-6 T 3.3-1 3.5-1 3.5-2 3.5-3 3.4-1 3.4-1a 3.4-1b 3.4-2 3.4-2a 3.4-2b 3.4-3 3.4-3a 3.4-3b 3.4-4 3.4-5 3.4-6 T 3.4-1 Sh 1 T 3.4-1 Sh 2 T 3.4-2 Sh 1 T 3.4-2 Sh 2 T 3.4-2 Sh 3 T 3.4-3 T 3.4-4 T 3.4-5 Sh 1 T 3.4-5 Sh 2 T 3.4-6 T 3.4-7 R04 ROO ROO R03 ROO ROO A23 A28 A28 A21 A26 A13 AOO A05 A05 AOO AOO ROO A05 A05 ROO ROO ROO ROO ROO A05 ROO AOO AOO ROO ROO ROO A25 ROO ROO ROO ROO ROO ROO A28 A04 A09 A05 3.5-4 3.5-4a 3.5-4b 3.5-4c 3.5-4d 3.5-5 3.5-5a 3.5-5b 3.5-6 3.5-7 3'-8 3.5-9 3.5-10 3.5-11 3'-12 3.5-13 3.5-14 3.5-15 3.5-15a 3.5-15b 3.5-16 3.5-17 3.5-18 3.5-19 3.5-19a 3.5-19b 3.5-20 3.5-21 3.5-22 T 3.5-1 Sh T 3.5-1 Sh T 3.5-2 T 3.5-3 T 3.5-4 T 3.5-5 T 3.5-6 T 3.5-7 T 3.5-8 T 3.5-9 T 3.5-10 T 3.5-11 T 3.5-12 T 3.5-13 T 3.5-14 T, 3.5-15 T 3.5-16 A27 A27 A27 A27 A26 A27 A27 A27 AOO A08 AOO AOO AOO AOO A01 AOO AOO R04 R04 A14 R04 R04 A21 ROO ROO ROO AOO AOO AOO ROO AOO A26 AOO AOO A28 AOO AOO AOO AOO AOO A28 AOO AOO A28 AOO AOO USAR Revision 4 EP 3-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T 3.5-17 T 3.5-17 T 3.5-17 T 3.5-18 T 3.5-18 T 3.5-18 T 3.5-19 T 3'-20 T 3.5-21 T 3.5-22 T 3.5-22 F 3.5-1 F 3.5-2 F 3.5-3 F 3.5-4 F 3.5-5 3.6A-1 3.6A-2 3.6A-3 3.6A-4 3.6A-5 3.6A-6 3.6A-7 3.6A-S 3.6A-9 3.6A-10 3.6A-10a 3.6A-10b 3.6A-11 3.6A-12 3.6A-12a 3.6A-12b 3.6A-13 3.6A-14 3.6A-14a 3.6A-14b 3.6A-15 3.6A-15a 3.6A-15b 3.6A-16 3.6A-17 3.6A-17a 3.6A-17b 3.6A-18 3.6A-19 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 AOO AOO AOO AOO AOO AOO AOO R04 A25 A24 A24 A04 AOO AOO AOO AOO AOO AOO AOO AOO R03 AOO ROO ROO AOO ROO ROO ROO AOO R03 ROO ROO R03 A12 A12 A12 ROO ROO ROO ROO R03 A12 A12 AOO AOO 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-28a 3.6A-28b 3 6A-29 3.6A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 3.6A-35 3.6A-35a 3.6A-35b 3.6A-36 3.6A-37 3.6A-38 T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-1 Sh T 3.6A-2 T 3.6A-3 T 3.6A-4 T 3.6A-5 T 3.6A-6 T 3.6A-7 T 3.6A-S T 3.6A-9 T 3.6A-10 T 3.6A-11 T 3.6A-12 T 3.6A-13 T 3'A-14 T 3.6A-15 T 3.6A-16 T 3.6A-17 T 3.6A-18 T 3.6A-19 AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO ROO AOO AOO A21 AOO AOO AOO A12 A12 A12 A05 A27 ROO R03 R03 R03 R03 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-29 3.6A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 3.6A-35 3.6A-36 3.6A-37 3.6A-38 3.6A-39 3.6A-40 3.6A-41 3.6A-42 3.6A-43 3.6A-44 3.6A-45 3.6A-46 3.6A-47 3.6A-48 3.6A-49 3.6A-50 3.6A-51 3.6A-52 3.6A-53 3.6A-54 3.6A-55 3.6A-56 3.6A-57 3.6A-58 3.6A-59 3.6A-60 3.6A-61 3.6A-62 3.6A-63 3.6A-64 3.6A-65 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 A28 USAR Revision 4 EP 3-3 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3.6A-66 3.6A-67 3.6A-68 3.6A-69 3.6A-70 3.6A-71 3.6A-72 3'A-72 3.6A-72 3.6A-72 3.6A-73 3.6A-73 3.6A-1 3.6A-2 3.6A-3 3.6A-4 3.6A-5 3.6A-6 3.6A-7 3.6A-8 3.6A-9 3.6A-10 3.6A-11 3.6A-12 3.6A-13 3.6A-14 3.6A-15 3.6A-16 3.6A-17 3.6A-18 3.6A-19 3.6A-20 3.6A-21 3.6A-22 3.6A-23 3.6A-24 3.6A-25 3.6A-26 3.6A-27 3.6A-28 3.6A-29 3'A-30 3.6A-31 3.6A-32 3.6A-33 3.6A-34 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 A28 A28 A28 A28 A28 A28 A21 A21 A21 A21 A21 A21 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 F 3.6A-35 F 3.6A-36 F 3.6A-37 F 3.6A-38 F 3.6A-39 F 3.6A-40 F 3'A-41 F 3.6A-42 F 3.6A-43 F 3.6A-44 F 3.6A-45 F 3.6A-46 F 3.6A-47 F 3.6A-48 F 3.6A-49 F 3.6A-50 F 3.6A-51 F 3.6A-52'3.6A-53 F 3.6A-54 F 3.6A-55 F 3.6A-56 F 3.6A-57 F 3.6A-58 F 3.6A-59 F 3.6A-60 3.6B-1 3.6B-2 3.6B-3 3.6B-4 3.6B-5 3.6B-6 3.6B-7 3.6B-8 3.6B-9 3.6B-9a 3.6B-9b 3.6B-10 3.6B-11 3.6B-12 3.6B-13 3.6B-14 3.6B-15 3.6B-16 3.6B-17 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 A27 ROO ROO A27 ROO R02 R02 R02 ROO R02 AOO AOO A23 R03 R03 A12 AOO A12 A12 A27 A12 A12 AOO AOO AOO AOO AOO AOO AOO 3.6B-18 3.6B-19 3.6B-20 3.6B-21 T 3.6B-1 T 3.6B-2 F 3'B-1 F 3.6B-2 F 3'B-3 3.7A-1 3.7A-2 3.7A-3 3.7A-3a 3.7A-3b 3.7A-4 3.7A-5 3.7A-5a 3.7A-5b 3.7A-6 3.7A-7 3.7A-7a 3.7A-7b 3.7A-8 3.7A-9 3.7A-10 3.7A-11 3.7A-12 3'A-13 3.7A-13a 3.7A-13b 3.7A-14 3.7A-15 3.7A-16 3.7A-17 3.7A-18 3.7A-19 3.7A-20 3.7A-20a 3.7A-20b 3.7A-21 3.7A-22 3.7A-22a 3.7A-22b 3.7A-23 3.7A-23a.AOO AOO AOO A23 AOO A27 A24 AOO AOO A24 A26 A23 A18 A18 AOO A23 A05 A05 A23 A27 A23 A05 A23 A24 AOO ROO AOO A20 A20 A20 AOO AOO AOO AOO AOO A23 R02 ROO A03 A18 ROO ROO ROO A25 A26 USAR Revision 4 EP 3-4 October 1992

~E Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=F i cFur e Number Page T=Table Amendment F=FicFure Number 3.7A-23b 3.7A-24 3.7A-25 3.7A-26 3.7A-27 3.7A-27a 3.7A-27b 3.7A-28 3.7A-28a 3.7A-28b 3.7A-29 3'A-30 3.7A-31 3.7A-32 3.7A-33 3.7A-34 T 3'A-1 T 3.7A-2 T 3'A-2 T 3.7A-3 T 3.7A-4 T 3.7A-5 T 3.7A-5 T 3.7A-6 T 3'A-7 T 3.7A-8 T 3.7A-9 T 3.7A-10 Sh Sh Sh Sh T 3.7A-11 T 3.7A-12 T 3.7A-13 F 3'A-1 F 3.7A-2 F 3.7A-3 F 3.7A-4 F 3.7A-5 F 3.7A-6 F 3.7A-7 F 3.7A-8 F 3.7A-9 F 3.7A-10 F 3.7A-11 F 3.7A-12 F 3.7A-13 F 3'A-14 F 3.7A-15 A25 A03 R02 R02 R02 R02 ROO A05 ROO A05 A26 A26 A26 A27 A26 A12 AOO AOO ROO A22 A22 A22 A22 A22 A22 A22 A22 ROO A25 A25 ROO AOO AOO A26 A26 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 F 3.7A-16 F 3.7A-17 F 3.7A-18 F 3.7A-19 F 3.7A-20 F 3.7A-21 F 3.7A-22 F 3.7A-23 F 3.7A-24 F 3.7A-25 F 3.7A-26 F 3.7A-27 F 3.7A-28 F 3.7A-29 F 3.7A-30 F 3.7A-31 F 3.7A-32 F 3.7A-33 F 3.7A-34 F 3.7A-35 F 3.7A-36 F 3.7A-36 3.7B-1 3.7B-2 3.7B-3 3.7B-4 3.7B-5 3.7B-6 3.7B-7 3.7B-8 3.7B-9 3.7B-10 3.7B-11 3.7B-12 3.7B-13 3.7B-14 3'B-15 3.7B-16 3.7B-17 3.7B-17a 3.7B-17b 3.7B-18-3.7B-19 3.7B-20 3.7B-21 Sh 1 Sh 2 A22 A22 A23 AOO A20 A23 A23 A23 A23 A23 A23 A20 A20 A20 A20 A20 A23 A05 A18 ROO ROO ROO AOO AOO A23 AOO AOO AOO A23 A23 AOO AOO AOO AOO A23 A23 A23 AOO A20 A20 A20 A19 AOO AOO ROO 3.7B-21a 3.7B-2lb 3.7B-22 3.7B-23 3.7B-24 3.7B-25 3.7B-26 3.7B-27 T 3.7B-1 T 3.7B-2 F 3.7B-1 F 3.7B-2 F 3.7B-3 3.8-1 3.8-2 3.8-3 3.8-4 3.8-5 3.8-6 3.8-7 3'-8 3.8-9 3.8-10 3.8-10a 3.8-10b 3.8-11 3.8-12 3.8-13 3.8-14 3.8-15 3.8-16 3.8-17 3.8-17a 3.8-17b 3.8-18 3.8-19 3.8-19a 3.8-19b 3.8-20 3.8-21 3.8-22 3.8-23 3.8-24 3.8-25 3.8-25.1 ROO ROO A23 A23.AOO A25 AOO AOO A23 AOO AOO AOO A19 A23 A18 R04 AOO AOO A18 AOO AOO AOO A19 A03 A03 AOO A20 A20 A26 AOO A20 A03 A03 A03 A22 A18 A03 A03 ROO A19 AOO AOO A26 A24 A24 USAR Revision 4 EP 3-5 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table Amendment F=F icFFr e Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=FicFure Number 3.8-25.2 3.8-25a 3.8-25b 3.8-25ba 3.8-25bb 3.8-25c 3.8-25d 3.8-26 3.8-26a 3.8-26b 3.8-27 3.8-27a 3.8-27b 3.8-28 3.8-29 3.8-30 3.8-31 3.8-32 3.8-33 3.8-34 3.8-35 3.8-36 3.8-37 3.8-38 3.8-39 3.8-40 3.8-41 3.8-42 3.8-43 3.8-43a 3.8-43b 3.8-44 3.8-45 3.8-45a 3.8-45b 3.8-46 3.8-47 3.8-47a 3.8-47b 3.8-48 3.8-49 3.8-50 3.8-51 3.8-51a 3.8-51b 3.8-52 A24 A13 A25 A22 A22 A13 A13 A23 A23 A23 A22 A22 A22 AOO AOO AOO AOO AOO AOO AOO AOO AOO A27 A23 R01 AOO AOO A26 A26 A21 A21 AOO A05 A05 A05 AOO A21 A03 A03 AOO A26 A23 A22 A22 A03 AOO 3.8<<53 3.8-54 3.8-55 3.8-56 3.8-57 3.8-58 3.8-59 3.8-60 3.8-61 3.8-62 3.8-63 3.8-63a 3.8-63b 3.8-64 3.8-65 3.8-65a 3.8-65b 3.8-66 3.8-67 3.8-68 3.8-69 3.8-69a 3.8-69b 3.8-70 3.8-71 3.8-71a 3.8-71b 3.8-72 3.8-73 3.8-73a 3.8-73b 3.8-74 3.8-75 3.8-76 3.8-77 3.8-78 T 3.8-1 Sh 1 T 3.8-1 Sh 2 T 3.8-1 Sh 3 T 3.8-1 Sh 4 T 3.8-1 Sh 5 T 3.8-1 Sh 6 T 3.8-2 Sh 1 T 3.8-2 Sh 2 T 3'.8-3 Sh 1 T 3.8-3 Sh 2 AOO A26 A21 AOO A03 AOO AOO AOO AOO AOO A21 A21 A21 A26 A23 A23 A21 R01 A23 AOO A05 A05 A05 AOO ROO A26 A05 A21 A23 A23 A23 R04 AOO A27 A26 AOO A25 A23 AOO AOO A26 A26 A19 A26 A26 AOO T T-T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F 3.8-3 Sh 3 3.8-3 Sh 4 3.8-3 Sh 5 3.8-4 Sh 1 3.8-4 Sh 2 3.8-4 Sh 3 3.8-4 Sh 4 3.8-5 Sh 1 3.8-5 Sh 2 3.8-6 Sh 1 3.8-6 Sh 2 3.8-7 Sh 1 3.8-7 Sh 2 3.8-8 3.8-9 Sh 1 3.8-9 Sh 2 3.8-10 Sh 1 3.8-10 Sh 2 3.8-10 Sh 3 3.8-11 Sh 1 3.8-11 Sh 2 3.8-11 Sh 3 3.8-12 Sh 1 3.8-12 Sh 2 3.8-12 Sh 3 3.8-12 Sh 3a 3'-12 Sh 4 3.8-13 3.8-14 3.8-15 Sh 1 3.8-15 Sh 2 3.8-1 3.8-2 3.8-3 3.8-3a 3.8-4 3.8-5 3.8-6 3.8-7 3.8-8 3.8-9 3.8-10 3.8-11 3.8-12 3.8-13 3.8-14 AOO AOO A26 A25 A28 A26 A25 A27 A27 A27 A27 R03 A27 A26 A26 AOO A26 R04 A26 A19 A23 A23 AOO A19 A26 A26 A26 A26 A26 A27 A23 AOO AOO AOO R04 AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-6 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=Ficrure Amendment Number Page T=Table F Ficrure Amendment Number Page T=Table Amendment F=Ficrure Number F 3.8-15 F 3.8-16 F 3.8-17 F 3.8-18 F 3.8-18 F 3.8-19 F 3.8-19 F 3~8-20 F 3~8-21 F 3'-22 F 3.8-23 3.9A-1 3.9A-1a 3.9A-1b 3.9A-2 3.9A-2a 3.9A-2b 3.9A-3 3.9A-3a 3.9A-3b 3'A-4 3.9A-4a 3.9A-4b 3.9A-5 3.9A-5a 3.9A-5b 3.9A-6 3.9A-6a 3 9A-6b 3.9A-7 3.9A-7a 3.9A-7b 3.9A-8 3.9A-8a 3.9A-8b 3'A-9 3.9A-9a 3.9A-9b 3.9A-10 3.9A-11 3.9A-11a 3.9A-11b 3.9A-12 3.9A-13 3.9A-13a Sh 1 Sh 2 Sh 1 Sh 2 AOO AOO AOO AOO AOO A16 AOO AOO AOO R04 R04 A26 A26 A26 A23 R03 R03 ROO R02 ROO R02 R02 ROO R02 A19 A19 ROO ROO ROO ROO ROO A28 ROO ROO ROO A27 A20 A20 AOO A27 A27 A27 A12 ROO ROO 3.9A-13b 3.9A-14 3.9A-14a 3.9A-14b 3.9A-15 3.9A-15a 3.9A-15b 3.9A-16 3 9A-17 3.9A-17a 3.9A-17b 3.9A-18 3.9A-19 3.9A-19a 3.9A-19b 3.9A-20 3.9A-20a 3.9A-20b 3.9A-21 3.9A-21a 3.9A-21b 3.9A-22 3.9A-23 3.9A-23a 3.9A-23b 3.9A-24 3.9A-24a 3.9A-24b 3.9A-24c 3.9A-24d 3.9A-25 3.9A-26 3.9A-26a 3.9A-26b 3.9A-26c 3.9A-26d 3'A-27 3.9A-27a 3.9A-27b 3.9A-28 T 3.9A-1 T 3.9A-1 T 3.9A-2 T 3.9A-2 T 3.9A-2 T 3.9A-2 Sh Sh Sh Sh sh Sh ROO R01 ROO ROO ROO ROO ROO ROO ROO A21 A20 A23 A20 A20 A20 A23 A20 A20 A27 A20 A23 A28 R02 ROO A12 ROO ROO ROO ROO A23 A23 ROO A12 A27 R03 A12 ROO ROO ROO R01 ROO ROO A20 A20 ROO ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9A-2 Sh 5 3.9A-2 Sh 6 3.9A-2 Sh 7 3.9A-2 Sh 8 3.9A-3 3.9A-4 Sh 1 3.9A-4 Sh 2 3.9A-4 Sh 3 3.9A-4 Sh 4 3.9A-4 Sh 5 3.9A-4 Sh 6 3.9A-4 Sh 6a 3.9A-4 Sh 6b 3.9A-5 Sh 1 3.9A-5 Sh 2 3.9A-5 Sh 3 3.9A-6 3.9A-7 3.9A-8 Sh 1 3.9A-8 Sh 2 3.9A-9 3.9A-10 Sh 1 3.9A-10 Sh 2 3.9A-10 Sh 3 3.9A-10 Sh 3a 3.9A-11 3.9A-12 Sh 1 3.9A-12 Sh 2 3.9A-12 Sh 3 3.9A-12 Sh 4 3.9A-12 Sh 5 3.9A-12 Sh 6 3.9A-12 Sh 7 3.9A-12 Sh 8 3.9A-12 Sh 9 3.9A-12 Sh 10 3.9A-12 Sh 11 3.9A-12 Sh 12 3.9A-12 Sh 13 3.9A-12 Sh 14 3.9A-12 Sh 15 3.9A-12 Sh 16 3.9A-12 Sh 17 3.9A-12 Sh 18 3.9A-12 Sh 19 3.9A-12 Sh 20 ROO ROO A20 A'2 0 AOO A27 A27 A27 A18 A27 A27 A28 A27 AOO A27 AOO AOO AOO AOO A12 R03 ROO R03 ROO ROO A18 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R03 ROO R01 R03 R03 R03 USAR Revision 4 EP 3-7 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 3 PAGES Page T=Table F=FicFure Amendment Number Page T=Table Amendment F FBFure Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3.9A-12 3.9A-13 3.9A-13 3.9A-13 3.9A-14 3.9A-15 3.9A-15 3.9A-15 3.9A-16 3.9A-16 3.9A-1 3.9A-2 3.9A-3 3.9A-4 3.9A-5 3.9A-6 3.9A-7 3.9A-8 3.9A-9 3.9A-10 3.9A-11 3.9A-12 3.9A-13 3.9A-14 3.9A-15 3.9A-16 3.9A-17 3.9A-18 3.9A-19 3.9A-20 3.9A-21 3.9A-22 3.9A-23 3.9A-24 3.9A-25 3.9A-26 3.9A-27 3.9A-28 3.9A-29 3.9A-30 3.9A-31 3.9A-32 3.9A-33 3.9A-34 3.9A-35 3.9A-36 Sh 21 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 2a Sh 1 Sh 2 R03 A12 A12 A12 R02 A26 A26 A26 ROO ROO A08 A12 A12 A12 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO F 3.9A-37 F 3.9A-38 F 3.9A-39 F 3.9A-40 F 3.9A-41 F 3.9A-42 F 3'A-43 F 3.9A-44 F 3.9A-45 F 3.9A-46 F 3.9A-47 F 3.9A-48 F 3.9A-49 F 3.9A-50 F 3.9A-51 F 3.9A-52 F 3'A-53 F 3.9A-54 F 3.9A-55 F 3.9A-56 F 3.9A-57 F 3.9A-58 F 3.9A-59 F 3.9A-60 F 3.9A-61 F 3.9A-62 F 3.9A-63 F 3.9A-64 F 3.9A-65 F 3.9A-66 F 3.9A-67 3.9B-1 3.9B-2 3.9B-3 3.9B-4 3.9B-4a 3.9B-4b 3.9B-5 3.9B-6 3'B-7 3.9B-8 3.9B-9 3.9B-10 3.9B-11 3.9B-12 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO AOO AOO A28 A28 A28 AOO AOO AOO ROO ROO ROO AOO AOO 3.9B-13 3.9B-14 3.9B-15 3.9B-16 3.9B-16a 3.9B-16b 3.9B-17 3.9B-18 3.9B-19 3.9B-20 3.9B-21 3.9B-21a 3.9B-21b 3.9B-22 3.9B-23 3.9B-24 3.9B-25 3.9B-26 3.9B-26a 3.9B-26b 3.9B-27 3.9B-28 3.9B-29 3.9B-30 3.9B-31 3.9B-32 3.9B-32a 3.9B-32b 3.9B-33 3.9B-34 3.9B-34a 3.9B-34b 3.9B-35 3.9B-36 3.9B-37 3.9B-38 3.9B-39 3.9B-40 3.9B-41 3.9B-42 3.9B-43 3.9B-44 3.9B-45 3.9B-46 3.9B-47 3.9B-47a R01 AOO R03 A27 A27 A27 AOO A24 A26 A26 A12 A28 A12 A20 AOO A13 AOO A13 ROO A13 A13 AOO AOO AOO A26 R03 A07 A07 ROO A28 A28 A28 AOO A20 A20 AOO AOO AOO AOO AOO AOO AOO A28 AOO A20 A20 USAR Revision 4 EP 3-8 October 1992 d<\+

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficrure Number 3.9B-47b 3.9B-48 3.9B-49 3.9B-49a 3.9B-49b 3.9B-50 3.9B-50a 3.9B-50b 3.9B-51 3.9B-52 3.9B-52a 3.9B-52b 3.9B-53 3.9B-54 3.9B-55 3.9B-56 3.9B-56a 3.9B-56b 3.9B-57 3.9B-58 3.9B-59 3.9B-60 3.9B-61 3.9B-62 3.9B-63 3.9B-63a 3.9B-63b 3.9B-64 3.9B-65 3.9B-66 3.9B-67 3.9B-68 3.9B-69 3.9B-70 3.9B-71 3.9B-72 3.9B-73 T 3.9B-1 Sh 1 T 3.9B-1 Sh 2 T 3'B-2 Sh 1 T 3.9B-2 Sh 2 T 3.9B-2 Sh 3 T 3.9B-2 Sh 4 T 3.9B-2 Sh 5 T 3.9B-2a Sh 1 T 3.9B-2a Sh 2 A20 AOO A20 A28 A20 A28 A28 A28 AOO ROO ROO ROO AOO AOO ROO A12 A12 A12 AOO A26 AOO R04 AOO A26 A12 A12 A12 AOO AOO A26 AOO AOO AOO AOO AOO AOO A28 A28 A19 AOO A28 AOO AOO A12 A22 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9B-2a 3.9B-2b 3.9B-2c 3.9B-2d 3.9B-2e 3.9B-2f 3.9B-2f 3.9B-2f 3.9B-2f 3.9B-2g 3.9B-2h 3.9B-2h 3.9B-2h 3.9B-2h 3.9B-2i 3.9B-2i 3.9B-2i 3.9B-2i 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2j 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2k 3.9B-2L 3.9B-2L 3.9B-2m 3.9B-2m 3.9B-2n 3.9B-2n 3.9B-2n 3.9B-2o 3.9B-2p 3.9B-2q 3.9B-2r 3.9B-2r 3.9B-2r 3.9B-2r Sh 3 Sh 1 Sh 2 Sh.3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 4 A23 A28 A22 A22 A22 A22 A22 A26 A24 A22 A22 A22 A26 A22 A22 A22 A22 A22 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 AOO AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO Sh 8 AOO Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 AOO AOO A28 A28 A28 A26 ROO A20 AOO A28 A20 A26 A20 A26 Sh 1 ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 3.9B-2s Sh 1 3.9B-2s Sh 2 3 9B-2t Sh 1 3.9B-2t Sh 2 3.9B-2t Sh 3 3.9B-2Q Sh 1 3.9B-2u Sh 2 3.9B-2u Sh 3 3.9B-2v Sh 1 3.9B-2v Sh 2 3.9B-2v Sh 3 3.9B-2v Sh 4 3.9B-2w Sh 1 3.9B-2w Sh 2 3.9B-2x Sh 1 3.9B-2x Sh 2 3.9B-2x Sh 3 3.9B-2x Sh 4 3.9B-2y Sh 1 3.9B-2y Sh 2 3.9B-2z Sh 1 3.9B-2z Sh 2 3.9B-2z Sh 3 3.9B-3 Sh 1 3.9B-3 Sh 2 3.9B-3 Sh 3 3.9B-3 Sh 4 3.9B-4 Sh 1 3.9B-4 Sh 1a 3.9B-4 Sh 2 3.9B-5 3.9B-6 Sh 1 3.9B-6 Sh 2 3.9B-6 Sh 3 3.9B-7 3.9B-8 3.9B-9 Sh 1 3.9B-9 Sh 2 3.9B-9 Sh 3 3.9B-9 Sh 4 3.9B-10 Sh 1 3.9B-10 Sh 2 3.9B-10 Sh 3 3.9B-11 Sh 1 3.9B-11 Sh 2 3.9B-11 Sh 3 A26 A27 A26 A26 A26 A23 A23 R03 AOO A28 R03 A24 AOO A28 A26 A24 A26 A24 A20 A20 A28 A28 A28 AOO AOO AOO AOO A28 A28 A25 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 3-9 October 1992 R I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=F icture Number Page T=Table Amendment F=FicFure Number F 3.9B-1 F 3.9B-2 F 3.9B-3 F 3.9B-4 F 3.9B-5 3.10A-1 3.10A-1a 3.10A-1b 3.10A-2 3.10A-3 3.10A-3a 3.10A-3b 3.10A-4 3.10A-5 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 T 3.10A-1 3.10B-1 3.10B-2 3.10B-2a 3.10B-2b 3.10B-3 3.10B-3a 3.10B-3b 3.10B-4 3.10B-5 Sh 1 Sh 2.Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 R04 A26 AOO AOO AOO A20 A20 A20 AOO A20 A20 A20 AOO A27 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 R03 R03 A26 A26 A26 A26 A26 A26 A26 A22 A22 A22 A22 A22 A22 A22 A22 A22 3.10B-5a 3.10B-5b 3.10B-6 3.10B-7 T 3.10B-1 Sh 1 T 3.10B-1 Sh 2 T 3.10B-1 Sh 3 T 3.10B-1 Sh 4 T 3.10B-1 Sh 5 T 3.10B-2 F 3.10B-1 F 3.10B-2 F 3.10B-3 F 3.10B-4 3.11-1 3.11-1a 3.11-1b 3'1-2 3~1 1 3 3 e 1 1 3a 3.11-3b 3.11-4 3.11-5 3.11-6 3~1 1 7 App 3A 3A-i 3A-ii 3A-iii 3A-iv 3A-iva 3A-ivb 3A-v 3A-vi 3A-vii 3A-viii 3A-ix 3A-x 3A-1 3A-2 3A.1-1 3A.1-2 3A.1-3 T 3A.1-1 A22 A22 A22 A22 A20 A20 A20 A20 A20 A22 A22 A22 A22 A22 ROO ROO A19 ROO A19 A19 A07 R01 A19 ROO R01 AOO R03 R02 R02 R02 R02 R02 A27 A19 A23 A27 A05 A27 A09 A23 AOO AOO AOO A23 F 3A.1-1 3A.2-1 3A.2-2 3A.2-3 3A.2-4 F 3A.2-1 F 3A.2-2 3A.3-1 3A.3-2 3A.3-3 3A.3-4 3A.3-5 T 3A.3-1 F 3A.3-1 F 3A.3-2 3A.4-1 3A.4-2 F 3A.4-1 F 3A.4-2 F 3A.4-3 F 3A.4-4 3A.5-1 3A.5-1a 3A.5-1b 3A.5-2 3A.6-1 3A.6-2 F 3A.6-1 F 3A.6-2 3A.7-1 T 3A.7-1 F 3A.7-1 F 3A.7-2 3A.8-1 3A.8-2 3A.8-3 3A.9-1 3A.9-2 3A.9-3 3A.9-4 3A.9-5 3A.9-6 F 3A.9-1 F 3A.9-2 F 3A.9-3 F 3A.9-4~AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R03 R03 R03 AOO AOO AOO AOO AOO A25 A25 A25 A25 AOO AOO AOO A27 A27 A27 A27 AOO A27 AOO AOO AOO AOO USAR Revision 4 EP 3-10 October 1992 4-J Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES.CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 3A.9-5 F 3A.9-6 F 3A.9-7 3A.10-1 3A.10-2 3A.10-3 T 3A.10-1 F 3A.10-1 F 3A.10-2 F 3A.10-3 F 3A.10-4 3A.11-1 3A.12-1 3A.12-2 T 3A.12-1 Sh 1 T 3A.12-1 Sh 2 F 3A.12-1 3A.13-1 3A.13-2 T 3A.13-1 T 3A.13-2 F 3A.13-1 F 3A.13-2 3A.14-1 3A.14-2 3A.14-3 T 3A.14-1 F 3A.14-1 F 3A.14-2 3A.15-1 3A.15-2 T 3A.15-1 T 3A.15-2 T 3A.15-3 T 3A.15-4 T 3A.15-5 T 3A.15-6 T 3A.15-7 T 3A.15-8 T 3A.15-9 T 3A.15-10 F 3A.15-1 F 3A.15-2 F 3A.15-3 3A.15A-1 3A.15A-2 AOO AOO AOO A27 A27 A27 A27 AOO AOO AOO A27 AOO AOO AOO A26 A26 ROO A03 AOO'03 A03 ROO A03 AOO AOO AOO AOO AOO AOO R02 R02 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R02 R02 3A.16-1 3A.16-2 T 3A.16-1 T 3A.16-2 T 3A.16-3 T 3A.16-4 T 3A.16-5 3A.17-1 3A.17-2 3A.17-3 T 3A.17-1 T 3A.17-2 T 3A.17-3 T 3A.17-4 T 3A.17-5 3A.18-1 3A.18-1a 3A.18-1b 3A.18-2 T 3A.18-1 F 3A.18-1 F 3A.18-2 3A.19-1 F 3A.19-1 F 3A.19-2 3A.20-1 3A.20-2 T 3A.20-1 F 3A.20-1 F 3A.20-2 F 3A.20-3 F 3A.20-4 F 3A.20-5 3A.21-1 3A.21-2 T 3A.21-1 T 3A.21-2 F 3A.21-1 F 3A.21-2 F 3A.21-3 F 3A.21-4 3A.22-1 3A.22-2 T 3A.22-1 T 3A.22-2 F 3A.22-1 A19 A19 A19 A19 A19 A19 A19 AOO AOO AOO AOO AOO AOO AOO AOO A23 A25 A05 A05 A05 A05 A05 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A05 AOO AOO AOO A27 3A.23-1 3A.23-2 T 3A.23-1 Sh 1 T 3A.23-1 Sh 2 3A.24-1 3A.24-2 T 3A.24-1 T 3A.24-2 F 3A.24-1 F 3A.24-2 F 3A.24-3 3A.25-1 3A.26-1 3A.26-2 T 3A.26-1 F 3A.26-1 F 3A.26-2 3A.27-1 3A.27-2 T 3A.27-1 3A.28-1 3A.28-2 3A.28-3 3A.29-1 3A.30-1 3A.30-2 3A.31-1 3A.31-2 3A.32-1 3A.33-1 3A.33-2 T 3A.33-1 T 3A.33-2 App 3B 3B-i 3B-ii 3B-iii 3B-iv 3B-v 3B-vi 3B-1 3B-2 3B-3 3B-4 3B-5 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A04 AOO AOO AOO A03 A03 AOO AOO AOO AOO AOO AOO A04 A09 A09 A09 A09 A23 A23 A23 A23 A23 AOO ROO R02 AOO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 3-11 October 1992

~, lt' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number 3B-6 3B-7 3B-8 3B-9 3B-10 3B-11 3B-12 T 3B-1 Sh 1 T 3B-1 Sh 2 T 3B-1 Sh 3 T 3B-2 T 3B-3 Sh 1 T 3B-3 Sh 2 T 3B-3 Sh 3 T 3B3 Sh 4 T 3B-3 Sh 5 T 3B-3 Sh 6 T 3B-3 Sh 7 T 3B-4 Sh 1 T 3B-4 Sh 2 T 3B-5 Sh 1 T 3B-5 Sh 2 T 3B-5 Sh 3 T 3B-5 Sh 4 T 3B-5 Sh 5 T 3B-5 Sh 5a T 3B-6 Sh 1 T 3B-6 Sh 2 T 3B-6 Sh 3 T 3B-6 Sh 4 T 3B-6 Sh 5 T 3B-6 Sh 6 T 3B-7 T 3B-8 T 3B-9 T 3B-10 T 3B-11 T 3B-12 T 3B-13 T 3B-14 T 3B-15 T 3B-16 T 3B-17 T 3B-18 F 3B-1 Sh 1 F 3B-1 Sh 2 ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R03 R03 R02 ROO R02 R02 R02 R02 R02 ROO R02 R02 R02 R02 R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R01 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 3B-1 Sh 3 3B-1 Sh 4 3B-1 Sh 5 3B-2 Sh 1 3B-2 Sh 2 3B-2 Sh 3 3B-2 Sh 4 3B-2 Sh 5 3B-3 3B-4 3B-5 3B-6 3B-7 3B-8 3B-9 3B-10 3B-11 3B-12 3B-13 3B-14 3B-15 3B-16 3B-17 3B-18 3B-19 3B-20 3B-21 3B-22 3B-23 3B-24 3B-25 3B-26 3B-27 3B-28 3B-29 3B-30 3B-31 3B-32 3B-33 3B-34 3B-35 3B-36 3B-37 3B-38 3B-39 3B-40 ROO ROO ROO ROO R01 R02 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO F 3B-41 F 3B-42 F 3B-43 F 3B-44 F 3B-45 F 3B-46 F 3B-47 F 3B-48 F 3B-49 F 3B-50 F 3B-51 F 3B-52 F 3B-53 F 3B-54 F 3B-55 F 3B-56 App 3C 3C-i 3C-ii 3C-1 3C-2 3C-3 3C-4 3C-5 3C-6 3C-7 3C-8 3C-9 3C-10 3C-11 3C-11a 3C-11b 3C-12 3C-13 3C-14 3C-15 3C-16 3C-17 3C-18 3C-19 3C-20 3C-21 3C-22 3C-23 3C-24 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO AOO R03 A26 AOO R03 ROO R03 R03 R03 R03 R03 R03 R03 A28 R03 A18 R03 R03 A28 A12 A12 A12 A12 A12 A28 A12 ROO A13 A27 USAR Revision 4 EP 3-12 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 3 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 3C-25 3C-26 3C-26a 3C-26b 3C-27 3C-27a 3C-27b 3C-28 3C-29 3C-30 3C-30a 3C-30b 3C-31 3C-32 3C-33 3C-34 F 3C.3-1 F 3C.3-2 F 3C.3-3 T 3C.4-1 T 3C.4-2 T 3C.4-3 T 3C.4-4 T 3C.4-5 T 3C.4-6 T 3C.5-1 T 3C.5-2 Sh T 3C.5-2 Sh App 3D 3D-1 3D-2 3D-3 3D-4 3D-5 3D-6 3D-7 3D-8 3D-9 3D-10 3D-11 3D-12 3D-13 3D-14 3D-15 3D-16 ROO A27 A27 A27 A27 ROO A27 A27 A13 A27 A27 A27 A13 A27 ROO A27 A12 A12 A12 A27 A27 A27 A27 A18 A13 A27 A26 A13 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO 3D-17 3D-18 3D-19 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 T 3D-1 App 3E 3E-1 3E-2 3E-3 3E-4 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 3-13 October 1992 n~

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 4 PAGES Page T=Table Amendment F=Picpure Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=FicFure Number 4-i 4-11 4-iii 4-iiia 4-iiib 4-1v 4-v 4-vi 4-vii 4-viii 4.1-1 4.1-2 4.1-3 4.1-4 4.1-5 4.1-6 4.1-7 4.1-8 4.1-9 4.1-10 4.1-11 4'-12 4.1-13 4'-14 4.1-15 4'-16 4.2-1 4.2-2 4'-1 4.3-2 4.3-3 4.3-4 T 4.3-1 T 4.3-2 T 4.3-3 F 4.3-1 F 4.3-2 4'-1 4'-2 4.4-2a 4.4-2b 4.4-3 A07 A24 A16 A16 A16 AOO R04 R03 R03 A09 R04 R03 AOO AOO A27 A19 A19 AOO A19 A19 A19 A19 AOO A19 A19 AOO R03 A14 R03 AOO A19 AOO AOO AOO AOO AOO A19 R03 R03 R01 A07 A19 4~4-4 4.4-5 4.4-6 4.4-7 4.4-8 4.4-9 4.4-9a 4.4-9b 4.4-9c 4.4-9d 4.4-10 4.4-11 T 4.4-1 S?1 1 T 4.4-1 Sh 2 T 4.4-2 T 4.4-3 T 4.4-4 T 4.4-5 T 4.4-6 T 4.4-7 T 4.4-8 T 4'-9 F 4.4-1 F 4.4-2 F 4'-3 F 4.4-4 F 4.4-5 F 4.4-6 F 4.4-7 F 4.4-8 F 4.4-9 F 4.4-10 4.5-1 4.5-2 4.5-3 4.5-4 4.5-5 4.5-6 4.5-6a 4.5-6b 4.5-7 4.5-8 4.5-9 4.5-10 R03 R03 A19 AOO R03 R03 R03 R03 A17 R03 A09 A07 R03 R03 A19 A19 AOO A19 A24 A19 A23 R03 AOO AOO AOO AOO AOO A16 R03 R03 R03 R03 A19 AOO A27 AOO A27 A19 A19 A19 AOO A27 AOO AOO 4.6-1 4.6-2 4.6-3 4.6-4 4.6-5 4.6-6 4.6-7 4.6-8 4.6-8a 4.6-8b 4.6-9 4.6-10 4.6-11 4.6-12 4.6-12a 4.6-12b 4.6-12c 4.6-12d 4.6-12e 4.6-12f 4.6-12g 4.6-1211 4.6-12i 4.6-12j 4.6-13 4.6-14 4.6-15 4.6-16 4.6-17 4.6-18 4.6-19 4.6-20 4.6-21 4.6-22 4.6-23 4.6-24 4.6-25 4.6-26 4.6-27 4.6-28 4'-29 4.6-30 4.6-31 4.6-32 4.6-33 4.6-34 AOO AOO A27 AOO AOO AOO AOO A05 A23 A05 A19 AOO AOO A05 A05 A05 A05 A05 A05 A05 A25 A07 R03 A07 AOO AOO AOO A26 AOO A26 A19 AOO R03 AOO AOO AOO AOO AOO AOO A19 AOO AOO AOO AOO AOO A19 USAR Revision 4 EP 4-1 October 1992 I~+4A Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 4 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 4.6-35 4.6-36 4.6-37 4.6-38 F 4.6-1 F 4.6-2 F 4.6-3 F 4.6-4 F 4.6-5a F 4'-5b F 4.6-5c F 4.6-6 F 4.6-7 S11 F 4.6-7 S11 F 4.6-7 S11 F 4.,6-8 F 4.6-9 A25 R04 AOO A05 AOO AOO A19 AOO R03 R03 R01 AOO 1 A23 2 A23 3 A23 AOO AOO App 4A 4A-1 4A-2 ROO R01 ROO USAR Revision 4 EP 4-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 5 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number 5-i 5-ii 5-iii 5-iv 5-v 5-vi 5-vii 5-viii 5-ix 5-ixa 5-ixb 5-x 5-xa 5-xb 5-xi 5.1-1 5.1-2 5.1-3 5.1-4 F 5.1-1a F 5.1-1b F 5.1-2a F 5'-2b F 5.1-2c 5.2-1 5.2-2 5.2-3 5.2-4 5.2-4a 5.2-4b 5.2-5 5.2-5a 5.2-5b 5.2-6 5.2-7 5.2-8 5.2-8a 5'-8b 5.2-9 5.2-9a 5.2-9b 5.2-10 5.2-10a 5-2-10b A07 R04 A24 R03 A24 R04 A24 R04 R03 R03 R03.R03 R02 A07 A24 AOO AOO A19 AOO A24 A19 R04 R03 R03 A15 R03 R03 A24 R03 A07 R03 R03 ROO ROO AOO A07 A19 A07 A13 A06 A06 A23 A07 A07 5'-11 5.2-12 5.2-12a 5'-12b 5.2-12c 5'-12d 5.2-13 5 2-14 5 2-15 5'-16 5 2-17 5 2-18 5.2-19 5'-20 5.2-21 5.2-21a 5'-21b 5.2-22 5.2-23 5.2-24 5.2-25 5.2-26 5'-27 5'-28 5.2-28a 5'-28b 5'-29 5'-30 5.2-31 5.2-32 5.2-32a 5-2-32b 5'-33 5.2-33a 5.2-33b 5.2-34 5-2-35 5'-36 5 2-37 5.2-37a 5.2-37b 5'-38 5.2-39 5.2-40 5.2-41 5.2-42 ROO A07'24 A24 R03 A07 AOO AOO AOO AOO R04 AOO ROO A05 A19~R01 A05 AOO AOO AOO AOO AOO AOO R01 A22 A11 R02 R02 R02 A23 A23 A05 R03 R03 A05 ROO ROO ROO A23 ROO A23 A10 ROO R01 AOO AOO 5.2-43 5.2-44 5.2-45 5.2-45a 5.2-45b 5.2-46 T 5.2-1 Sh T T T 5.2-1 5.2-1 5.2-1 Sh Sh Sh 5.2-1 Sh T T T T T 5.2-1 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh Sh T T T T 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh 5.2-1 5.2-1 Sh Sh T T T T 5.2-1 5.2-1 5.2-1 5.2-1 Sh Sh Sh Sh 5.2-2 T 5.2-3 T 5.2-4 T 5.2-5 Sh T T T T T T 5.2>>5 5.2-5 5.2-5 5.2-5 5.2-5 5.2-5 Sh Sh Sh Sh Sh Sh 5.2-6 5.2-7 T T T 5.2-8 5.2-9 5.2-10 F F F F F 5.2-1 5.2-2 5.2-3 5.2-4 5.2-4 Sh Sh 1 2 3 3a 3b 5 5a 6 6a 6b 6b1 6ba 7 8 8a 8a1 8b 8c 8d 1 2 3 3a 4 5 6 1 2 AOO R01 A05 A05 A05 ROO ROO A23 ROO A23 R02 A21 A25 ROO A28 A23 A28 A21 A19 A11 A19 A21 ROO A26 A28 A28 R03 R03 R03 A24 A23 A28 A28 R01 A24 A23 A23 R04 R02 ROO ROO R03 AOO AOO A23 R03 USAR Revision 4 EP 5-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 5 Page T=Table F=FicFure Amendment Number Page T=Table Amendment g~Fi ure Number Page T=Table Amendment~F~q~ure Number F 5'-5 F 5.2-5a F 5.2-6 F 5.2-7 F 5.2-8 F 5.2-9 5.3-1 5.3-2 5'-3 5.3-4 5.3-5 5.3-6 5.3-7 5.3-7a 5.3-7b 5.3-8 5.3-9 5.3-10 5.3-11 5.3-11a 5.3-11b 5.3-12 5.3-13 5.3-14 5.3-15 5.3-16 5.3-17 5.3-18 5.3-19 5.3-20 5'-21 5.3-22 T 5.3-1 S11 1 T 5.3-1 S?1 2 T 5.3-2a T 5.3-2b F 5.3-1 F 5.3-2 F 5.3-2a F 5.3-2b F 5.3-2c F 5'-2d F 5.3-2e F 5.3-3 F 5.3-4 AOO A07 AOO AOO AOO AOO A24 A23 A24 All A24 R03 R03 A24 A24 AOO All R02 R03 R03 R03 R03 AOO All A24 AOO ROO A24 A23 A24 A27 AOO AOO AOO R03 R03 AOO A24 R03 R03 R03 R03 R03 R03 AOO F 5.3-5 5.4-1 5.4-2 5.4-3 5.4-4 5.4-4a 5.4-4b 5.4-5 5.4-5a 5.4-5b 5.4-6 5.4-7 5.4-8 5.4-9 5.4-9a 5.4-9b 5.4-10 5.4-11 5.4-12 5.4-13 5'-14 5.4-15 5.4-16 5.4-17 5.4-17a 5.4-17b 5.4-18 5'-19 5.4-20 5.4-21 5.4-21a 5.4-21b 5.4-22 5.4-23 5.4-23a 5.4-23b 5.4-24 5.4-25 5.4-26 5.4-27 5.4-28 5.4-28a 5.4-28b 5.4-29 5.4-30 A24 ROO A24 A24 A23 A23 A23 A24 A24 A24 A24 A24 A24 Rol A28 A28 Rol Rol A28 ROO A28 A28 ROO R02 ROO ROO AOO Rol AOO A05 A24 A07 A24 ROO ROO ROO A09 A24 A24 A27 A05 A24 A05 A24 A24 5'-31 5.4-32 5.4-33 5'-34 5'-34a 5'-34b 5.4-34c 5.4-34d 5.4-35 5.4-36 5.4-37 5.4-37a 5.4-37b 5.4-38 5.4-38a 5.4-38b 5'-39 5.4-40 5.4-41 5.4-42 5.4-42a 5.4-42b 5.4-43 5.4-43a 5.4-43b 5.4-44 5'-45 5.4-45a 5.4-45b 5.4-46 5.4-47 5.4-48 5.4-49 5.4-50 5.4-50a 5'-50b 5.4-51 5.4-51a 5.4-51b 5.4-52 5.4-53 5.4-54 T 5'-1 T 5.4-1 T 5.4-1 T 5'-2 S11 1 S11 2 Sh 3.A24 A24 A24 R03 A28 A28 A28 A28 AOO ROO R04 R03 A13 R04 R04 A13 ROO A05 A27 A05 ROO A05 Rol Alo A05 AOO ROO A05 A05 ROO ROO ROO A24 ROO ROO ROO Rol A13 A13 AOO AOO A28 A24 A24 AOO A28 USAR Revision 4 EP 5-2 October 1992

Nine Mile Point Unit 2 FSAR LIST'OF EFFECTIVE PAGES CHAPTER 5 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=F icF ure Number F=FicFure Number T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 5.4-3 5.4-1 5.4-2a 5.4-2b 5.4-2c 5.4-2d 5.4-3 5.4-4 5.4-5 5.4-6 5.4-7 5.4-8 5.4-9a 5.4-9b 5.4-9c 5.4-9d 5.4-10 S11 1 5'-10 S?1 2 5.4-10a 5.4-10b 5.4-11 5.4-12 5.4-13a 5.4-13b 5.4-13c 5 4-13d 5.4-13e 5'-13f 5.4-13g 5.4-14 Sh 1 5.4-14 Sh 2 5.4-14 S?1 3 5'-15 5.4-16a 5.4-16b 5.4-16c 5.4-16d 5.4-16e 5.4-16f 5.4-17 Sh 1 5.4-17 Sh 2 5.4-17 S?1 3 5.4-18 5.4-19 AOO AOO ROO R03 R03 R04 AOO AOO AOO AOO A28 A28 ROO R01 ROO R01 A23 A23 A24 A07 AOO AOO ROO ROO ROO R03 R03 ROO R03 A23 A23 R03 AOO R04 ROO R04 R04 R04 R04 R02 A23 AOO ROO A23 SA-i 5A-1 5A-2 5A-2a 5A-2b 5A-3 T 5A-1 Sh 1 T 5A-1 Sb 2.T 5A-2 Sh 1 T 5A-2 S11 2 T 5A-3a T 5A-3b T 5A-4 F 5.A-1 F 5.A-2'tt 5A-1 App 5B 5B-1 5B-2 5B-3 A24 R03 R03 R03 A28 R03 AOO AOO AOO AOO R03 R03 AOO AOO AOO AOO ROO ROO ROO R03 App 5A USAR Revision 4 AOO EP 5-3 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=Ficture Amendment Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F F=icFure Number 6-i 6-ii 6-iii 6-iv 6-v 6-vi 6-vii 6-viii 6-1x 6-x 6-xa 6-xb 6-xi 6-xii 6-xiii 6 x1v 6-xiva 6-xivb 6-xv 6-xvi 6-xvii 6-xviii 6-xix 6-xixa 6-xixb 6-xx 6-xxi 6-xxii 6-xxiia 6-xxiib 6-xxiii 6'-l 6.1-2 6.1-3 6'-4 6.1-4a 6.1-4b 6.1-5 6.1-6 T 6.1-1 T 6.1-1 T 6'-2 T 6.1-2 T 6.1-3 S11 1 Sh 2 Sb 1 Sh 2 R04 R03 A24 R03 R04 ROO ROO A24 A24 ROO ROO A11 ROO A24 A24 A24 A24 A17 A15 R02 A24 A27 R03 R04 R04 A24 A24 A24 A24 A24 R04 A27 A27 R02 R04 A03 A03 A28 A28 A27 A28 ROO ROO R04 6.2-1 6.2-2 6.2-2a 6.2-2b 6.2-3 6.2-4 6.2-5 6.2-6'6.2-6a 6.2-6b 6.2-7 6.2-8 6.2-9 6.2-10 6.2-11 6.2-12 6.2-13 6.2-14 6.2-15 6.2-15a 6.2-15b 6.2-16 6.2-17 6.2-18 6.2-19 6.2-20 6.2-21 6.2-22 6.2-23 6.2-24 6.2-24a 6.2-24b 6.2-24c 6.2-24d 6.2-25 6.2-25a 6.2-25b 6.2-26 6.2-27 6.2-28 6.2-29 6.2-30 6.2-30a 6.2-30b 6.2-31 6.2-32 AOO A07 ROO A07 AOO AOO A23 ROO A23 ROO R03 ROO A23 AOO ROO AOO AOO AOO ROO ROO ROO ROO AOO ROO AOO AOO AOO AOO ROO A20 A18 ROO ROO A17 ROO ROO ROO ROO A05 A05 AOO AOO All A11 AOO AOO 6.2-33 6.2-33a 6.2-33b 6.2-34 6.2-35 6.2-35a 6 2-35b 6.2-36 6.2-37 6.2-37a 6.2-37b 6.2-38 6.2-39 6.2-40 6.2-41 6.2-42 6.2-43 6.2-43a 6.2-43b 6.2-44 6.2-45 6.2-46 6.2-46a 6.2-46b 6.2-47 6.2-47a 6.2-47b 6.2-48 6.2-49 6.2-50 6.2-51 6.2-51a 6.2-51b 6.2-52 6.2-53 6.2-53a 6.2-53b 6.2-54 6.2-54a 6.2-54b 6.2-55 6.2-55a 6.2-55b 6.2-55c 6.2-55d 6.2-56 ROO ROO ROO A11 A23 A05 A05 ROO A23 ROO ROO R02 R03 R03 R04 R03 R03 R01 ROO A15 ROO ROO R04 R04 R04 A05 A05 A15 ROO ROO A27 A25 A13 A27 R01 A08 A08 ROO ROO A27 A21 A27 R01 ROO ROO A18 USAR Revision 4 EP 6-1 October 1992

.t Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 6 PAGES Page T=Table F Ficrure Amendment Number Page T=Table.F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 6 2-57 6.2-57a 6.2-57b 6.2-57c 6.2-57d 6.2-57e 6.2-57f 6.2-58 6.2-59 6.2-.59a 6.2-59b 6.2-60 6.2-60a 6.2-60b 6.2-61 6.2-61a 6.2-61b 6.2-62 6.2-62a 6.2-62b 6.2-63 6.2-63a 6.2-63b 6.2-64 6.2-65 6.2-65a 6.2-65b 6.2-66 6.2-67 6.2-67a 6.2-67b 6.2-68 6.2-68a 6.2-68b 6.2-69 6.2-69a 6.2-69b 6.2-70 6.2-71 6.2-71a 6.2-71b 6.2-72 6.2-72a 6.2-72b 6.2-73 6.2-74 R04 R04 R03 R04 R04 R03 A26 AOO ROO ROO ROO A28 A28 A05 A26 ROO ROO A07 A23 A07 ROO ROO ROO A18 A17 A17 A17 AOO A26 A21 A21 A26 A25 A05 A11 A05 A05 ROO A05 A05 A05 R01 ROO ROO A28 A27 6.2-75 6.2-75a 6.2-75b 6.2-76 6.2-76a 6.2-76b 6.2-77 6.2-77a 6.2-77b 6.2-78 6.2-79 6.2-79a 6.2-79b 6.2-80 6.2-80a 6.2-80b 6 2-81 6.2-82 6.2-83 6.2-83a 6.2-83b 6.2-84 6.2-84a 6.2-84b 6.2-85 6.2-85a 6.2-85b 6.2-86 6.2-86a 6.2-86b 6.2-87 6.2-87a 6.2-87b 6.2-88 6.2-88a 6.2-88b 6.2-89 T 6.2-1 T 6.2-2 Sh 1 T 6.2-2 Sh 2 T 6.2-3 Sh 1 T 6.2-3 Sh 2 T 6.2-3 Sh 3 T 6.2-4 T 6.2-4a T 6.2-5 ROO A27 A05 A15 A28 A05 A27 R04 A15 R03 A15 A15 A15 ROO A15 A15 ROO A15 R01 A27 A23 R03 A23 A23 R03 R03 A17 R03 R03 A17 R03 R01 A17 R03 R01 ROO A15 AOO AOO AOO R03 ROO ROO AOO ROO AOO T 6.2-6 Sh 1 T 6.2-6 Sh 2 T 6.2-7 T 6.2-8 T 6.2-9 T 6.2-10 T 6.2-11 T 6 2-12 T 6.2-13 T 6 2-14 T 6.2-15 Sh 1 T 6 2-15 Sh 2 T 6.2-16 T 6'-17 T 6.2-18 T 6'-19 T 6.2-20 T 6.2-20a T 6.2-21 T 6'-22 T 6'-23 T 6.2-24 T 6.2-25 T 6.2-26 T 6.2-27 T 6.2-27A T 6.2-28 T 6.2-29 T 6.2-30 T 6.2-31 T 6.2-32 T 6.2-33 T 6.2-34 T 6.2-35 T 6.2-36 T 6.2-37 T 6.2-38 Sh 1 T 6.2-38 Sh 2 T 6.2-39 Sh 1 T 6.2-39 Sh 2 T 6.2-39 Sh 3 T 6.2-39 Sh 4 T 6.2-39 Sh 5 T 6.2-39 Sh 6 T 6.2-40 T 6.2-41 ROO ROO AOO AOO ROO AOO AOO AOO AOO AOO A26 AOO AOO AOO AOO AOO AOO A21 AOO AOO AOO AOO AOO AOO AOO ROO A11 ROO ROO ROO ROO ROO ROO A11 A11 A27 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 USAR Revision 4 EP 6-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 6 PAGES Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number T 6'-42 T 6.2-43 T 6.2-43A T 6.2-43B T 6.2-44 T 6.2-44A T 6.2-44B T 6.2-45 T 6.2-45A T 6.2-45B T 6.2-46 T 6'-47 T 6.2-48 T 6.2-49 T 6'-50 T 6'-51 T 6.2-52 T 6.2-53 T 6.2-54 T 6.2-55 T 6.2-55a Sh 1 T 6.2-55a Sh 2 T 6.2-55a Sh 3 T 6.2-55b Sh 1 T 6.2-55b Sh 2 T 6 2-55b Sh 3 T 6.2-55c Sh 1 T 6.2-55c Sh 2 T 6.2-55c Sh 3 T 6.2-55d Sh 1 T 6.2-55d Sh 2 T 6.2-55d Sh 3 T 6.2-56 Sh 1 T 6'-56 Sh 2 T 6.2-56 Sh 2a T 6.2-56 Sh 3 T 6 2-56 Sh 4 T 6.2-56 Sh 5 T 6.2-56 Sh 6 T 6 2-56 Sh 7 T 6.2-56 Sh 8 T 6.2-56 Sh 9 T 6.2-56 Sh 10 T 6.2-56 Sh 11 T 6.2-56 Sh 12 T 6.2-56 Sh 13 A11 A11 A11 ROO A11 A11 A11 A11 A11 A28 A11 A11 A28 A28 AOO ROO ROO ROO R04 A21 ROO ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO R01 A28 A28 A28 A21 A28 ROO R03 R03 A27 A28 R03 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-57 6.2-58 6.2-59 Sh 6.2-59 Sh 6.2-59A Sh 6.2-59A Sh 6.2-59B 6.2-59C 6.2-59D 6.2-60 6.2-61 6.2-62 6.2-63 Sh 6.2-63 Sh 6.2-64 6.2-65 Sh 6..2-65 Sh 6.2-1 6.2-2 6.2-3 6.2-4 6.2-5 6.2-6 6.2-7 6.2-8 6.2-9 6.2-10 6.2-11 14 15 16 17 17a 18 19 19a 20 20a 21 22 22a 23 23a 24 24a 24b 1 2 1 2 A27 A28 A28 A28 A28 ROO R03 A17 ROO ROO A26 A27 A26 R03 ROO A28 R04 R04 A28 AOO ROO R03 A18 A18 A18 A15 ROO R03 A27 A25 A24 A24 ROO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO A27 AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-12 6.2-13 6.2-14 6.2-15 6.2-16 6.2-17 6.2-18 6.2-19 6.2-20 6.2-21 6.2-22 6.2-23 6.2-24 6.2-25 6.2-26 6.2-27 6.2-28 6.2-28A 6.2-28B 6.2-28C 6.2-29 6.2-29A 6.2-29B 6.2-29C 6.2-29D 6.2-29E 6.2-29F 6.2-29G 6.2-29H 6.2-29I 6.2-29J 6.2-30 6.2-30A 6.2-31 6.2-31A 6.2-31B 6.2-32 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6'-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33 Sh 6.2-33A AOO AOO AOO AOO AOO AOO AOO AOO A18 A18 AOO A18 AOO AOO AOO AOO ROO ROO ROO ROO AOO-A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 A11 ROO ROO A11 A23 A23 A23 A23 A23 A23 A23 A23 ROO USAR Revision 4 EP 6-3 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-33B 6.2-34 6.2-35 6'-36 6.2-37 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-38 6.2-39 6.2-39A 6.2-40 6.2-41 6.2-42 6.2-43 6.2-44 6.2-45 6.2-46 6.2-46A 6.2-47 6.2-48 6.2-49 6.2-50 6.2-51 6.2-52 6.2-53 6.2-53 6.2-53 6.2-53 6.2>>53 6.2-53 6.2-54 6.2-55 6.2-56 6.2-56 6.2-56 6.2-56 6.2-56 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 ROO AOO AOO AOO AOO R03 ROO R03 R03 R03 R03 ROO ROO ROO R03 R03 ROO AOO A09 A27 A27 A28 A27 ROO ROO ROO ROO AOO AOO AOO A27 ROO All All All All All All All A23 All All A23 A23 A23 A23 F'F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-56 Sh 6.2-57 6.2-58 6'-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-59 Sh 6.2-60 6.2-61 6.2-62 Sh 6.2-62 Sh 6.2-62 Sh 6 2-62 Sh 6.2-62 Sh 6'-62A 6'-63 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64 Sh 6.2-64A 6.2-65 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh 6.2-66 Sh, 6.2-66 Sh 6.2-66A 6.2-67 6.2-68 6.2-68A 6.2-69 6.2-69A 6'-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6 7 8 9 10 1..2 3 4 5 A23 A23 A23 A23 A23 All All All All All All All A23 All All 2 All 3 All 4 All 5 All All All All All All All All All All All All All All All All All All All A27 A27 All Rol ROO ROO ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6 2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6'-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-70 Sh 6.2-71a 6.2-71b 6.2-72a 6.2-72b 6.2-'72c 6.2-72d 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 31A 32 33 34 35 36 37 38 39 40 41 42 43 43a 43b ROO ROO ROO ROO ROO ROO ROO ROO Rol ROO ROO ROO ROO ROO R02 ROO ROO ROO ROO R03 Rol ROO Rol R02 ROO ROO R03 ROO Rol ROO ROO Rol ROO ROO ROO Rol ROO R03 ROO ROO R03 R03 ROO ROO A07 ROO USAR Revision 4 EP 6-4 October 1992 1

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table~Fi ure Amendment Number Page T=Table Amendment F=FicFFre Number Page T=Table Amendment~F=Fi ure Number F 6.2-72e F 6.2-72f F 6.2-72g F 6.2-72?1 F 6.2-72i F 6.2-72j F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-72k F 6.2-73A F 6.2-74 F 6.2-75 F 6.2-75a F 6.2-75b F 6.2-76 F 6.2-76A F 6'-77 F 6.2-77A F 6.2-78 F 6.2-79 F 6.2-80 F 6.2-81 F 6.2-82 F 6.2-83 F 6.2-84 F 6'-85 F 6.2-86 F 6.2-87 F 6.2-88 F 6.2-89 F 6.2-90 F 6.2-91 F 6.2-92 F 6.2-93 F 6.2-94 6.3-1 6.3-2 6.3-3 6.3-4 6.3-5 6.3-6 6.3-6a 6.3-6b S?1 1 Sh 2 S?1 3 Sh 4 Sh 5 A28 A15 A15 ROO ROO A15 R03 R03 R03 R03 R03 ROO A10 R03 R03 R03 R03 R03 R04 R03 A04 A18 A25 A18 A25 R01 ROO A18 A28 A13 A27 A27 A27 R04 R04 R04 R04 AOO ROO A28 AOO A23 A23 A06 A06 6.3-7 6.3-8 6.3-8a 6.3-8aa 6.3-8ab 6.3-8b 6.3-8c 6.3-8d 6.3-9 6.3-10 6.3-10a 6.3-10b 6.3-11 6.3-12 6.3-13 6.3-14 6.3-14a 6.3-14b 6.3-15 6.3-16 6.3-16a 6.3-16b 6.3-17 6.3-18 6.3-19 6.3-20 6.3-20a 6.3-20b 6.3-21 6.3-21a 6.3-2lb 6.3-22 6.3-23 6.3-23a 6.3-23b 6.3-24 6.3-24a 6.3-24b 6.3-24c 6.3-24d 6.3-25 6.3-26 6.3-27 6.3-28 6.3-29 6.3-30 A19 A26 A26 A20 A20 A25 A24 A19 AOO A05 A27 A05 A27 R03 A05 A23 A23 A05 ROO A27 A23 A23 A23 R03 AOO A05 A23 A05 R03 R03 R03 AOO A20 A20 A20 A20 A07 A07 A07 A07 R03 AOO A20 R03 AOO R01 6.3-31 6.3-32 6.3-33 T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6.3-1 Sh 6.3-1 S11 6.3-1 S11 6~3-2 Sh 6.3-2 Sh 6.3-3 6.3-4 S11 6.3-4 S?1 6.3-5 6.3-6 S11 6.3-6 S?1 6.3-1 S?I 6.3-1 Sh 6.3-2 6.3-3a 6.3-3b 6.3-4a 6.3-4b 6.3-5a 6.3-5b 6.3-5c 6.3-6a 6.3-6b 6.3-7a 6.3-8 6.3-9 6.3-10 6.3-11 6.3-12 6.3-13 6.3-14 6.3-15 6.3-16 6.3-17 6.3-18 6.3-19 6'-20 6.3-21 6.3-22 6.3'-23 6.3-24 6.3-25 6.3-26 1 2 3 1 2 A27 A26 AOO R03 R03 R03 A20 A20 A20 R03 A20 A20 A20 A20 A27 A23 ROO A20 A05 A20 A05 A20 A07 A07 R04 ROO R04 A20 AOO A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 R03 A20 USAR Revision 4 EP 6-5 October 1992 II I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 6 Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 6 3-27 F 6.3-28 F 6.3-29 F 6.3-30 F 6.3-31 F 6.3-32 F 6.3-33 F 6.3-34 F 6.3-35 F 6.3-36 F 6.3-37 F 6.3-38 F 6.3-39 F 6.3-40 F 6.3-41 F 6.3-42 F 6.3-43 F 6.3-44 F 6.3-45 F 6.3-46 F 6.3-47 F 6.3-48 F 6.3-49 F 6.3-50 F 6.3-51 F 6.3-52 F 6.3-53 F 6.3-54 F 6.3-55 F 6.3-56 6'-1 6'-2 6.4-3 6.4-4 6.4-5 6.4-6 6.4-7 F 6.4-1 6.5-1 6.5-2 6.5-2a 6.5-2b 6.5-3 6.5-4 A20 R03 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 A20 AOO AOO R02 R04 A26 AOO R01 R04 AOO A28 A25 A25 ROO A28 6.5-4a 6.5-4b 6.5-5 6.5-6 6.5-7 6.5-7a 6'-7b 6.5-8 6.5-8a 6.5-8b 6.5-9 6.5-10 6.5-11 T 6.5-1 F 6.5-1 Sh 1 F 6.5-1 Sh 2 F 6.5-1 Sh 3 F 6.5-1 Sh 4 F 6.5-1 Sh 5 F 6.5-1 Sh 6 F 6 5-1 Sh 7 F 6.5-1 Sh 8 F 6.5-2 F 6.5-3 F 6.5-4 F 6.5-5 6.6-1 6.6-1a 6.6-1b 6.6-2 6.6-3 App 6A 6A-1 App 6B 6B-i 6B-1 6B-2 6B-3 6B-4 6B-5 6B-6 6B-7 6B-8 A25 A25 ROO A28 R04 A23 A23 A26 A20 A20 R04 R04 AOO AOO R03 R01 R04 R03 R01 R03 R04 R03 R04 R04 R04 R04 R03 A11 A11 AOO AOO AOO AOO AOO AOO AOO AOO A23 A23 AOO A23 A23 AOO 6B-9 F 6B-1 F 6B-2 App 6C 6C-1 6C-2 6C-3 6C-4 6C-5 6C-6 6C-7 6C-8 6C-9 6C-10 6C-10a 6C-10b 6C-11 6C-12 6C-13 6C-14 6C-15 6C-16 6C-17 6C-18 6C-19 6C-20 6C-21 6C-22 6C-23/24 (T HC-1)6C-25/26 (T HC-2)6C-27/28 (F HC-1)AOO AOO AOO ROO ROO ROO ROO ROO ROO R02 ROO ROO R02 R03 R03 R03 ROO ROO ROO ROO ROO ROO R02 ROO ROO R03 ROO R03 ROO R03 ROO USAR Revision 4 EP 6-6 October 1992 4

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 7 PAGES Page T=Table F FicFure Amendment Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number 7 i 7-ii 7-iii 7-iV 7-V 7-Vi 7-Vii 7-viia 7-viib 7-Viii 7 1X 7 X 7-Xi 7-Xii 7'-1 7 e 1 1 a 7.1-1b 7~1 2 7~1 3 7~1-4 7.1-5 7.1-5a 7.1-5b 7.1-6 7.1-6a 7.1-6b 7.1-6c 7.1-6d 7~1 7 7~1 7a 7.1-7b 7'-8 T 7~1 1 T 7.1-1 T 7.1-1 T 7.1-2 T 7.1-2 T 7~1 2 T 7~1 3 T 7~1 3 T 7~1-3 T 7.1-3 T 7~1 3 T 7.1-4 T 7.1-4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 ROO A24 R04 ROO ROO ROO R03 ROO A24 ROO R04 A24 R03 R03 R04 ROO ROO ROO A18 AOO ROO ROO ROO ROO ROO ROO ROO ROO R04 R02 R02 R02 AOO A09 A18 A28 A18 A28 A24 A24 ROO R02 ROO R04 ROO 7 e 2 1 7~2 2 7~2 3 7~2 3a 7.2-3b 7.2-4 7'-5 7'-6 7~2 7 7.2-8 7.2-9 7.2-10 7~2 1 1 7'-12 7e2 13 7~2 13a 7.2-13b 7'13c 7~2 13d 7.2-14 7'-15 7.2-16 7~2 17 7.2-18 7.2-19 7.2-20 7.2-21 7~2 22 T 7.2-1 T 7.2-2 T 7'-2 T 7.2-2 T 7~2 2 T 7.2-2 T 7.2-2 T 7~2 2 T 7~2 2 T 7.2-2 T 7~2 2 T 7.2-2 T 7~2 2 T 7~2 2 T 7~2 2 T 7.2-2 T 7~2 2 T 7~2 2 Sh 1 Sh2-Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 A23 ROO ROO ROO A26 A09 AOO R04 AOO A09 AOO R01 R03 R01 R01 ROO ROO ROO ROO R01 AOO AOO AOO A09 A09 AOO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO T 7'-2 F 7.2-1 F 7.2-1 F 7.2-1 F 7.2-1 F 7.2-1 7~3 1 7~3 2 7~3 3 7.3-4 7.3-5 7.3-6 7~3 7 7~3 7a 7.3-7b 7.3-8 7.3-9 7.3-9a 7.3-9b 7.3-10 7~3 1 1 7~3 12 7~3 13 7~3 13a 7.3-13b 7.3-14 7.3-15 7.3-16 7.3-16a 7.3-16b 7~3 1 7 7;3-18 7.3-19 7.3-19a 7.3-19b 7.3-20 7~3 2 1 7~3 22 7 e 3 22a 7.3-22b 7~3 23 7.3-24 7.3-25 7.3-26 7.3-26a Sh Sh Sh Sh Sh Sh 18 1 2 3 4 5 ROO A23 A23 ROO R01 A23 AOO A23 R01 R02 R01 A26 A25 A25 A09 R01 A23 A13 A13 AOO ROO A23 A09 A09 A09 ROO A09 A28 A18 A18 A28 A28 R04 ROO A09 R01 R04 R01 ROO ROO R04 R03 A26 R04 R01 USAR Revision 4 EP 7-1 October 1992

~I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 7 PAGES Page T=Table F=FicFur e Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 7.3-26b 7~3 27 7.3-28 7.3-29 7.3-30 7.3-31 7~3 3 la 7.3-31b 7~3 32 7~3 33 7~3 33a 7.3-33b 7.3-34 7.3-35 T 7~3 1 T 7.3-2 T 7~3 3 T 7.3-4 T 7'-5 T 7.3-5 T 7.3-6 T 7'-7 T 7.3-8 T 7'-9 T 7.3-10 T 7~3 1 1 T 7'-11 T 7.3-12 T 7~3 13 T 7~3-14 T 7.3-15 T 7.3-16 T 7.3-16 T 7~3 17 T 7~3 17 T 7.3-17 T 7~3 17 T 7.3-17 T 7.3-17 T 7'-17 T 7.3-17 T 7~3 17 T 7~3 17 T 7e3 17 T 7.3-17 T 7.3-17 ROO AOO Rol A23 Alo A23 Alo Alo AOO ROO R01 Rol ROO ROO Rol Rol Rol Rol A23 Rol Rol Rol ROl Rol Rol ROO Rol Rol Rol Rol Rol ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO T 7.3-17 Sh 14 T 7.3-17 Sh 15 T 7.3-17 Sh 16 F 7.3-1 F 7.3-2 Sh 1 F 7.3-2 Sh 2 F 7 3-2 Sh 3 F 7.3-3 Sh 1 F 7.3-3 Sh 2 F 7.3-3 Sh 3 F 7.3-4 Sh 1 F 7.3-4 Sh 2 F 7.3-4 Sh 3 F 7.3-4 Sh 4 F 7.3-4 Sh 5 F 7.3-5 Sh 1 F 7.3-5 Sh 2 F 7.3-6 Sh 1 F 7.3-6 Sh 2 F 7.3-6 Sh 3 F 7.3-6 Sh 4 F 7.3-6 Sh 5 F 7.3-7 F 7.3-8 F 7.3-9 F 7.3-10 Sh 1 F 7.3-10 Sh 2 7.4-1 7~4-2 7.4-3 7.4-3a 7.4-3b 7.4-4 7.4-4a 7'-4b 7.4-5 7.4-6 7.4-6a 7'-6b 7'-7 7'-8 7.4-8a 7.4-8b 7'-9 7.4-10 ROO R01 R04 A09 R03 A23 A23 ROO ROO ROO ROO A23 ROO ROO A23 ROO A23 ROO A23 ROO ROO ROO ROO A09 A09 R03 ROO A21 AOO R04 ROO ROO ROO ROO A18 A20 A24 A24 A24 ROO ROO ROO ROO ROO ROO 7.4-11 7.4-lla 7.4-11b 7.4-12 7.4-12a 7.4-12b 7.4-13 7.4-13a 7.4-13b 7.4-14 7.4-15 7.4-16 7.4-17 7.4-18 7.4-19 7.4-19a 7.4-19b 7.4-20 7'-21 7.4-22 7.4-22a 7.4-22b 7.4-23 7.4-23a 7.4-23b 7.4-23c 7.4-23d 7.4-24 T 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-1 F 7.4-2 7.5-1 7.5-1a 7.5-1b 7.5-2 7.5-3 7.5-4 7.5-5 7.5-6 7.5-7 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 ROO ROO A23 ROO ROO ROO R03 A18 A18 R01 Rol AOO AOO AOO ROO ROO ROO A18 A23 A18 A23 A23 Rol ROO ROO ROO ROO AOO ROO ROO A23 A23 ROO ROO ROO ROO ROO ROO ROO A27 AOO ROO A27 A23 R04 USAR Revision 4 EP 7-2 October 1992 fi Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T-Zable F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 7.5-8 7.5-9 7.5-10 7.5-11 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7.5-1 T 7'-1 T 7.5-1 T 7'-1 T 7 5-1 T 7.5-1 T 7 5-1 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7'-2 T 7'-2 T 7'-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 R04 R04 R04 R04 R01 ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 T 7~5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7'-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 T 7.5-2 7.6-1 7.6-2 7.6-2a 7.6-2b 7.6-3 7.6-3a 7.6-3b 7.6-4 7.6-4a 7.6-4b 7.6-5 7.6-6 7.6-6a 7.6-6b 7.6-7 7.6-8 7.6-8a 7.6-8b 7.6-8c 7.6-8d 7.6-9 7.6-9a 7.6-9b 7.6-10 7.6-10a Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 A18 R04 R04 A10 ROO A10 A10 R01 A10 A10 A26 R01 A18 A10 A27 A24 R01 ROO R03 ROO ROO A10 A10 R01 R01 7.6-10b 7.6-11 7.6-12 7.6-13 7.6-14 7.6-15 7.6-16 7.6-17 7.6-18 7.6-19 7.6-20 7.6-21 7.6-22 7.6-22a 7 6-22b 7.6-23 7.6-23a 7.6-23b 7.6-24 7.6-25 7.6-26 7.6-26a 7.6-26b 7.6-26c 7.6-26d 7.6-26e 7.6-26f 7.6-26g 7.6-26h 7.6-27 T 7'-1 T 7.6-2 T 7.6-3 T 7.6-3 T 7.6-4 T 7.6-5 T 7.6-6 F 7.6-1 F 7'-1 F 7.6-2 F 7.6-3 F 7.6-3 F 7.6-4 F 7.6-5 F 7.6-6 F 7.6-6 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 A18 R01 R03 R01 A10 , AOO AOO A27 A27 AOO A27 AOO R01 ROO ROO A13 A10 A10 A10 A10 A18 A18 A24 A18 A18 R03 R01 R01 A18 AOO R01 R04 ROO R01 A10 A27 A27 ROO ROO AOO A23 A23 AOO AOO A23 A23 USAR Revision 4 EP 7-3 October 1992

-~z Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T=Table Amendment F=F icFure Number Page T=Table Amendment F=FicFur e Number Page T=Table F=FicFure Amendment Number F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-6 Sh F 7.6-7 F 7.6-8 F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7'-9 Sh F 7'-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh F 7.6-9 Sh 7~7 1 7~7 1a 7.7-1b 7'7 2 7~7 3 7.7-4 7.7-5 7'-6 7~7 7 7.7-8 7.7-9 7'-10 7~7 1 1 7~7 1 2 7~7 1 3 7.7-14 7.7-15 7'-16 7~7 17 7~7 17a 7.7-17b 7.7-18 7.7-19 7.7-20 7~7 2 1 7e721a 7.7-2lb 7~7 22 A23 A23 A23 A23 A23 A27 A27 A23 A23 A23 A23 A23 R01 A23 A23 A23 ROO R04 A10 A10 AOO A10 AOO R03 AOO R03 A27 R01 R03 AOO R03 A27 AOO AOO R01 R03 R03 R03 AOO ROO ROO ROO A18 A18 A18 7~7 22a 7.7-22b 7~7 23 7.7-24 7.7-24a 7.7-24b 7.7-25 7.7-26 7~7 27 7~7 27a 7.7-27b 7.7-28 7.7-29 7.7-30 7~7 3 1 7~7 32 7~7 33 7.7-34 7.7-35 7.7-36 7~7 37 7~7 3 7 a 7.7-37b 7.7-38 7.7-39 7.7-39a 7.7-39b 7;7-40 7.7-41 7.7-42 T 7~7 1 T 7~7 2 T 7.7-3 Sh 1 T 7.7-3 Sh 2 F 7.7-1 Sh 1 F 7.7-1 Sh 2 F 7.7-1 Sh 3 F 7.7-1 Sh 4 F 7.7-1 Sh 5 F 7.7-1 Sh 6 F 7.7-1 Sh 7 F 7.7-2 Sh 1 F 7.7-2 Sh 2 F 7.7-2 Sh 3 F 7.7-2 Sh 4 F 7.7-2 Sh 5 A27 A10 ROO R01 R01 A14 A10 R03 A23 A23 A23 AOO A23 ROO ROO A14 AOO AOO A09 R03 R04 R03 R03 A10 A26 A26 A26 A10 A10 R03 A10 A10 A10 AOO ROO R03 A23 R03 A23 ROO R03 R03 R03 R03 R03 A23 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7.7-2 F 7'-2 F 7.7-2 F 7'-2 F 7.7-3 F 7.7-4 F 7.7-5 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-6 F 7.7-7 F 7.7-8 F 7'-9 F 7.7-10 App 7A Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 sh Sh Sh Sh Sh Sh Sh R03 A23 R03 R03 A23 A23 A23 R04 R04 A23 A23 A23 A23 A23 A23 A23 A23 R03 R04 R03 R03 A23 R03 A23 A23 R03 A23 A23 A23 R03 AOO A10 AOO A23 A23 ROO ROO A23 ROO ROO ROO R03 AOO ROO ROO USAR Revision 4 EP 7-4 October 1992 H

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 7 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 7A.1-1 7A.1-2 7A.1-3 7A.1-4 7A.1-5 7A.1-6 7A.1-7 7A.1-8 7A.1-9 7A.1-10 7A.1-11 7A.1-12 7A.1-13 7A.1-14 7A.1-15 7A.1-16 T 7A.1-1 F 7A.1-1 F 7A.1-2 F 7A.1-3 F 7A.1-4 F 7A.1-5 F 7A.1-6 F 7A.1-7 F 7A.1-8 F 7A.1-9 7A.2-1 7A.2-2 7A.2-3 7A.3-1 7A.3-2 7A.3-3 7A.4-1 7A.4-2 7A.4-3 7A.5-1 7A.5-2 7A.5-3 7A.5-4 7A.5-5 7A;6-1 7A.6-2 7A.6-3 7A.6-4 F 7A.6-1 R02 R02 R02 R02 ROO ROO R02 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO App 7B 7B-1 T 7B-1 T 7B-1 T 7B-1.T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 T 7B-1 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 7-5 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 8-i 8-ii 8-iii 8-iv 8-v 8-va 8-vb 8-vi 8.1-1 8.1-2 8.1-3 8.1-3a 8.1-3b 8.1-4 8.1-5 8.1-6 8.1-7 8.1-8 F 8.1-1 8.2-1 8.2-1a 8.2-1b 8.2-2 8.2-2a 8.2-2b 8.2-3 8.2-4 8.2-5 8.2-5a 8.2-5b 8'-6 8.2-6a 8.2-6b 8.2-7 8.2-7a 8.2-7b 8.2-8 8.2-9 8.2-10 8.2-11 8 2-12 8.2-13 8.2-14 8.2-15 ROO ROO ROO R04 ROO R02 A26 R04 A07 A27 A27 A27 A27 AOO AOO ROO AOO AOO A27 R04 R04 A07 ROO ROO R04 R04 A21 A26 A14 A14 A23 A14 A07 A13 A13 A13 AOO A04 A23 ROO A23 A21 ROO A26 8.2-15a 8.2-15b 8 2-16 8.2-16a 8.2-16b 8.2-17 8.2-18 8.2-19 8'-20 8.2-21 8'-22 8.2-23 8.2-23a 8.2-23b 8.2-24 8.2-24a 8.2-24b 8.2-24c 8.2-24d 8.2-25 8.2-26 T 8.2-1 S11 1 T 8.2-1 S?1 2 T 8.2-1 Sh 3 T 8.2-1 Sjl 4 F 8.2-1 F 8.2-1a F 8.2-1b F 8.2-1c F 8.2-2 F 8.2-3 F 8.2-4 F 8.2-4a F 8.2-5 F 8.2-5a F 8.2-6 F 8.2-6a F 8.2-6b F 8.2-6c F 8.2-7 F 8.2-8 F 8.2-9 8.3-1 8.3-2 8.3-3 A26 A26 A26 A26 A26 A07 ROO ROO A23 ROO R01.A23 A07 A07 A15 A23 ROO A28 A28 ROO ROO ROO'OO R03 A28 A26 ROO ROO ROO A26 A07 AOO A26 A26 A26 A26 A26 A26 A26 ROO ROO A26 AOO AOO AOO 8.3-4 8.3-4a 8'-4b 8.3-5 8'-6 8'-7 8 3-7a 8.3-7b 8.3-8 8'-8a 8'-8b 8'-9 8.3-9a 8.3-9b 8'-10 8.3-11 8.3-11a 8.3-11b 8'-12 8.3-12a 8'-12b 8'-13 8'-14 8.3-15 8 3-16 8 3-17 8 3-18 8.3-18a 8'-18b 8.3-18c 8'-18d 8'-19 8 3-19a 8'-19b 8.3-20 8.3-20a 8.3-20b 8'-21 8.3-22 8'-23 8'-24 8-3-24a 8'-24b 8'-25 8'-25a 8-3-25b R02 A24 A06 R04 A23 ROO A07 A07 R01 A07 A07 R01 A23 A13 A23 ROO A19 A07 R04 A23 A23 R04 R04 R04 A19 ROO ROO ROO A28 ROO A07 ROO ROO ROO R04 ROO A23 R04 ROO R04 ROO A27 A27 ROO ROO A20 USAR Revision 4 EP 8-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F FicFure Number Page T=Table F=FicFure Amendment Number 8.3-26 8.3-26a 8.3-26b 8.3-27 8.3-27a 8.3-27b 8.3-27c 8.3-27d 8.3-28 8.3-29 8.3-30 8'-31 8'-32 8.3-33 8'-34 8.3-35 8.3-36 8.3-37 8.3-37a 8.3-37b 8.3-38 8.3-39 8.3-40 8.3-40a 8.3-40b 8.3-41 8.3-42 8.3-42a 8.3-42b 8.3-43 8.3;44 8.3-45 8.3-45a 8.3-45b 8.3-46 8.3-46a 8'-46b 8.3-47 8'-48 8.3-48a 8.3-48b 8.3-49 8.3-49a 8'-49b 8.3-50 8.3-50a ROO ROO A07 A07 ROO ROO ROO ROO R04 A23 A23 A23 ROO ROO R03 ROO ROO ROO ROO A21 R04 AOO ROO A15 A15 ROO R04 ROO A07 ROO AOO A19 A19 A19 ROO A13 A13 AOO ROO A07 A07 A23 ROO A20 R04 A23 8.3-50b 8.3-51 8.3-51a 8.3-51b 8.3-52 8.3-52a 8.3-52b 8.3-53 8.3-53a 8.3-53b 8.3-54 8'-54a 8.3-54b 8.3-55 8'-56 8.3-57 8.3-57a 8.3-57b 8.3-58 8.3-58a 8.3-58b 8'-59 8.3-60 8.3-61 8.3-62 8.3-62a 8.3-62b 8.3-63 8.3-64 8.3-64a 8.3-64b 8.3-65 8.3-66 8.3-67 8.3-68 8.3-69 8.3-70 8.3-71 8.3-72 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 T 8.3-1 Sh 1 Sh 1a Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 A15 A26 A25 A23 ROO ROO A23 A07 A07 A07 A28 A28 A07 A23 A19 R03 R03 A07 A'23 A19 A07 A27 ROO A14 R01 R01 A18 A23 A23 A19 A19 ROO A19 AOO AOO R02 R01 AOO ROO ROO ROO ROO R01 ROO ROO ROO T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-1 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8.3-2 8'-2 8.3-3 8.3-3 Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 8.3-4 sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh sh 8'-3A 7 8 9 10 11 12 13 1 2 3 4 5 6 7 8 9 10 11 1 2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 ROO ROO'OO ROO ROO ROO ROO ROO ROO R01 ROO ROO ROO ROO ROO ROO ROO ROO ROO A27 A27 R01 ROO ROO A28 A28 R01 ROO A28 ROO ROO ROO ROO A28 ROO A28 A28 A28 R01 ROO ROO A28 ROO A28 A28 ROO USAR Revision 4 EP 8-2 October 1992 F

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 8 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T 8.3-4 Sh 26 T 8.3-4 Sh 27 T 8.3-4 Sh 28 T 8.3-4 Sh 29 T 8.3-4 Sh 30 T 8.3-4 Sh 31 T 8.3-4 Sh 32 T 8'-4 Sh 33 T 8.3-4 Sh 34 T 8.3-4 Sh 35 T 8.3-4 Sh 36 T 8.3-4 Sh 37 T 8.3-4 Sh 38 T 8.3-4 Sh 39 T 8.3-4 Sh 40 T 8.3-5 T 8.3-6 T 8.3-6a Sh 1 T 8.3-6a Sh 2 T 8.3-7 T 8.3-8 T 8.3-9 T 8.3-10 T 8.3-11 T 8.3-12 T 8.3-13 T 8.3-14 T 8.3-15 T 8.3-16 Sh 1 T 8.3-16 Sh 2 T 8.3-17 F 8.3-1 F 8.3-2 F 8.3-3 Sh 1 F 8.3-3 Sh 2 F 8.3-4 F 8.3-5 F 8.3-6 Sh 1 F 8'-6 Sh 2 F 8.3-6 Sh 3 F 8.3-6 Sh 4 F 8.3-6 Sh 5 F 8.3-6 Sh 6 F 8'-6 Sh 7 F 8.3-6 Sh 8 F 8.3-6 Sh 9 ROO ROO ROO ROO R01.A28 ROO ROO A28 ROO ROO ROO ROO A28 ROO ROO ROO ROO R03 ROO ROO ROO R03 ROO ROO A23 AOO AOO R04 R04 R04 ROO ROO R04 R04 ROO ROO ROO ROO ROO ROO R03 ROO ROO R03 ROO F 8.3-6 Sh 10 F 8.3-6 Sh 11 F 8.3-6 Sh 12 F 8.3-6 Sh 13 F 8.3-6 Sh 14 F 8'-6 Sh 15 F 8'-6 Sh 16 F 8.3-6 Sh 17..F 8.3-6 Sh 18 F 8.3-6 Sh 19 F 8.3-6 Sh 20 F 8.3-6 Sh 21 F 8.3-6 Sh 22 F 8.3-6 Sh 23 F 8.3-6 Sh 24 F 8.3-6 Sh 25 F 8.3-6 Sh 26 F 8.3-6 Sh 27 F 8.3-6 Sh 28 F 8.3-6 Sh 29 F 8.3-6 Sh 30 F 8.3-6 Sh 31 F 8.3-7 F 8.3-8 Sh 1 F 8.3-8 Sh 2 F 8.3-8A F 8.3-8B Sh 1 F 8.3-8B Sh 2 F 8.3-8B Sh 3 F 8.3-8B Sh 4 F 8.3-8B Sh 5 F 8.3-8B Sh 6 F 8.3-8B Sh 7 F 8.3-8B Sh 8 F 8.3-8B Sh 9 F 8.3-8B Sh 10 F 8.3-8B Sh 11 F 8.3-8B Sh 12 F 8.3-8B Sh 13 F 8.3-8B Sh 13a F 8.3-8B Sh 13b F 8.3-8B Sh 13c F 8.3-8B Sh 13d F 8.3-8B Sh 13e F 8.3-8B Sh 13e F 8.3-8B Sh 13f R03 ROO ROO R03 ROO R03 R03 R03 ROO ROO R03 R03 R03 ROO ROO ROO ROO R03 R03 R03 ROO ROO R01 ROO ROO ROO A15 A15 A15 A15 A15 A15 A15 A15 A15 A15 A15 ROO A23 A28 A28 A28 A28 A28 A28 A28 F 8.3-9 F 8.3-10 F 8.3-11 App 8A 8A-1 8A-2 8A-3 8A-4 R04 ROO R01 ROO ROO ROO ROO ROO USAR Revision 4 EP 8-3 October 1992 g 1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 9-i 9-ii 9-iii 9-iv 9-iva 9-ivb 9-v 9-vi 9-vii 9-viia 9-viib 9-viii 9-ix 9-x 9-xi 9-xii 9-xiii 9-xiiia 9-xiiib 9-xiv 9-xv 9-xvi 9-xvii 9-xvlii 9-xix 9-xx 9-xxi 9-xxii 9.1-1 9~1-2 9'-2a 9.1-2b 9.1-3 9.1-3a 9.1-3b 9'-4 9.1-5 9.1-6 9.1-6a 9.1-6b 9.1-7 9.1-7a 9.1-7b 9.1-8 9.1-8a R04 R03 A24 A12 A12 A12 ROO R03 A24 A24 A23 AOO ROO R03 R04 ROO A24'26 A26 R03 R04 R04 R04 R03 R03 R02 R03 R04 AOO A05 A20 A05 A05 A22 A05 AOO A05 A20 A20 A20 R04 R03 A05 ROO A23 9.1-8b 9.1-9 9.1-9a 9.1-9b 9.1-10 9.1-10a 9.1-10b 9.1-11 9.1-11a 9.1-11b 9'-12 9.1-13 9.1-14 9.1-14a 9.1-14b 9.1-15 9.1-15a 9.1-15b 9.1-16 9.1-17 9.1-18 9.1-19 9.1-20 9.1-21 9.1-22 9.1-23 9.1-24 9.1-25 9.1-26 9.1-27 9.1-28 9.1-29 9.1-29a 9.1-29b 9.1-30 9.1-31 9.1-32 9.1-32a 9.1-32b 9.1-33 9.1-34 9.1-35 9.1-36 9.1-37 9.1-38 9.1-39 A20 A14 A14-A14 R04 R04 A14 R04 A23 A23 R04 R04 R04 R04 A05 R04 R04 A05 AOO AOO A24 A21 AOO A09 AOO R03 AOO AOO A21 AOO AOO ROO ROO A28 AOO R04 R02 R02 R02 AOO AOO AOO AOO AOO AOO AOO 9.1-40 9.1-41 9.1-42 9.1-42a 9.1-42b 9.1-43 9.1-44 9.1-45 9.1-46 T 9.1-1 T 9'-2 T 9.1-3 T 9.1-4 S?1 T 9.1-4 S?1 T 9.1-5 T 9.1-6 F 9'-1 F 9.1-1A F 9.1-2 F 9.1-3 F 9.1-3A F 9.1-4 F 9.1-5a F 9.1-5b F 9.1-5c F 9.1-5d F 9.1-6 Sh F 9.1-6 Sh F 9.1-6 S11 F 9.1-6 Sh F 9.1-6 Sh F 9 1-6 S11, F 9.1-6 S11 F 9.1-6 Sh F 9'-7 F 9'-8 F 9.1-9 F F 1-10 F 9.1-11 F 9.1-12 F 9.1-13 F 9.1-14 F 9.1-15 F 9.1-16 F 9.1-17 F 9.1-18 1 2 1 2 3 4 5 6 7 8 AOO R04 R04 A09 A09 A23 A20 A20 A20 AOO AOO A'00 AOO AOO A05 A19 AOO A05 A04 R02 A05 A23 R04 R04 R03 R04 R03 R03 R03 R03 ROO R04 R03 R03 R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO USAR Revision 4 EP 9-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number F 9'-19 F 9.1-19a F 9.1-20 F 9.1-20a F 9'-21 F 9.1-22 F 9.1-23 F 9'-24 F 9.1-25 F 9.1-26a 9'-1 9.2-2 9.2-3 9'-4 9.2-4a 9.2-4b 9.2-5 9.2-5a 9.2-5b 9.2-6 9.2-7 9.2-7a 9.2-7b 9.2-8 9.2-9 9.2-10 9.2-10a 9.2-10b 9.2-11 9.2-11a 9.2-11b 9.2-12 9.2-13 9.2-14 9.2-15 9.2-16 9'-17 9.2-18 9.2-18a 9.2-18b 9.2-19 9.2-20 9.2-21 9.2-22 9.2-22a A28 ROO A28 ROO AOO AOO R03 AOO R02 ROO AOO R03 A25 R03 R03.R03 A11 A25 A05 A24 R01 A25 A23 R03 R03 R03 A22 A22 A27 A23 A23 A27'27 ROO R03 A27 ROO ROO ROO A25 A25 A25 ROO ROO ROO 9.2-22b 9.2-23 9.2-23a 9.2-23b 9.2-24 9.2-25 9.2-25a 9.2-25b 9.2-26 9.2-26a 9.2-26b 9.2-27 9.2-28 9.2-28a 9.2-28b 9'-29 9.2-30 9.2-31 9.2-32 9.2-33 9.2-34 9.2-35 9.2-36 9.2-37 9.2-38 9.2-39 9.2-39a 9.2-39b 9.2-40 9.2-41 9.2-42 9.2-43 9.2-44 9.2-45 9.2-46 9.2-46a 9.2-46b 9.2-47 9.2-48 9.2-48a 9.2-48b 9.2-49 9'-50 9.2-51 T 9.2-1A Sh 1 T 9.2-1A Sh 2 ROO A23'23 A23 A23 R04 A23 A18 A23 A23 A18 ROO R04 R04 A25 R04 R04 R04 AOO AOO AOO R04 R04 AOO R04 A26 A26 A26 R04 R04 A22 R04 R04 A23 A05 A24 A05 A24 ROO A20 A20 R03 A23 AOO R01 A28 T 9.2-1A Sh 3 T 9.2-1A Sh 4 T 9.2-1A Sh 5 T 9 2-1A Sh 6 T 9.2-1B Sh 1 T 9.2-1B Sh 2 T 9'-1B Sh 3 T 9.2-1B Sh 4 T 9.2-1B Sh 5 T 9.2-2 Sh 1 T 9.2-2 Sh 2 T 9.2-2 Sh 3 T 9.2-2 Sh 4 T 9.2-2 Sh 5 T 9.2-2 Sh 6 T 9.2-2 Sh 7 T 9.2-2 Sh 8 T 9.2-2 Sh 9 T 9.2-3 Sh 1 T 9 2-3 Sh 2 T 9.2-4 Sh 1 T 9'-4 Sh 2 T 9.2-4 Sh 3 T 9.2-5 T 9.2-6 T 9.2-7 T 9'-8 T 9.2-9 F 9.2-1a F 9.2-1b F 9.2-1c F 9.2-1d F 9.2-1e F 9.2-1f F 9.2-1g F 9.2-1h F 9.2-1j F 9 2-1jc F 9.2-1L F 9.2-1m F 9.2-1n F 9.2-1p F 9.2-1q F 9.2-2 Sh 1 F 9.2-2 Sh 2 F 9.2-2 Sh 3 A28 A28 R01 R01 R01 A28 A28 A28 R01 R01 A28 A28 A28'01 A28 A28 A28 R01 ROO A23 A23 A23 A23 AOO AOO AOO AOO AOO R04 R04 R04 R04 R04 R04 R04 R03 R04 ROO R04 R04 ROO R04 R02 R03 R03 R03 USAR Revision 4 EP 9-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=Picpure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment~Fi ure Number F 9~2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9.2-2 Sh F 9'-2 Sh F 9.2-3a F 9.2-3b F 9.2-3c F 9.2-3d F 9.2-3e F 9'-3f F 9.2-3g F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9'-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-4 Sh F 9.2-5a F 9.2-5b F 9.2-5c 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 1 2 3 4 5 6 7 8 9 10 11 12 R03 R04 R03 R03 R03 R03 R03 R01 R03 R03 R03 R01 R01 R03 R03 R03 R03 R03 R01 R01 R03 R01 R01 R01 R03 R04 ROO R03 ROO ROO ROO R03 R03 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R01 ROO ROO F 9.2-5d F 9.2-5e F 9.2-6a F 9.2-7 Sh 1 F 9.2-7 Sh 2 F 9'-7 Sh 3 F 9.2-7 Sh 4 F 9.2-7 Sh 5 F 9.2-7 Sh 6 F 9'-7 Sh 7 F 9.2-7 Sh 8 F 9'-7 Sh 9 F 9.2-7 Sh 10 F 9.2-7 Sh 11 F 9.2-7 Sh 12 F 9.2-8a F 9'-8b F 9.2-9a F 9.2-9b F 9.2-10 F 9.2-11 F 9.2-12 F 9.2-13 F 9.2-14 F 9.2-15 F 9.2-16 F 9.2-17a F 9.2-17b F 9.2-17c F 9.2-18 Sh 1 F 9.2-18 Sh 2 F 9.2-18 Sh 3 F 9.2-18 Sh 4 F 9.2-19a F 9.2-19b F 9.2-19c F 9.2-19d F 9.2-19e F 9.2-19f F 9.2-20 Sh 1 F 9'-20 Sh 2 F 9.2-20 Sh 3 F 9.2-20 Sh 4 F 9.2-20 Sh 5 F 9.2-21 ROO R01 R02 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R04 ROO R03 R04 R04 R04 AOO R04 AOO AOO R03 R04 ROO R03 R03 R03 R03 R03 ROO ROO ROO ROO R04 R03 R03 R03 R03 R03 A18 9'-1 9.3-1a 9.3-1b 9.3-2 9.3-3 9.3-4 9.3-4a 9.3-4b 9.3-5 9.3-6 9.3-7 9.3-8 9.3-9 9.3-10 9.3-11 9.3-11a 9.3-11b 9.3-11c 9.3-11d 9.3-11e 9.3-11f 9.3-11g 9.3-11h 9.3-11i 9.3-11j 9.3-12 9.3-13 9.3-14 9.3-15 9.3-16 9.3-17 9.3-17a 9.3-17b 9.3-18 9.3-19 9.3-20 9.3-21 9.3-22 9.3-22a 9.3-22b 9.3-23 9'-23a 9.3-23b 9.3-24 9.3-25 9'-26'.ROO ROO A28 A25 ROO ROO ROO ROO R03 A12 R04 A23 R04 A24 ROO R02 A12 A26 R03 ROO ROO A28 ROO ROO A12 A25 A23 AOO ROO A23 A24 A24 A24 AOO AOO AOO AOO A22 A22 A22 R04 R04 A22 A27 A27 A22 USAR Revision 4 EP 9-3 October 1992 4

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=F icFFre Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 9.3-26a 9.3-26b 9.3-27 9.3-28 9.3-28a 9.3-28b 9.3-29 9.3-29a 9.3-29b 9.3-30 9.3-31 9.3-32 9.3-33 9.3-33a 9.3-33b 9.3-34 9.3-35 9.3-35a 9.3-35b 9'-36 T 9.3-1 Sh 1 T 9'-1 Sh 2 T 9.3-1 Sh 3 T 9.3-1 Sh 4 T 9'-1 Sh 5 T 9.3-1 Sh 5a T 9'-1 Sh 6 T 9.3-1 Sh 7 T 9'3-1 Sh 8 T 9.3-1 Sh 9 T 9.3-1 Sh 9a T 9.3-1 Sh 10 T 9.3-2 Sh 1 T 9'-2 Sh 2 T 9.3-3 F 9'-la F 9.3-lb F 9.3-1c F 9.3-1d F 9.3-1e F 9.3-1f F 9.3-1g F 9'-lh F 9.3-lj F 9.3-lk F 9.3-1L A27 A22 ROO ROO A24 A22 A24 A18 A18 A18 A27 ROO A26 A26 A18 ROO A28 A28 A28 Rol AOO AOO AOO AOO A23 A23 AOO R03 A23 A23 A23 A23 A21 A23 ROO R04 R04 R04 R02 R04 R04 R03 R02 R02 R02 ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F'F F F 9.3-1m 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-2 Sh 9.3-3a 9.3-3b 9.3-3c 9.3-3d 9.3-3e 9.3-4 Sh 9.3-4 Sh 9.3-5a 9.3-5b 9.3-5c 9.3-5d 9.3-5e 9.3-5f 9.3-5g 9.3-,5h 9'-5j 9'-5k 9'-6 Sh 9'-6 Sh 9'-6 Sh 9 3-6 Sh 9-3-7 Sh 9'-7 Sh 9.3-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-7 Sh 9'-8 Sh 9'-8 Sh 9'-8 Sh 9.3-9a 9'-9b 1 2 3 4 5 6 7 8 9 10 11 1 2 1 2 3 4 1 2 3 4 5 6 7 8 1 2 3 ROO R03 R03 R03 ROO R03 R03 R03 R03 R03 ROO ROO ROO ROO ROO ROO ROO R03 R03 ROO ROO ROO ROO R01 Rol ROO ROO R04 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 ROO ROO ROO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 9.3-9c 9.3-9d 9.3-9e 9.3-9f 9.3-10a 9.3-10b 9.3-10c 9.3-10d 9.3-10e 9.3-10f 9.3-10g 9.3-10h 9.3-10j 9.3-11a 9.3-11b 9.3-11c 9.3-11d 9.3-11e 9.3-12a 9.3-12b 9.3-12c 9.3-12d 9.3-12e 9.3-12f 9.3-12g 9.3-12h 9.3-12j 9.3-12k 9.3-12L 9.3-13 Sh 1 9.3-13 Sh 2 9.3-13 Sh 3 9.3-13 Sh 4 9.3-13 Sh 5 9.3-13 Sh 6 9.3-13 Sh 7 9.3-13 Sh 8 9.3-13 Sh 9 9.3-13 Sh 10 9.3-14 Sh 1 9.3-14 Sh 2 9.3-14 Sh 3 9.3-14 Sh 4 9.3-15 9.3-16 Sh 1 9.3-16 Sh 2 R03 ROO ROO R04 R03 R03 R03 ROO R03 ROO R03 R03 R04 ROO ROO ROO R03 R03 ROO R01 R03 R03 ROO ROO R03 ROO R02 ROO ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 USAR Revision 4 EP 9-4 October 1992

Nine Mile Point Unit, 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number F 9.3-16 S?1 3 F 9.3-16 Sh 4 F 9'-16 S?1 5 F 9.3-16 Sh 6 F 9.3-16 Sb 7 F 9.3-16 S?1 8 F 9.3-16 S?1 9 F 9.3-17a F 9.3-18 F 9'-19 F 9.3-20a F 9.3-20b 9.4-1 9'-2 9.4-2a 9'-2b 9 4-3 9.4-4 9'-5 9.4-6 9'-7 9'-8 9.4-9 9'-10 9'-11 9.4-12 9.4-13 9.4-14 9.4-15 9.4-16 9.4-17 9.4-18 9.4-19 9'-20 9.4-21 9'-21a 9.4-21b 9.4-22 9.4-23 9.4-23a 9.4-23b 9'-24 9.4-25 9.4-26 9.4-26a R03 R03.R03 R03 R03 R03 R03 R04 A26 AOO R03 R03 A26 A26 A26 A05 R03 ROO A26 A26 A23 A25 A22 A26 A25 R03 ROO ROO A25 AOO ROO A25 A25 A25 A25 A25 A15 ROO ROO R03 A15 R03 ROO A15 A15 9.4-26b 9.4-27 9.4-28 9.4-29 9.4-30 9.4-31 9.4-32 9.4-32a 9.4-32b 9.4-33 9.4-33a 9.4-33b 9.4-34 9.4-34a 9.4-34b 9.4-35 9.4-36 9.4-37 9.4-37a 9.4-37b 9.4-37c 9.4-37d 9.4-38 9.4-39 9'-40 9~4-41 9.4-42 9'-43 9 4-44 9.4-44a 9.4-44b 9.4-45 9.4-46 9.4-46a 9.4-46b 9.4-47 9.4-47a 9.4-47b 9.4-48 9.4-49 9.4-50 9.4-51 9.4-52 9.4-53 9.4-54 9.4-54a A05 R04 A28 A24 A25 A25 R01 R01 R01 R03 R03 A22 A22 A22 A22 A22 A26 R01 R03 R03 R03 A22 A25 A23 R02 A23 R02 R02 R02 R02 R01 R02 R02 R02 R02 R02 R02 R02 AOO R01 A25 A23 A23 A23 A23 A23 9.4-54b 9.4-55 9.4-56 9.4-56a 9.4-56b 9.4-57 9.4-57a 9.4-57b 9.4-58 9.4-58a 9.4-58b 9.4-59 9.4-59a 9.4-59b 9.4-60 9.4-61 9.4-62 9.4-63 9.4-64 9.4-65 9.4-66 9.4-67 9.4-67a 9.4-67b 9.4-68 9.4-69 9.4-70 9.4-71 9.4-72 9.4-72a 9.4-72b 9.4-73 T 9.4-1 T 9.4-1 T 9.4-1 T 9 4-2 T 9'-2 T 9'-2 T 9.4-2 T 9.4-2 T 9'-2 T 9'-2 T 9.4-2 T 9.4-2 T 9'-2 T 9'-2 S11 1 S11 2 Sh 3 Sh 1 S11 2 S11 3 S11 4 S?1 5 S?1 6 S?1 7 S?1 8 Sh 9 Sh 10 Sh 11 A23 ROO ROO A24 A23 ROO A23 A23 A09 A24 ROO A25 A23 A23 A24 A26 A25 A23 A05 R03 R01 R04 A20 A20 AOO A23 A25 AOO A23 A23 A23 A24 R03 ROO R01 A26'03 A26 A26 A26 A26 A26 ROO R03 A26 R03 USAR Revision 4 EP 9-5 October 1992 t

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=FicFur e Amendment Number Page T=Table F F=icru re Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T T T T T T T T T T T T 9.4-2 9.4-2 9.4-2 9.4-3 9.4-3 9~4-3 9~4-3 9~4-3 9.4-3 9.4-3 9.4-3 9.4-3 9'-3 9.4-3 9.4-3 9'-4 9.4-4 9.4-4 9.4-4 9.4-4 9'-4 9.4-4 9.4-4 Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh T T T T T T T T T T T T T T T T T T 9.4-5 9.4-5 9~4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9.4-5 9~4-5 9~4-5 9~4-5 9~4-5 9~4-5 9.4-5 9.4-6 Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 9.4-4 Sh 12 13 14 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 5a 6 6a 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 A26 A26 A26 ROO ROO ROO A26 ROO ROO ROO ROO ROO ROO ROO A26 A26 A26 A26 R01 R01 R01 R03 R03 A26 A26 A26 ROO A26 ROO A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 A26 R02 T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F F F 9 4-6 Sh 2 9'-6 Sh 3 9 4-7 Sh 1 9-4-7 Sh 2 9-4-8 Sh 1 9'-8 Sh 2 9'-8 Sh 3 9'-8 Sh 4 9'-8 Sh 5 9'-8 Sh 6 9'-9 9 4-10 Sh 1 9.4-10 Sh 2 9'-11 Sh 1 9'-11 Sh 2 9-4-12 Sh 1 9'-12 Sh 2 9'-12 Sh 3 9.4-12 Sh 4 9.4-12 Sh 5 9.4-1a 9.4-1b 9.4-1c 9.4-1d 9.4-1e 9.4-1f 9.4-2a 9.4-2b 9.4-2c 9.4-2d 9.4-2e 9.4-3a 9.4-3b 9.4-3c 9.4-3d 9.4-3e 9.4-3f 9.4-4 Sh 1 9 4-4 Sh 2 9.4-4 Sh 3 9.4-4 Sh 4 9.4-4 Sh 5 9.'4-4 Sh 6 9'.4-4 Sh 7 9.4-4 Sh 8 9'-4 Sh 9 R02 R02 A26 A26 A26 A26 A26 ROO A26 A26 A26 A26 A26 A28 A28 A28 A28 A28 A28 A28 R04 R04 R03 ROO R04 ROO ROO R01 R02 ROO ROO ROO ROO ROO R01 ROO ROO R03 R03 R03 R03 R03 R03 ROO R03 R03 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9.4-5 Sh 9'-5 Sh 9.4-6 Sh 9'-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-6 Sh 9.4-7 Sh 9.4-7 Sh 9.4-7 Sh 9'-7 Sh 9 4-7 Sh 9'-7 Sh 9-4-7 Sh 9-4-7 Sh 9'-7 Sh 9'-7 Sh 9-4-7 Sh 9-4-7 Sh 9.4-7 Sh 9'-7 Sh 9'-8a 9.4-8b 9.4-8c 9'-8d 9.4-8e 9.4-8f 9.4-8g 9.4-8h 9.4-8j 9 4-8k 9.4-8L 9 4-9 Sh 9'-9 Sh 9.4-9 Sh 9'-9 Sh 9'-9 Sh 9'-9 Sh F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 2 3 4 5 6 R03 ROO R03 R03 ROO R03 ROO R01 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO ROO ROO R03 R03 R03 ROO ROO R03 R04 ROO ROO ROO ROO ROO R03 R03 R04 R03 R04 R03 R03 R03 R03 R03 R04 USAR Revision 4 EP 9-6 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 9.4-9 Sh 7 9.4-9 Sh 8 9.4-9 Sh 9 9.4-9 Sh 10 9.4-9 Sh 11 9.4-9 Sh 12 9.4-9 Sh 13 9.4-9 Sh 14 9'-9 Sh 15'.4-9 Sh 16 9.4-9 Sh 17 9'-9 Sh 18 9'-9 Sh 19 9'-9 Sh 20 9.4-9 Sh 21 9.4-9 Sh 22 9'-9 Sh 23 9'-9 Sh 24 9'-9 Sh 25 9.4-10a 9.4-10b 9'-10c 9'-10d 9.4-10e 9.4-11 Sh 1 9.4-11 Sh 2 9.4-11 Sh 3 9.4-11 Sh 4 9.4-11 Sh 5 9.4-11 Sh 6 9.4-11 Sh 7 9.4-11 Sh 8 9.4-11 Sh 9 9.4-11 Sh 10 9.4-11 Sh 11 9.4-11 Sh 12 9.4-11 Sh 13 F 9.4-11 Sh 14 F 9.4-11.sh 15 F 9.4-11 Sh 16 9.4-11 Sh 17 9.4-12a, 9'-12b 9.4-12c 9'-12d 9.4-13 Sh 1 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R01 R04 R03 ROO ROO ROO R04 ROO ROO ROO R04 R03 R03 R03 R03 R01 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R03 R03 R03 R02 ROO ROO R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9-Sh 10 Sh 11 Sh 12 Sh 1 Sh 2 Sh 3 a Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 9.4-13 9.4-13 9.4-13 9'-13 9.4-13 9.4-13 9.4-13 9.4-13 9'-13 9.4-13 9'-13 9.4-14 9~4-14 9.4-14 9.4-15 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-16 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9.4-17 9'-17 9.4-17 9.4-18 9'-18 9.4-18 9.4-18 9.4-19 9.4-19 9.4-19 9.4-20 9.4-20 R03 R03 R03 R03 R03 ROO ROO R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 F 9.4-20 Sh F 9.4-20 Sh F 9'-20 Sh F 9.4-21 Sh F 9.4-21 Sh F 9'-21 Sh F 9'-21 Sh F 9.4-22a F 9.4-22b F 9.4-22c F 9.4-22d F 9.4-22e F 9'-23 Sh F 9.4-23 Sh F 9'-23 Sh F 9.4-23 Sh F 9.4-23 Sh F 9'-23 Sh F 9.4-23 Sh 9.5-1 9.5-1a 9.5-1b 9.5-2 9.5-3 9.5-4 9.5-4a 9.5-4b, 9.5-5 9.5-5a 9.5-5b 9.5-6 9.5-6a 9.5-6b 9.5-7 9.5-8 9.5-9 9.5-10 9.5-11 9.5-12 9.5-12a 9.5-12b 9.5-13 9.5-14 9.5-15 9.5-16 R03 R03 R03 R03 R03 ROO R03 R04 ROO ROO ROO ROO R03 R03 R03 R03 ROO R03 R03 ROO ROO ROO R04 R04 R04 ROO A09 R02 R02 R02 R02 R02 A26 R04 R04 R04 A28 AOO R01 A23 A23 AOO R04 AOO ROO USAR Revision 4 EP 9-7 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F=Fi cpu re Number Page T=Table Amendment F=Ficrure Number 9.5-17 9.5-17a 9'-17b 9.5-18 9.5-18a 9'-18b 9'-19 9.5-19a 9'-19b 9'-20 9.5-20a 9.5-20b 9.5-21 9.5-22 9.5-22a 9.5-22a1 9.5-22a2 9.5-22b 9.5-22c 9'-22d 9.5-22e 9.5-22f 9.5-23 9.5-23a 9.5-23b 9.5-24 9.5-24.1 9.5-24.2 9.5-24a 9'-24b 9.5-24c 9.5-24d 9.5-25 9.5-25a 9.5-25b 9.5-26 9'-26a 9.5-26b 9.5-27 9.5-27a 9.5-27b 9.5-28 9.5-29 9.5-30 9.5-31 9.5-31a A24 A13 A07 ROO A23 A23 ROO ROO ROO ROO ROO A15 ROO A25 A23 R02 A21 R03 A26 A26 A18 A17 ROO ROO ROO A28 A28 A25 A13 A13 A13 A13 ROO ROO ROO R02 A20 A20 R01 ROO A20 ROO A21 ROO ROO A26 9.5-31b 9.5-32 9.5-33 9.5-33a 9.5-33b 9.5-34 9.5-35 9.5-35a 9.5-35b 9.5-.36 9.5-36a 9.5<<36b 9.5-37 9.5-37a 9.5-37b 9.5-38 9.5-38a 9.5-38b 9.5-39 9.5-40 9.5-40a 9.5-40b 9.5-41 9.5-41a 9.5-41b 9.5-42 9.5-42a 9.5-42b 9.5-43 9.5-43a 9.5-43b 9.5-44 9.5-44a 9.5-44b 9.5-45 9.5-45a 9.5-45b 9.5-46 9.5-47 9.5-47a 9.5-47b 9.5-48 9.5-49 9.5-49a 9.5-49b 9.5-50 A13 AOO R02 R02 A07 A24 A09 A09 A09 A09 A09 A09 R02 R04 R03 R01 ROO A20 R04 A23 A17 A07 A26 A09 A09 ROO ROO R02 R01 ROO ROO R03 A21 A08 ROO R01 A07 AOO ROO A07 A07 R02 R03 A19 A07 A13 9.5-50a 9.5-50b 9.5-51 9.5-51a 9.5-51b 9.5-51c 9.5-51d 9.5-52 9.5-52a 9.5-52b 9.5-53 9.5-54 9.5-55 9.5-55a 9.5-55b 9.5-56 9.5-57 9.5-57a 9.5-57b 9.5-58 9.5-58a 9.5-58b 9.5-59 9.5-60 9.5-61 9.5-61a 9.5-61b 9.5-62 9.5-63 9.5-64 9.5-65 9.5-66 9.5-67 9.5-67a 9.5-67b 9.5-68 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-1 T 9.5-2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 1 ROO A07 ROO ROO ROO ROO ROO A20 R02 A11 A23 A20 R04 A20 A07 AOO ROO R04 A07 ROO ROO A07 R04 ROO ROO ROO ROO R04 A18 A26 A27 ROO R04 R04 ROO ROO A08 A08 A08 A26 A23 R03 A26 R02 ROO AOO USAR Revision 4 EP 9-8 October 1992

~,>>

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 Page T=Table F=Ficrure Amendment Number Page T=Table F=FicFur e Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F F F F F F 9.5-2 Sh 2 9.5-2 Sh 3 9.5-2 Sh 4 9'-2 Sh 5 9.5-2 Sh 6 9.5-2 Sh 7 9'-2 Sh 8 9.5-3 Sh 1 9.5-3 Sh 2 9.5-3 Sh 3 9'-3 Sh 4 9'-3 Sh 4a 9.5-3 Sh 5 9.5-3 Sh 6 9'-3 Sh 7 9.5-3 Sh 8 9'-3 Sh 9 9.5-3 Sh 9a 9.5-3 Sh 9b 9 5-3 Sh 10 9'-3 Sh 11 9.5-3a 9.5-1a 9.5-1b 9.5<<1c 9.5-1d 9.5-1e 9.5-1f 9.5-1g 9'-1h 9.5-2a 9'-2b 9.5-3a 9.5-3b 9.5-3c 9.5-4a 9.5-5 Sh 1 9.5-5 Sh 2 9'-6 9'-7 9.5-8 Sh 1 9.5-8 Sh 2 9.5-9 Sh 1 9.5-9 Sh 2 9.5-10 Sh 1 9'-10 Sh 2 AOO A23R02 R03 A26 AOO AOO A26 A26 R03 R03 R03 A26 A26 A26 A26 R04 R04 R04 A26 A26 R03 ROO ROO R02 R03 R03 R03 R03 R02 R03 ROO R04 R04 R02 ROO R02 R02 R02 R04 R02 R02 R02 R02 R02 R02 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 9.5-11 9.5-12 9.5-13 9.5-14 9.5-15 9.5-16 9.5-17 9.5-18 9'-19 9.5-20 9.5-20 9.5-21 9.5-22 9.5-23 9.5-24 9.5-25 9.5-26 9.5-26 9.5-27 9.5-28 9.5-29 9.5-30 9.5-31 9.5-32 9.5-33 9.5-34 9.5-35 9.5-36 9.5-37 9.5-38 9.5-39 9.5-40a 9.5-40b 9.5-40c 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9.5-41 9'-41 9'-41 9.5-41 9.5-41 9'-41 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R02 R03 R03 R02 R02 R04 R02 R02 R04 R02 R02 R03 R02 R02 R02 R02 R02 R04 R04 R04 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R02 Sh 1 Sh 2 Sh 1 Sh 2 a b c Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 App 9A 9A-i 9A-ii 9A-iii 9A-iv 9A-v 9A-vi 9A-vii 9A-viii 9A.1-1 9A.2-1 9A.2-1a 9A.2-lb 9A.2-2 9A.2-3 9A.2-4 9A.2-5 9A.2-6 9A.3-1 9A.3-1a 9A.3-1b 9A.3-2 9A.3-3 F 9.5-42 F 9.5-43 F 9.5-44 F 9.5-44 F 9.5-45 F 9.5-46 F 9.5-47 F 9.5-48 F 9.5-48 F 9.5-49 F 9'-50 F 9.5-51 F 9'-52 F 9.5-52 F 9.5-52 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 F 9.5-53 A23 A07 A28 A28 A08 A28 A07 R01 R01 R04 R04 R04 R04 R04 R04 R03 R03 R03 R03 R03 R03 ROO A06 R03 ROO R01 ROO ROO R01 R03 R03 A06 ROO A24 A24 R02 R02 R04 A25 ROO R03 R04 A28 R04 R04 USAR Revision 4 EP 9-9 October 1992 A I' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 9 page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number 9A.3-4 9A.3-5 9A.3-6 9A.3-7 9A.3-7a 9A.3-7b 9A.3-8 9A.3-9 9A.3-10 9A.3-10a 9A.3-10b 9A.3-11 9A.3-12 9A.3-12a 9A.3-12b 9A.3-13 9A.3-14 9A.3-14a 9A.3-14b 9A.3-15 9A.3-16 9A.3-16a 9A.3-16b 9A.3-17 9A.3-17a 9A.3-17b 9A.3-18 9A.3-19 9A.3-20 9A.3-20a 9A.3-20b 9A.3-21 9A.3-22 9A.3-23 9A.3-24 9A.3-25 9A.3-26 9A.3-27 9A.3-28 9A.3-29 9A.3-29a 9A.3-29b 9A.3-30 9A.3-30a 9A.3-30b 9A.3-31 R03 ROO ROO R04 R02 A26 R01 ROO R01 A24 A24 ROO R02 A10 A10 ROO ROO'ROO ROO ROO R01 A24 A24 R01 ROO A23 ROO ROO A23 A23 A23 ROO A06 ROO ROO ROO A26 R04 A23 ROO A26 A26 A26 ROO A13 R04 9A.3-3 1a 9A.3-31b 9A.3-32 9A.3-33 9A.3-34 9A.3-35 9A.3-36 9A.3-37 9A.3-38 9A.3-39 9A.3-40 9A.3-40a 9A.3-40b 9A.3-41 9A.3-41a 9A.3-41b 9A.3-42 9A.3-42a 9A.3-42b 9A.3-43 9A.3-44 9A.3-44a 9A.3-44b 9A.3-45 9A.3-45a 9A.3-45b 9A.3-46 9A.3-47 9A.3-48 9A.3-48a 9A.3-48b 9A.3-49 9A.3-49a 9A.3-49b 9A.3-50 9A.3-50a 9A.3-50b 9A.3-50c 9A.3-50d 9A.3-50e 9A.3-50f 9A.3-51 9A.3-51a 9A.3-51b 9A.3-52 9A.3-52a R04 A14 R04 ROO ROO ROO ROO ROO ROO ROO R01 ROO ROO R01 R01 R01 R03 R04 A13 ROO ROO ROO A13 R04 A09 A09 ROO ROO A28 R04.A28 R02 R04 A13 A28 A28 A28 R04 A28 ROO A28 ROO A10 A10 R01 ROO 9A.3-52b 9A.3-52c 9A.3-52d 9A.3-53 9A.3-53a 9A.3-53b 9A.3-53c 9A.3-53d 9A.3-54 9A.3-55 9A.3-55a 9A.3-55b 9A.3-56 9A.3-57 9A.3-57a 9A.3-57b 9A.3-58 9A.3-59 9A.3-60 T 9A.3-1 T 9A.3-1 T 9A.3-1 T 9A.3-1 T 9A.3-2 T 9A.3-2 T 9A.3-2 T 9A.3-3 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-4 T 9A.3-5 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-6 T 9A.3-7 T 9A.3-7 T 9A.3-8 T 9A.3-8 T 9A.3-9 T 9A.3-9 T 9A.3-9 Sh 1 Sh 2 Sh 3 Sh 4 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 ROO R04 ROO A28 R04 R04 R04 A28 R04 R04 ROO A18 R03 ROO A17 A13 ROO R03 ROO ROO R02 R02 R02 ROO R02 ROO R01 ROO R01 R01 R01 R01 R04 R01 ROO R02 R01 R02 R02 ROO ROO ROO R02 R04 R02 R03 USAR Revision 4 EP 9-10 October 1992

-4~P Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 9 PAGES Page T=Table F=FicFure Amendment Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number Sh 1 Sh 2 T T T T T T T T T T T T T T T T T T T T T T T T T T T F F F F F F F F F F F F F F F F F F F 9A.3-10 9A.3-10 9A.3-11 9A.3-12 9A.3-13 9A.3-14 9A 3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-15 9A.3-16 9A.3-17 9A.3-17 9A.3-17 9A.3-18 9A.3-18 9A.3-18 9A.3-18 9A.3-18 9A-3-18 9A.3-18 9A.3-19 9A.3-20 9A.3-20 9A.3-21 9A.3-1 9A.3-2 9A.3-3 9A.3-4 9A.3-5 9A.3-6 9A.3-7 9A.3-8 9A.3-9 9A.3-10 9A.3-11 9A.3-12 9A.3-13.9A.3-14 9A.3-14 9A.3-15 9A 3-15 9A.3-16 9A 3-16 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 R01 ROO ROO R01 ROO A06 A26 A12 A26 A26 A26 A26 R03 A28 A28 R03 A28 R04 A28 A28 R03 A28 A28 R01 A28 A28 ROO R03 ROO R01 R04 R04 R04 R04 ROO A23 A23 A23 ROO ROO ROO A28 A28 A28 A28 A28 F 9A.3-17 Sh F 9A.3-17 Sh F 9A.3-18 F 9A.3-19 F 9A.3-20 F 9A.3-21 F 9A.3-22 F 9A.3-23 9B-1 App 9C 9C-i 9C-ii 9C-iii 9C.1-1 9C.2-1 9C-3-1 9C.3-2 9C.3-3 9C.3-4 9C.3-5 9C.3-6 9C.3-7 9C.3-8 9C.3-9 9C.3-10 9C.3-11 9C.3-12 T 3-1 Sh 1 T 3-1 Sh 2 T 3-2 Sh 1 T 3-2 Sh 2 T 3-2 Sh 3 T 3-2 Sh 4 T 3-3 Sh 1 T 3-3 Sh 2 T 3-3 Sh 3 T 3-4 T 3-5 9C.4-1 T 4-1 Sh 1 T 4-1 Sh 2 T 4-1 Sh 3 T 4-1 Sh 4-T 4-1 Sh 5 R03 A28 ROO A28 A28 A28 A28 R03 A04 ROO ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO R04 ROO ROO ROO ROO ROO ROO T 4-1 Sh 6 T 4-1 Sh 7 T 4-1 Sh 7a T 4-1 Sh 8 T 4-1 Sh 9 T 4-1 Sh 10 9C.5-1 F 5-1 F 5-2 F 5-3 F 5-4 Sh 1 F 5-4 Sh 2 9C.6-1 9C.7-1 9C.8-1 9C.8-2 9C.8-3 9C.8-4 9C.8-5 9C.9-1 9C.10-1 9C.10-2 9C.10-3 9C.10-4 9C.10-5 ROO ROO ROO ROO R04 ROO ROO R02 R02 ROO R03 R03 ROO ROO R03 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 9-11 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 10 Page T=Table Amendment F=Ficrure Number Page T=Table F F=icFure Amendment Number Page T=Table Amendment F Ficrure Number 10-i 10-ii 10-iii 10-iv 10-v 10-va 10-vb 10-vi 10.1-1 10'-2 10.1-3 T 10'-1 F 10.1-1 F 10.1-2 F 10.1-3a F 10.1-3b F 10.1-3c F 10.1-3d F 10.1-3e F 10.1-3f F 10.1-3g F 10.1-321 F 10.1-3j F 10.1-3k F 10.1-4a F 10.1-4b F 10.1-4c F 10.1-4d F 10.1-5a F 10.1-5b F 10.1-5c F 10.1-5d F 10.1-5e F 10.1-6a F 10.1-6b F 10.1-6c F 10.1-6d F 10.1-6e F 10.1-7a F 10.1-7b F 10.1-7c F 10.1-7d F 10.1-7e F 10.1-7f F 10.1-7g R04 A24 A24 R04 R03 ROO A24 R03 R03 AOO AOO R03 AOO R03 ROO ROO ROO ROO ROO R03 R03 R04 ROO R04 ROO ROO ROO ROO R03 R01 R04 R04 R03 R03 R04 R02 ROO ROO R01 R01 R01 ROO ROO R03 R03 F 10.1-7h F 10.1-7j F 10'-7k F 10.1-7L F 10.1-7m F 10.1-7n F 10.1-7p F 10.1-7q F 10.1-7r F 10.1-7s F 10.1-7t F 10.1-7u F 10.1-7w F 10.1-8a F 10.1-8b F 10.1-8c F 10.1-8d F 10.1-8e F 10.1-8f F 10.1-8g F 10.1-9a F 10.1-9b F 10.1-9c F 10.1-9d F 10.1-9e F 10.1-9f F 10.1-9g F 10.1-9?1 10.2-1 10.2-2 10.2-3 10.2-3a 10.2-3b 10.2-4 10.2-5 10.2-5a 10.2-5b 10'-6 10.2-7 10.2-7a 10.2-7b 10.2-7c 10.2-7d 10.2-8 10.2-9 ROO ROO ROO ROO R04 ROO R03 R03 R03 ROO ROO ROO ROO R03 ROO R03 ROO ROO ROO ROO ROO ROO ROO R04 ROO ROO ROO ROO R03 R04 R04 R04 A07 R03 R04 R04 ROO R04 R04 R04 R04 R04 R04 A23 AOO 10.2-10 10.2-11 10.2-12 T 10.2-1 T 10.2-1 T 10.2-1 F 10.2-1 F 10.2-2 F 10.2-3 F 10.2-3 F 10'-3 10.3-1 10.3-1a 10.3-1b 10.3-2 10.3-3 10.3-3a 10.3-3b 10'-4 10.3-5 10.4-1 10.4-2 10'-3 10.4-3a 10.4-3b 10.4-4 10.4-4a 10.4-4b 10.4-5 10.4-6 10.4 7 10.4-7a 10.4-7b 10'-8 10'-9 10.4-10 10.4-11 10.4-12 10~4-13 10.4-14 10.4-15 10.4-16 10.4-17 10.4-17a S?1 1 Sh 2 S11 3 S?1 1 Sh 2 Sh 3 R02 R02 AOO R04 R04 R04 AOO AOO R03 A07 A07 A05 A05 A05 A27 R04 ROO A05 AOO A23 AOO ROO A21 A06 A06 A28 R03 A06 AOO AOO R01 A21 A21 ROO A27 A21 A21 AOO AOO R03 ROO AOO ROO ROO USAR Revision 4 EP 10-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 10 Page T=Table F=Ficpure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number 10.4-17b 10.4-18 10.4-19 10.4-19a 10.4-19b 10.4-20 10.4-21 10.4-22 10.4-23 10.4-23a 10.4-23b 10.4-24 10.4-25 10.4-25a 10.4-25b 10.4-26 10.4-26a 10.4-26b 10.4-27 10.4-28 10.4-28a 10.4-28b 10.4-29 10.4-30 10.4-31 10.4-32 10.4-33 10.4-33a 10.4-33b 10.4-34 10.4-34a 10.4-34b 10'-35 10 4-36 10.4-37 10.4-38 10.4-39 T 10.4-1 T 10.4-2 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-1 F 10.4-2a F 10.4-3 S11 S11 Sh Sb S11 S?1 ROO A18 A28 A28 A18 AOO AOO AOO A26 A05 A05 R01 A10 A05 A05 A21 A05 A05 ROO R03 A14 A07 ROO AOO AOO R02 R02 A25 A20 ROO A20 A20 AOO AOO AOO A24 AOO ROO A27 R03 R03 ROO R03 R03 R03 R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 10.4-3 S11 2 10.4-3 Sh 3 10.4-3 Sh 4 10'-3 Sh 5 10 4-4 10'-5 10.4-6 10.4-7a 10.4-7b 10.4-7c 10.4-7d 10.4-7e 10.4-7f 10.4-7g 10.4-74 10.4-8 Sh 1 10.4-8 S11 2 10.4-8 S?1 3 10.4-8 S11 4 10.4-8 S11 5 10.4-8 S11 6 10.4-8 Sh 7 10.4-8 Sh 8 10.4-8 Sh 9 10.4-8 Sh 10 10.4-9 Sh 1 10.4-9 Sh 2 10.4-9 S11 3 10.4-9 Sh 4 10.4-9 Sh 5 10.4-9 Sh 6 10.4-9 S11 7 10.4-9 Sh 8 10.4-9 Sh 9 10.4-9 Sh,:10 10.4-10 Sh 1 10.4-10 SN 2 10.4-10 Sh 3 10.4-10 Sh 4 10.4-10 Sh 5 10.4-10 Sh 6 10.4-10 S?1 7 10.4-10 S?1 8 10.4-10 Sh 9 10.4-10 Sh 10 10.4-10 Sh 11 R03 R03 R03 R03 AOO AOO AOO ROO ROO ROO R02 ROO ROO ROO ROO R03 ROO R03 R03 R03 R03 ROO R03 R01 ROO R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 ROO ROO ROO ROO ROO ROO ROO ROO R03 R03 R03 F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-10 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-11 10.4-12 10.4-12 10.4-12 10.4-12 10.4-12 10.4-12 10'-12 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 10.4-13 Sh 12 Sh 13 Sh 14 S?1 15 S?1 16 Sh 17 Sh 18 Sh 19 Sh 20 S?1 21 S11 22 S?1 23 S?1 1 S?I 2 S?1 3 S?1 4 S11 5 S?1 6 Sh 7 Sh 8 Sjl 9 S?1 1 S?1 2 S?1 3 S?1 4 S?1 5 Sh 6 Sh 7 S?1 1 S?1 2 S11 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 R03 R03 ROO ROO ROO R03 ROO R03 R03 ROO R03 R04 R03 R03 R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO USAR Revision 4 EP 10-2 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 11 Page T=Table Amendment g"=Figure Number Page T=Table Amendment Page T=Table Amendment F=FicFure Number 11-i 11 ii 11-iia 11-iib 11 iil 11-iv 11-v ll-vi ll.1-1 11.1-2 11~1-3 11.1-4 11.1-5 11.1-6 1 1~1 7 11.1-8 11.1-9 11.1-10 11.1-11 11.1-12 11.1-13 11.1-14 11.1-15 T 11.1-1 T 11.1-1 T 11 1-1 T 11.1-2 T 11.1-3 T 11.1-4 T 11.1-5 T 11.1-6 T 11 F 1-7 T 11.1-8 F 11 F 1-1 F 11.1-2 F 11.1-3 11.2-1 11.2-2 11'-3 1 1~2 3a 11.2-3b 11.2-4 11.2-4a 11.2-4b Sh 1 Sh 2 Sh 3 A24 A24 A23 A23 ROO AOO A08 R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO AOO AOO AOO A23 A19'19 R01 AOO AOO AOO AOO AOO AOO A23 ROO A23 A23 A23 ROO A05 A05 11.2-5 11.2-5a 11.2-5b 11'-6 11.2-6a 11.2-6b 1 1~2 7 11.2-8 11.2-9 11.2-10 11.2-11 11.2-12 11.2-13 11.2-14 11.2-14a 11.2-14b 11.2-15 11.2-16 11.2-17 11.2-18 T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-1 Sh T 11.2-2 T 11.2-3 T 11.2-4 T 11.2-5 Sh T 11.2-5 Sh T 11.2-6 Sh T 11.2-6 Sh F 11.2-1a F 11.2-1b F 11.2-1c F 11.2-ld F 11.2-1e F 11.2-1f F 11.2-1g F 11.2-1h F 11.2-1j F 11.2-lk F 11.2-1L F 11.2-1m 11.3-1 A05 ROO" A05 ROO A05 A05 ROO ROO ROO ROO A23 ROO ROO ROO ROO A23 A23 AOO R04 ROO ROO R02 ROO R02 A25 ROO ROO AOO A27 A27 A27 A27 R03 ROO ROO ROO ROO R02 ROO R02 R01 ROO ROO R03 A03 11.3-1a 11.3-1b 1 1~3 2 11.3-2a 11.3-2b 1 1%3 3 11.3-4 11.3-5 11.3-5a 11.3-5b 11.3-6 1 1~3 7 11.3-7a 11.3-7b 11.3-8 11.3-9 T 11.3-1 Sh T 11.3-1 Sh T 11 3-2 Sh T 11.3-2 Sh T 11.3-3 Sh T 11 3-3 Sh F 11.3-1a F 11 3-lb F 11.3-1c F 11.3-2 11.4-1 11.4-1a 11.4-1b 11.4-2 11.4-2a 11.4-2b 11.4-3 11.4-3a 11.4-3b 11.4-4 11.4-4a-11.4-4b 11.4-5 11.4-6 T 11.4-1 T 11.4-2 T 11.4-3 Sh T 11 4-3 Sh T 11.4-3 Sh A03 A03 ROO A23 A05 A23 A23 R02 R04 A05 A24 A09 R04 A09 A12 A12 A12 AOO ROO ROO A12 A12 R04 R04 ROO R04 A03 A03 A03 ROO ROO A08 ROO Rol ROO ROO Rol A23 Rol ROO Rol ROO A26 A26 AOO USAR Revision 4 EP 11-1 October 1992 V II Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 11 PAGES Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T 11 4-3 Sh 4 T 11.4-3 Sh 5 T 11.4-4 Sh 1 T 11.4-4 Sh 2 T 11.4-5 T 11.4-6 T 11.4-7 F 11.4-1a F 11.4-1b F 11.4-1c F 11.4-1d F 11.4-1e F 11.4-1f F 11.4-1g F 11.4-1h 11.5-1 11.5-2 11.5-2a 11.5-2b 11.5-3 11.5-3a 11.5-3b 11.5 4 11.5-5 11.5-5a 11.5-5b 11.5-6 11.5-7 11.5-8 11.5-9 11.5-10 11.5-10a 11.5-10b 11.5.-11 11.5-11a 11.5-11b 11.5-12 11.5-12a 11.5-12b 11.5-13 11.5-14 T 11.5-1 Sh 1 T 11.5-1 Sh 2 T 11.5-1 Sh 2a T 11.5-2 Sh 1 A26 A26 R04 R04 A08 A08 A08 R01 R03 ROO ROO ROO ROO ROO ROO A23 A23 ROO A23 A23 A23 A23 A23 A23 A23 A23 A23 R04 A23 A23 A23 A23 A23 R01 A25 A23 A23 A07 A07 A28 A23 ROO ROO ROO AOO T 11 5-2 Sh 2 T 11.5-2 Sh 3 T 11.5-2 Sh 4 F 11.5-1 F 11.5-2 F 11.5-3a F 11.5-3b F 11.5-3c F 11.5-3d F 11.5-4 F 11.5-5 F 11.5-6 F 11.5-7 F 11.5-8 Sh 1 F 11.5-8 Sh 2 App 11A 11A-i llA-ii 11A.1-1 11A.1-2 T llA.l-l T 11A.1-2 T 11A.1-3 T 11A.1-4 T 11A.1-5 T llA.1-6 T llA.1-7 T 11A.1-8 T 11A.1-9 T 11A.1-10 T 11A.1-11 T 11A.1-12 T 11A.1-13 T 11A.1-14 T 11A.1-15 T 11A.1-16 T 11A.1-17 T 11A.1-18 T 11A.1-19 11A.2-1 11A.2-2 T 11A.2-1 T 11A.2-2 AOO ROO AOO ROO ROO R03 ROO ROO R03 A23 AOO R04 ROO AOO AOO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO AOO ROO AOO AOO AOO AOO AOO A25 A25 A25 AOO ROO ROO ROO ROO AOO ROO ROO USAR Revision 4 EP 11-2 October 1992 F 4 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page T=Table F=FBFur e Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 12-i 12 ii 12-lii 12-iv 12-iva 12-ivb 12-v 12-vi 12-vii 12-viia 12-viib 12-viii 12-ix 12-x 12-xi 12-xii 12.1-1 12'-2 12 F 1-3 12'-4 12.1-5 12.1-6 12'-7 12.1-8 12'-9 12.1-9a 12.1-9b 12.1-10 12.1-11 12.1-12 12.1-13 12.1-13a 12.1-13b 12.1-14 12.1-14a 12'-14b 12.1-15 12.2-1 12.2-1a 12.2-1b 12.2-2 12'-3 12.2-4 12.2-5 R03 A24 ROO R03 A24 A12 R03 R01 A24 A24 A24 R02 R02 ROO ROO ROO R03 R03 AOO AOO R03 ROO R03 R03 R03 A09 A09 AOO AOO AOO A07 A07 A07 A07 A07 A07 AOO A11 All A11 AOO A11 A11 ROO 12.2-6 1 2~2 7 12.2-8 12.2-8a 12.2-8b 12.2-9 12.2-10 12.2-11 12.2-12 12.2-13 12.2-14 12.2-15 12.2-16 T 12.2-1 T 12.2-2 T 12.2-3 T 12.2-4 Sh 1 T 12.2-4 Sh 2 T 12.2-4 Sh 3 T 12.2-5 Sh 1 T 12.2-5 Sh 2 T 12.2-6 Sh 1 T 12.2-6 Sh 2 T 12.2-6 Sh 3 T 12.2-7 Sh 1 T 12.2-7 Sh 2 T 12.2-8 Sh 1 T 12.2-8 Sh 2 T 12.2-9 T 12.2-10 Sh 1 T 12.2-10 Sh 2 T 12.2-10 Sh 3 T 12.2-11 T 12.-2-12 Sh 1 T 12.2-12 Sh 2 T 12.2-12 Sh 3 T 12.2-13 Sh 1 T 12.2-13 Sh 2 T 12.2-13 Sh 3 T 12.2-14 T 12.2-15a T 12.2-15b T 12.2-16 1 2~3 1 1 2~3 2 AOO R02 A09 A09 A09 R03 A25 R04 A07 A07 A09 A09 A11 ROO ROO ROO ROO ROO R01 A09 A09 R01 ROO AOO ROO R01 AOO AOO R01 R01 R01 R01 AOO R01 R01=R01 R01 R01 ROO A07 ROO ROO A11 AOO AOO 1 2~3 3 12.3-4 12.3-5 12.3-6 12~3 7 12~3 7a 12.3-7b 12.3-8 12.3-9 12.3-10 12.3-11 12.3-11a1 12.3-11b1 12.3-11a 12.3-11b 12.3-11c 12.3-11d 12.3-11e 12.3-11f 12.3-12 12.3-13 12.3-14 12.3-15 12.3-15a 12.3-15b 12.3-16 12.3-17 12.3-18 12.3-19 12.3-20 12.3-21 12 3-22 12 e 3 23 12.3-23a 12'-23b 12.3-24 12.3-25 12.3-26 12.3-27 12.3-28 12.3-29 12.3-30 12.3-30a 12.3-30b 12~3-3 1 12.3-31a AOO ROO AOO AOO ROO ROO ROO AOO R02 R04 R03 R02 A20 A13 A13 ROO ROO ROO A13 ROO R02 AOO R02 A05 A05 AOO AOO A01 AOO R01 AOO A10 A10 A10 A10 ROO A10 AOO AOO A10 ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 12-1'ctober 1992 e~

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 12.3-31b 12~3 32 12~3 33 T 12'-1 Sh 1 T 12.3-1 Sh 2 T 12'-1 Sb 3 T 12.3-1 S11 4 T 12.3-2 Sh 1 T 12.3-2 Sh 2 T 12.3-2 S11 3 T 12'-3 Sb 1 T 12'-3 S11 2 T 12.3-4 S?I 1 T 12 3-4 S?1 2 T 12'-4 S?1 3 T 12.3-4 S?1 4 F 12'-1 F 12.3-2 F 12.3-3 F 12.3-4 F 12.3-5 F 12.3-6 F 12.3-7 F 12.3-8 F 12.3-9 F 12.3-10 F 12.3-11 F 12.3-12 F 12.3-13 F 12.3-14 F'12.3-15 F 12.3-16 F.12.3-17 F 12.3-18 F 12.3-19 F 12.3-20 F 12.3-21 F 12.3-22 F 12'-23 F 12'-24 F 12.3-25 F 12.3-26 F 12.3-27 F 12.3-28 F 12.3-29 F 12.3-30 ROO ROO AOO ROO ROO A24 R01 ROO ROO ROO ROO ROO R01 R01 ROO ROO R03 R02 R03 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 R03 R02 R02 R04 R02 R02 R02 R03 R02 R02 R02 R02 R02 R02 R02 R02 R03 F 12.3-30a F 12.3-31 F 12.3-32 F 12.3-33 F 12.3-34 F 12.3-35 F 12.3-36 F 12.3-37 F 12.3-38 F 12.3-39 F 12'-40 F 12.3-41 F 12.3-42 F'2.3-43 F 12 3-44 F 12.3-45 F 12.3-46 F 12.3-47 F 12.3-48 F 12.3-49 F 12'-50 F 12.3-51 F 12.3-52 F 12.3-53 F 12.3-54 F 12.3-55 F 12.3-56 F 12.3-57 F 12.3-58 F 12.3-59 F 12.3-60 F 12.3-61 F 12.3-62 F 12.3-63 F 12.3-63a F 12.3-64 F 12.3-65 F 12.3-66 F 12.3-67 F 12.3-68 F 12.3-69 S?1 1 F 12.3-69 S?1 2 F 12.3-69 Sh 3 F 12.3-69 S?1 4 12.4-1 R02 R02 R02 R02 R03 R02 R03 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 R03 R02 R02 R04 R02 R02 R02 R03 R02 R02 R02 R02 R02 R02 R02 R02 R03 R02 R02 R02 R02 ROO AOO ROO ROO ROO R03 ROO 12.4-1a 12.4-1b 12.4-1c 12.4-1d 12.4-2 12.4-2a 12.4-2b 12.4-3 T 12'-1 T 12.4-2 T 12 4-3 T 12.4-4 T 12.4-5 T 12.4-6 T 12'-7 S?1 1 T 12.4-7 S?1 2 T 12.4-8 T 12 4-9 T 12.4-10 T 12.4-11 T 12.4-12 T 12.4-13 12.5-1 12.5-2 12.5-3 12.5-4 12.5-5 12.5-6 12.5-7 12.5-7a 12.5-7b 12.5-8 12.5-9 12.5-10 12.5-11 12.5-12 12.5-13 12.5-14 12.5-14a 12.5-14b 12.5-15 12.5-16 12.5-17 12.5-18 12.5-19 A15 ROO A24 A15 A12 A12 A12 ROO ROO ROO ROO ROO ROO A20 A20 A20 A20 A20 ROO A20 A15 A15 R03 R03 A26 R01 ROO AOO A01 R04 A01 AOO R04 A01 AOO AOO R03 R03 A05 A05 R04 R03 R03 ROO R03 USAR Revision 4 EP 12-2 October 1992 P~

Nine Mile Paint Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 12 Page Page Page T=Table.Amendment T=Table Amendment, T=Table Amendment F=FicFure Number F~FicFure Number F=FicFure Number 12.5-20 T 12.5-1 T 12.5-2 T 12.5-3 T 12.5-4 A26 R01 ROO A05 A01 USAR Revision 4 EP 12-3 October 1992

~t Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table F=Fictu re Amendment Number Page T=Table Amendment F Ficrure Number Page T=Table Amendment F=FicFure Number 13-i 13 11 13-iii 13-iv 13-iva 13-ivb 13-v 13-vi 13-vii 13-viii 1 3~1 1 13.1-2 13.1-2a 13.1-2b 13'-3 13'-3a 13.1-3b 13 1-4 13.1-4a 13.1-4b 13.1-5 13.1-5a 13.1-5b 13.1-6 T 13'-1 T 13.1-2 T 13'-3 T 1301-3 T 13.1-3 T 1301-3 T 13.1-3 T 13.1-3 T 13'-3 T 13.1-3 T 1 3~1 3 T 13~1-3 T 13.1-4 T 13 1-4 T 13.1-4 T 13.1-4 T 13.1-4 T 13.1-5 F 13.1-1 F 13.1-1a F 13.1-2 Sh Sh sh Sh Sh Sh Sh sh sh Sh Sh Sh sh Sh Sh 1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 ROO ROO ROO R03 ROO A09 R04 ROO R03 R03 A28 R03 R03 A09 R03 R03 A09 ROO ROO A01 R03 R03 A09 A28 R03 R04 R04 R04 R04 R03 R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 R03 A28 R03 R03 R03 F 13'-3 F 13.1-3a F 13.1-4 F 13.1-4a F 13.1-5 F 13.1-5a F 13.1-5b F 13.1-6 F 13.1-7 F 13'-8 F 13.1-9 F 13.1-10 1 3~2 1 13.2-2 1302-3 13.2-4 13.2-5 13.2-6 1 3~2 7 13.2-8 13.2-9 13.2-10 13.2-11 13.2-12 13~2 13 13.2-14 13.2-15 13.2-16 13.2-17 13.2-18 13.2-19 13.2-20 13.2-21 13.2-22 13~2 23 13.2-24 13.2-25 13.2-26 13.2-27 13.2-28 13.2-29 13.2-30 13'-31 13.2-32 13'-33 R04 R03 R03 R03 R03 A13 R03 R03 R03 R03 R03 R03 R03 ROO ROO ROO R03 ROO R03 ROO R03 R03 R03 R03 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO R03 ROO R03 13.2-34 13.2-35 13.2-36 13~2 37 13.2-38 13.2-39 13'-40 T 13'-1 F 13.2-1 13~3 1 13~3 2 13.4-1 13.4-2 13.4-2a 13.4-2b 13.4-3 13.4-4 T 13.4-1 T 13.4-2 Sh T 13.4-2 Sh T 13.4-2 Sh T 13.4-3 Sh T 13.4-3 Sh T 13.4-3 Sh F 13.4-1 13.5-1 13.5-2 13.5-3 13.5-3a 13.5-3b 13.5-4 13.5-4a 13.5-4b 13.5-5 13.5-6 13.5-7 T 13.5-1 Sh T 13.5-1 Sh T 13.5-2 T 13.5-3.sh T 13.5-3 Sh T 13'-3 Sh T 13.5-4 ROO ROO ROO ROO R03 R03 ROO ROO A28 ROO ROO R03 R04 R04 R03 R04 ROO.R03 ROO R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 A06 R03 A06.A06 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 USAR Revision 4 EP 13-1 October 1992 r

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table Amendment F=F icrure Number Page T=Table Amendment F=Ficrure Number Page T=Table Amendment F Ficrure Number T 13~5-5 T 13'-6 SB 1 T 13.5-6 Sh 2 T 13 5-6 Sh 3 T 13.5-6 S11 4 T 13.5-6 Sh 5 T 13.5-7 F 13.5-1 13.6-1 App 13A 13A-1 13A-2 13A-3 13A-4 13A-5 13A-6 13A-7 13A-8 13A-9 13A-10 13A-11 13A-12'3A-13 13A-14 13A-14a 13A-14b 13A-14c 13A-14d 13A-14e 13A-14f 13A-14g 13A-1421 13A-14i 13A-14j 13A-14k 13A-14L 13A-14m 13A-14n 13A-14o 13A-14p 13A-14'3A-14r 13A-14s 13A-14t A22 A23 ROO ROO R02 R03 R03 AOO R04 AOO AOO A16 A16 A16 AOO AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 13A-14u 13A-14v 13A-15 13A-16 13A-17 13A-18 13A-19 13A-19a 13A-19b 13A-20 13A-21 13A-22 13A-23 13A-24 13A-25 13A-26 13A-27 13A-28'3A-29 13A-30 13A-31 13A-32 13A-33 13A-34 13A-35 13A-36 13A-37 13A-38 13A-39 13A-40 13A-41 13A-41a 13A-41b 13A-42 13A-43 13A-43a 13A-43b 13A-43c 13A-43d 13A-44 13A-45 13A-46 13A-47 13A-48 13A-49 13A-50 A17 A17 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO AOO A16 A16 AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO A16 A16 A16 A16 AOO 13A-51 13A-52 13A-53 13A-54 13A-55 13A-56 13A-57 13A-58 13A-59 13A-60 13A-61 13A-62 13A-63 13A-64 13A-65 13A-66 13A-67 13A-68 13A-68a 13A-68b 13A-68c 13A-68d 13A-69 13A-70 13A-71 13A-72 13A-72a 13A-72b 13A-72c 13A-72d 13A-72e 13A>>72 f 13A-72g 13A-72?1 13A-72i 13A-72j 13A-72k 13A-72L 13A-72m 13A-72n 13A-72o 13A-72p 13A-73 13A-74 13A-74a 13A-74b AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A09 A09 A17 A17 AOO A16 A16 AOO A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A16 A16 A16 A16 USAR Revision 4 EP 13-2 October 1992 I p Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 13 Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number 13A-75 13A-76 13A-77 13A-78 13A-79 13A-80 13A-81 13A-82 13A-83 13A-83a 13A-83b 13A-84 13A-85 13A-86 13A-87 13A-88 13A-89 13A-90 13A-91 13A-92 13A-93 13A-94 13A-95 13A-96 13A-97 13A-98 13A-99 13A-100 13A-101 13A-102 13A-103 13A-104 13A-105 13A-106 13A-107 13A-108 13A-109 13A-110 13A-111 13A-112 13A-112a 13A-112b 13A-113 13A-114 13A-115 13A-116 A16 A16 A16 AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A16 A16 A16 A16 A16 AOO AOO AOO AOO 13A-117 13A-118 13A-119 13A-120 13A-121 13A-122 13A-123 13A-124 13A-124a 13A-124b 13A-124c 13A-124d 13A-125 13A-126 13A-127 13A-128 13A-129 13A-129a 13A-129b 13A-129c 13A-129d 13A-129e 13A-129f 13A-129g 13A-129'3A-129i 13A-129j 13A-129k 13A-129L 13A-130 13A-130a 13A-130b 13A-131 13A-132 13A-133 13A-134 13A-135 13A-136 13A-137 App 13B 13B-1 AOO A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 A16 AOO AOO AOO AOO AOO A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A17 A16 A16 A16 AOO AOO AOO A16 A16 A16 A16 AOO AOO USAR Revision 4 EP 13-3 October 1992 0 6 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 14 PAGES Page T=Table F=FicFure Amendment Number Page T=Table F=Ficpure Amendment Number Page T=Table F=F icFure Amendment Number 14-i 14-ii 14-iia 14-iib 14-111 14-iv 14-v 14-vi 14-vii 14-viii 14-ix 14-x 14-xl 14-xia 14-xib 14-xll 14.1-1 14.2-1 14.2-2 14'-3 14.2-4 14.2-5 14.2-6 14.2-7 14.2-8 14.2-9 14.2-10 14.2-11 14.2-12 14.2-13 14.2-14 14.2-15 14.2-16 14.2-17 14.2-18 14.2-19 14.2-20 14.2-21 14'-22 14'-23 14.2-24 14.2-25 14.2-26 14.2-27 A28 A22~A28 A22 ROO ROO ROO ROO ROO ROO ROO A28 ROO A28 A16 ROO AOO A22 A22 A22 A22 A28 A25 ROO ROO A25 ROO A28 ROO A22 ROO A22 ROO A22 A22.A22 ROO A22 A22 ROO A22 ROO ROO A22 14.2-28 14.2-29 14'-30 14.2-31 14.2-31a 14'-31b 14'-32 14.2-33 14.2-34 14'-35 14.2-36 14.2-37 T 14.2-1 Sh 1"T 14.2-1 Sh 2 T 14-2-1 Sh 3 T 14.2-1 Sh 4 T 14.2-1 Sh 5 T 14.2-1 Sh 6 T 14.2-1a Sh 1 T 14.2-1a Sh 2 T 14.2-la Sh 3 T 14.2-1a Sh 4 T 14.2-1b Sh 1 T 14.2-1b Sh 2 T 14.2-1b Sh 3 T 14.2-1b Sh 4 F 14.2-lb-1 T 14.2-2 Sh 1 T 14.2-2 Sh 2 T 14.2-3 Sh 1 T 14.2-3 Sh 2 T 14.2-4 T 14.2-5 Sh 1 T 14.2-5 Sh 2 T 14.2-6 T 14.2-7 Sh 1 T 14.2-7 Sh 2 T 14.2-8 Sh 1 T 14.2-8 Sh 2 T 14.2-9 Sh 1 T 14.2-9 Sh 2 T 14.2-10 Sh 1 T 14.2-10 Sh 2 T 14.2-11 Sh 1 T 14.2-11 Sh 2 T 14.2-12 Sh 1 A22 R01 ROO A28 A28 A28 R01 A28 A28 ROO ROO A28 ROO ROO ROO ROO ROO A22 ROO ROO ROO ROO ROO ROO ROO ROO ROO A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-12 14.2-13 14.2-13 14.2-14 14.2-15 14.2-15 14.2-16 14.2-16 14.2-17 14.2-17 14.2-18 14.2-19 14.2-19 14'-20 14.2-20 14.2-21 14.2-21 14.2-22 14.2-22 14'-23 14.2-23 14.2-24 14.2-25 14.2-25 14.2-26 14.2-26 14.2-27 14.2-27 14.2-28 14.2-28 14.2-29 14'-29 14.2-30 14.2-30 14.2-31 14 2-31 14'-32 14.2-32 14'-33 14.2-33 14.2-34 14.2-34 14'-35 14'-35 14'-36 14.2-36 Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A25 A25 A24 A22 A22 A22 A24 A22 USAR Revision 4 EP 14-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T='Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 14.2-37 14.2-37 14.2-38 14.2-38 14'-39 14.2-39 14 2-40 14.2-40 14.2-41 14'-41 14.2-42 14.2-42 14.2-43 14.2-43 14~2-43A 14.2-44 14.2-44 14'-45 14.2-45 14.2-46 14.2-46 14.2-47 14.2-47 14.2-48 14'-48 14'-49 14.2-49 14'-50 14.2-50 14.2-51 14.2-51 14.2-52 14.2-52 14.2-53 14.2-53 14.2-54 14.2-54 14.2-55 14'-55 14.2-56 14.2-56 14'-57 14'-57 14.2-58 14'-58 14.2-43A A22 A22 A24 A22 A24 A22 A24 A22 A28 A28 A24 A22 A24 A22 ROO A26 A24 A22 A22 A22 A24 A22 A24 A26 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-59 14.2-59 14.2-60 14.2-60 14'-61 14.2-61 14.2-62 14.2-62 14.2-63 14.2-63 14.2-64 14.2-64 14.2-65 14.2-65 14.2-66 14.2-66 14.2-67 14.2-67 14.2-68 14.2-68 14.2-69 14.2-69 14.2-70 14.2-70 14.2-71 14.2-71 14.2-72 14.2-72 14.2-73 14.2-73 14.2-74 14.2-74 14.2-75 14.2-75 14.2-76 14.2-76 14.2-77 14.2-77 14.2-78 14.2-78 14.2-79 14.2-79 14.2-80 14.2-80 14.2-81 14.2-81 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 A24 A22 A24 A22 A24 A22 A24 A22 A28 A28 A24 A22 A24 A22 A22 A22 A24 A22 A24 A22 A24 A22 A22 A22 A24 A22 A24 A22 A25 A25 A26 A26 A24 A22 A26 A22 A24 A28 A24 A22 A24 A22 A24 A22 A24 A22 T 14 2-82 Sh 1 T 14.2-82 Sh 2 T 14'-83 Sh 1 T 14.2-83 Sh 2 T 14.2-84 Sh 1 T 14.2-84 Sh 2 T 14.2-85 Sh 1 T 14.2-85 Sh 2 T 14.2-86 Sh 1 T 14.2-86 Sh 2 T 14.2-87 Sh 1 T 14.2-87 Sh 2 T 14.2-88 Sh 1 T 14'-88 Sh 2 T 14.2-89 Sh 1 T 14'-89 Sh 2 T 14.2-90 Sh 1 T 14.2-90 Sh 2 T 14.2-91 Sh 1 T 14.2-91 Sh 2 T 14.2-92 Sh 1 T 14.2-92 Sh 2 T 14.2-93 Sh 1 T 14 2-93 Sh 2 T 14.2-94 Sh 1 T 14.2-94 Sh 2 T 14.2-95 Sh 1 T 14.2-95 Sh 2 T 14.2-96 Sh 1 T 14 2-96 Sh 2 T 14.2-97 Sh 1 T 14.2-97 Sh 2 T 14.2-98 Sh 1 T 14.2-98 Sh 2 T 14'-99 Sh 1 T 14.2-99 Sh 2 T 14 2-100 Sh 1 T 14.2-100 Sh 2 T 14.2-101 Sh 1 T 14.2-101 Sh 2 T 14.2-102 Sh 1 T 14.2-102 Sh 2 T 14.2-103 Sh 1 T 14.2-103 Sh 2 T 14.2-104 Sh 1 T 14.2-104 Sh 2 A24 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A22 A22 A22 A22 A22 A22 A22 A22 A24 A22 A24 A24 A24 A26 A24 A22 A24 A22 USAR Revision EP 14-2 October 1992

~\~1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T=Table F FicFure Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table F=FicFure Amendment Number T T T T T T T T T T T T 14.2-105 14.2-105 14.2-106 14.2-106 14.2-107 14.2-107 14.2-108 14.2-108 14.2-109 14.2-109 14.2-110 14.2-110 T 14.2-111 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T 14.2-111 14.2-112 14.2-112 14.2-113 14.2-113 14.2-114 14'-114 14.2-115 14 2-115 14.2-116 14.2-117 14.2-117 14'-118 14.2-118 14.2-119 14.2-119 14.2-120 14.2-120 14 2-121 14'-121 14.2-122 14.2-122 14.2-123 14.2-123 14.2-124 14.2-124 14.2-125 14'-125 14.2-125 T 14.2-126 T 14.2-126 14.2-126 14.2-127 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 1 Sh 2 Sh 3 Sh 1 Sh 2 A25 A22 A24 A22 A24 A22 A24 A22 A26 A22 A24 A22 A17 A17 A25 A25 A24 A22 A24 A22 A24 A22 A24 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A24 A22 A22 A22 A24 A22 A22 A24 A22 Sh 2a A22 Sh 1 A22 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F T T T 14.2-127 14.2-128 14 2-128 14.2-129 14.2-129 14.2-129 14.2-130 14'-130 14.2-131 14.2-132 14.2-201 14.2-201 14.2-202 14.2-202 14.2-203 14.2-203 14.2-204 14.2-204 14.2-205 14.2-206 14.2-206 14.2-206 14.2-206 14.2-206 14.2-206 14.2-207 14.2-207 14.2-208 14.2-208 14.2-209 14.2-209 14.2-210 14.2-210 14.2-211 14.2-211 14.2-212 14.2-212 14.2-212 14.2-213 14.2-213 14.2-213 14.2-213 Sh Sh Sh Sh sh sh Sh Sh, Sh Sh Sh sh Sh Sh sh Sh Sh Sh sh Sh Sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh 14.2-214 14.2-215 Sh Sh 14.2-213-1 14.2-214 Sh 2 A22 1 A22 2 A22 1 A22 2 A24 2a A28 1 A22 2 A22 A24 A26 1 ROO 2 A22 1 ROO 2 A28 1 A08 2 A28 1 A22 2 ROO A12 1 A12 2 ROO 3 ROO 3a A28 3b A28 4 A16 1 A28 2 A28 1 A28 2 A28 1 A28 2 ROO 1 ROO 2 A08 1 A28 2 A28 1 A22 2 ROO 3 A12 1 ROO 2 ROO 3 ROO 4 ROO A08 1 A12 2 A22 1 A28 T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T F 14~2-217 14.2-217 14.2-218 14.2-218 14~2-219 14.2-219 14.2-220 14.2-220 14.2-221 14.2-221 14.2-221 14 2-222 14.2-222 14.2-222 14.2-223 14.2-223 14.2-224 14.2-224 14.2-225 14.2-225 14'-225 14'-226 14.2-226 14.2-227 14'-227 14'-227 14.2-228 14.2-228 14.2-229 14.2-230 14.2-230 14'-230 14'-231 14.2-231 14.2-231 14.2-231 14.2-232 14.2-232 14.2-233 Sh Sh Sh Sh Sh Sh sh Sh Sh sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh 14.2-233 Sh 14.2-233 Sh 14.2-233-1 14.2-215 Sh 14.2-216 Sh 14'-216 Sh 14 2-216A 2 1 2 1 2 1 2 1 2 1 2 1 2 3 1 2 3 1 2 1 2 1 2 3 1 2 1 2 3 1 2 1 2 3 1 2 3 4 1 2 1 2 3 A28 A28 R01 A16 ROO A28 A22 A28 A08 A28 A28 A28 A28 ROO A22 ROO ROO A16 ROO A22 A22 A12 A28 A28 A28 ROO ROO ROO ROO ROO A28 ROO A12 A28 A28 A28 A28 ROO A28 ROO A28 A28 A22 ROO A16 ROO USAR Revision EP 14-3 October 1992 T~

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 14 Page T=Table F=FicFure Amendment Number Page Page T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number T T T T T F T T T T T F T T T T T F T T T T T T T T T T T T T T T T T T T T T T T 14.2-234 14.2-234 14'-234 Sh Sh Sh 14.2-235 14'-235 14'-235 14'-236 Sh Sh Sh Sh 14.2-236 Sh 14.2-236-1 14.2-237 Sh 14.2-237 14.2-238 14.2-239 14.2-239 Sh Sh Sh 14.2-239-1 14.2-240 14'-240 14.2-241 14.2-241 14.2-241 14.2-241 Sh Sh Sh Sh Sh Sh 14.2-241a 14.2-241b 14.2-242 14.2-242 14.2-243 14'-243 14'-244 Sh Sh Sh Sh Sh 14.2-244 Sh 14.2-244'h 14.2-245 14.2-245 14.2-245 14'-301 14.2-301 14.2-302 14'-303 14.2-303 sh Sh Sh sh Sh Sh Sh 14'-234 Sh 14'-234 Sh 14.2-234-1 1 2 3 4 5 1 2 3 1 2 1 2 1 2 1 2 1 2 3 4 1 2 1 2 1 2 3 1 2 3 1 2 1 2 ROO ROO ROO A28 A22 A08 A12 A22 A22 ROO A28 A22 A28 A28 A22 A28 A28 A08 A28 ROO A28 ROO ROO A22 A22 A22 A08 A28 ROO ROO A28 A28 A22 A22 A28 A22 ROO R01 A28 A28 ROO T 14.2-304 T 14.2-304 T 14.2-304 T 14'-304 T 14.2-304 T 14.2-305 T 14.2-305 T 14.2-306 T 14.2-307 T 14.2-401 T 14.2-402 T 14.2-402 T 14.2-402 T 14'-402 T 14.2-403 F 14.2-1 F 14.2-2 F 14.2-3 F 14.2-4 F 14.2-5 F 14.2-6 F 14.2-7 Sh 2a A28 Sh 2b A28 Sh 2c A28 Sh 2d A28 Sh 3 A28 Sh 1 A22 Sh 2 A22 A28 A28 A22 Sh 1 A16 Sh 2 A16 Sh 3 A16 Sh 4 A16 A28 A24 A28 A24 A28 ROO A22 A16 14.2-303 sh 2a ROO T T T 14.2-303 14.2-303 14.2-304 14.2-304 Sh Sh Sh sh 2b A28 3 R01 1 ROO 2 ROO USAR Revision EP 14-4 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 15 PAGES Page T=T able Amendment F=FBFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 15-i 15-ii 15-iii 15-iv 15-v 15-vi 15-vii 15-viii 15 1X 15-x 15-xl 15-xii 15-xiii 15-xiv 15-xv 15-xvl 15-xvll 15-xvl 1 1 15-xix 15-xx 15-xxi 15-xxii 15-xxiia 15-xxiib 15-xxiii 15-xxiv 15-xxv 15-xxvi 15-xxvii 15'-1 15.0-1a 15.0-1b 15.0-2 15.0-3 15.0-4 15.0-5 15.0-6 15'-7 15.0-7a 15.0-7b 15'-8 15.0-9 15.0-9a 15.0-9b 15.0-10 R03 AOO AOO R03 AOO ROO A24 A24 AOO R03 A06 A24 A12 ROO AOO A18 R03 R03 A24 AOO A24 ROO A18 A18 AOO AOO A22 A24 AOO R03 R03 R03 AOO AOO AOO AOO AOO A06 A06 A06 R01 R03 R03 R02 R03 15.0-11 15.0-11a 15.0-11b 15.0-11c 15.0-11d 15.0-12 T 15'-1 T 15.0-1 T 15.0-1 T 15.0-2 T 15.0-3 T 15.0-3 T 15.0-3 T 15.0-3 T 15.0-4 T 15'-5 T 15.0-5 T 15.0-6 F 15.0-1 F 15.0-2 F 15.0-3 15.1-1 15.1-2 15.1-2a 15.1-2b 15.1-3 15.1-4 15.1-5 15.1-6 15.1-7 15.1-8 15.1-9 15.1-10 15.1-11 15.1-12 15.1-13 15.1-14 15.1-15 15.1-16 15.1-17 T 15.1-1 T 15.1-2 T 15.1-3 T 15.1-4 T 15.1-5 Sh 1 Sh 2,.Sh 3 Sh 1 Sh 2 Sh 3 Sh 3a Sh 1 Sh 2 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R02 R02 R02 AOO ROO ROO R03 R03 R03 R03 R03 A22 A06 A06 AOO A27 A22 AOO AOO R02 AOO AOO A22 R03 AOO AOO AOO AOO AOO A22 ROO A22 A26 AOO T 15.1-6 F 15.1-1 F 15.1-2 F 15.1-3 F 15.1-4 15'-1 15.2-2 15.2-3 15.2-4 15.2-5 15.2-6 15.2-7 15.2-8 15.2-8a 15.2-8b 15.2-9 15.2-10 15.2-11 15.2-12 15.2-13 15.2-14 15.2-15 15.2-16 15.2-17 15.2-18 15.2-19 15.2-20 15'-21 15.2-21a 15.2-21b 15.2-22 15.2-23 15.2-24 15.2-25 15.2-25a 15-2-25b 15.2-26 15.2-27 15.2-28 15.2-29 15'-30 15.2-31 15.2-32 15.2-32a 15.2-32b I AOO AOO AOO AOO AOO R03 AOO AOO A06 A22 A22 AOO R01 R01 R01 AOO A22 AOO A28 ROO ROO A22.A23 AOO AOO AOO AOO ROO ROO ROO A22 AOO AOO A10 A10 A10 AOO AOO A22 A22 AOO AOO A22 A22 A22 USAR Revision 4 EP 15-1 October 1992

~re~9 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table F=FicFFre Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 15.2-33 15.2-34 T 15.2-1 T 15.2-2 T 15.2-3 T 15.2-4 T 15.2-5 T 15.2-6 T 15.2-7 T 15.2-7 T 15.2-8 T 15'-9 T 15-2-10 T 15-2-10 T 15.2-11 T 15.2-12 T 15.2-13 F 15.2-1 F 15.2-2 F 15.2-3 F 15.2-4 F 15.2-5 F 15.2-6 F 15.2-7 F 15'-8 F 15.2-9 F 15.2-10 F 15.2-11 Sh 1 Sh 2 Sh 1 Sh 2 15.3-1 15.3-2 15.3-3 15.3-4 15.3-5 15.3-6 15.3-7 15.3-8 15.3-9 15.2 Notes Sh 15.2 Notes Sh F 15.2-12 F 15.2-13 F 15.2-14 F 15.2-15 F 15.2-16 F 15.2-17 AOO AOO R03 AOO AOO AOO A28 AOO AOO AOO AOO A22 AOO AOO A22 A27 R03 AOO AOO A22 A22 AOO AOO AOO AOO A10 A22 A22 A22 A22 AOO AOO AOO AOO AOO AOO AOO AOO AOO A22 AOO AOO A22 A27 AOO 15.3-10 15.3-11 15.3-12 15.3-13 15.3-14 T 15.3-1 T 15'-2 T 15'-3 T 15.3-4 T 15.3-5 F 15.3-1 F 15.3-2 F 15.3-3 F 15.3-4 F 15.3-5 15.4-1 15.4-2 15.4-3 15.4-4 15.4-4a 15.4-4b 15.4-5 15'-6 15.4-7 15.4-8 15.4-9 15.4-10 15.4-11 15.4-12 15-4-13 15-4-14 15.4-15 15.4-15a 15-4-15b 15.4-16 15.4-17 15.4-18 15.4-18a 15-4-18b 15.4-19 15.4-20 15.4-21 T 15'-1 T 15'-2 T 15.4-3 A22 AOO AOO AOO AOO A22 A10 A10 A22 A10 AOO AOO AOO AOO AOO R03 A22 R03 R03 ROO A28 AOO AOO A22 AOO AOO R03 AOO A22 A22 AOO A22 A06 A27 A22 A12 ROO ROO A12 A12 AOO A28 AOO AOO A22 T 15.4-4 T 15.4-5 T 15.4-6 T 15.4-7 T 15.4-8 T 15.4-9 T 15.4-10 Sh 1 T 15.4-10 Sh 2 T 15.4-11 T 15.4-12 T 15.4-13 T 15.4-14 T 15.4-15 T 15.4-16 F 15'-1 F 15'-2 F 15.4-3 F 15.4-4 F 15.4-5 F 15'-6 F 15.4-7 F 15.4-8 15'-1 15.5-2 15.5-3 T 15.5-1 F 15'-1 15.6-1 15.6-2 15.6-3 15.6-4 15.6-5 15.6-6 15.6-7 15.6-8 15.6-8a 15.6-8b 15.6-9 15.6-10 15.6-11 15.6-12 15.6-12a 15.6-12a.1 15.6-12a.2.A22 AOO AOO AOO A27 A22 A12 A12 A12 A12 A12 A12 A12 A12 A22 A22 AOO AOO AOO AOO AOO AOO AOO R03 AOO AOO AOO A12 A12 ROO A12 AOO R03 A12 ROO R03 A12 A25 AOO ROO R04 ROO ROO A25 USAR Revision 4 EP 15-2 October 1992 I

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=Ficpure Number Page T=Table Amendment F=Ficture Number 15.6-12b 15.6-12c 15.6-12d 15.6-13 15.6-13a 15.6-13b 15.6-14 15.6-14a 15.6-14b 15.6-15 15.6-16 15.6-17 15.6-18 T 15'-1 Sh T 15.6-1 Sh T 15.6-2 T 15.6-3 T 15.6-4 T 15.6-5 T 15.6-6 Sh T 15.6-6 Sh T 15.6-7 T 15.6-8 T 15.6-9 T 15.6-10 T 15.6-11 T 15.6-12 T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-13 Sh T 15.6-14 T 15.6-15 T 15.6-15a T 15.6-15b T 15.6-16 T 15.6-16a 1 2 1 2 1 2 3 4 5 6 7 8 9 10 11 12 13 ROO R03 A18 R01 A13 A13 R03 A10 A10 AOO A25 AOO A18 ROO R01 AOO A12 R01 R02 ROO ROO A12 ROO ROO A12 A12 A12 ROO R03 R03 R03 ROO ROO ROO ROO R01 R04 R03 ROO R03 ROO A21 A23 ROO A21 A23 T 15.6-16b T 15.6-17 T 15.6-18 T 15.6-19 T 15.6-20 T 15.6-21 15.7-1 15.7-2 15.7-3 15.7-4 15.7-5 15.7-6 15.7-7 15.7-8 15.7-9 15.7-10 15.7-11 15.7-12 15.7-13 15.7-13a 15.7-13b 15.7-14 15.7-15 15.7-16 15.7-17 15.7-18 T 15.7-1 T 15.7-2 T 15.7-3 T 15.7-4 T 15.7-5 T 15.7-6 T 15.7-7 Sh T 15.7-7 Sh T 15.7-8 Sh T 15.7-8 Sh T 15.7-9 Sh T 15.7-9 Sh T 15.7-10 T 15.7-11 T 15.7-12 T 15.7-13 T 15.7-14 T 15.7-15 T 15.7-16 Sh ROO A13 A13 A13 A13 A22 AOO A25 A23 A19 R02 R03 AOO AOO AOO AOO AOO R04 R04 R04 ROO A12 A18 A12 ROO R01 A25 A13 AOO AOO R01 AOO AOO AOO A23 AOO ROO ROO R01 ROO ROO A12 A12 A12 R01 T 15-7-16 T 15.7-17 15.8-1 15.8-2 15.8-3 15 8-4 15'-5 App 15A 15A-i 15A-ii 15A-iii 15A-iv 15A-v 15A-vi 15A-vii 15A-viii 15A-1 15A-2 15A-3 15A-4 15A-5 15A-6 15A-7 15A-8 15A-9 15A-10 15A-11 15A-12 15A-13 15A-14 15A-15 15A-16 15A-17 15A-18 15A-19 15A-20'5A-21 15A-22 15A-23 15A-24 15A-25 15A-26 15A-27 15A-28 Sh 2 R01 R01 R03 R03 A18 R03 R03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO USAR Revision 4 EP 15-3 October 1992 I~d I' Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE CHAPTER 15 PAGES Page T=Table Amendment F=FicFure Number Page T=Table F=Ficrure Amendment Number Page T=Table Amendment F=FicFure Number 15A-29 15A-30 15A-31 15A-32 15A-33 15A-34 15A-35 15A-36 15A-37 15A-38 15A-39 15A-40 15A-41 15A-42 15A-43 15A-44 15A-45 15A-46 15A-47 15A-48 15A-49 15A-50 15A-51 15A-52 15A-53 15A-54 15A-55 15A-56 15A-57 15A-58 15A-59 T 15A-1 T 15A-2 S?1 1 T 15A-2 Sh 2 T 15A-3 T 15A-4 T 15A-5 T 15A-6 T 15A-7 T 15A-8 T 15A-9 T 15A-10 T 15A-11 F 15A-1 F 15A-2 F 15A-3 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R03 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 15A-4 15A-5 15A-6 15A-7 15A-8 15A-9 15A-10 15A-11 15A-12 15A-13 15A-14 15A-15 15A-16 15A-17 15A-18 15A-19 15A-20 15A-21 15A-22 15A-23 15A-24 15A-25 15A-26 15A-27 15A-28 15A-29 15A-30 15A-31 15A-32 15A-33 15A-34 15A-35 15A-36 15A-37 15A-38 15A-39 15A-40 15A-41 15A-42 15A-43 15A-44 15A-45 15A-46 15A-47 15A-48 15A-49 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO A28 R04 AOO AOO AOO AOO A28 AOO AOO AOO R03 AOO AOO AOO AOO AOO AOO AOO R04 AOO AOO AOO AOO AOO AOO AOO R04 R04 AOO AOO AOO AOO AOO AOO AOO AOO F 15A-50 F 15A-51 F 15A-52 F 15A-53 App 15B 15B-i 15B-ii 15B-iii 15B-iv 15B.1-1 15B.1-2 15B.2-1 15B.2-2 15B.2-3 15B.2-4 15B.2-5 15B.2-6 15B 3-1 15B.3-2 15B.3-3 15B.3-4 15B.3-4a 15B.3-4b 15B.3-5 15B.3-6 15B.3-7 15B.3-8 15B.3-9 15B.3-10 15B.3-11 15B.3-12 15B.3-13 15B.3-13a 15B.3-13b 15B.3-14 15B.3-15 15B.3-16 15B.3-17 15B.3-18 15B.3-19 15B.4-1 15B.4-2 15B.4-3 15B.5-1 15B.5-2 AOO AOO AOO R04 A26 R03 A26 R03 R03 R04 R03 A26 A26 A26 A26 A26 A26 R03 R03 R03 R03 R03 R03 R03 A26 A26 R03 R03 R03 R03 R03 R04 R04 R03 A26 R03 R03 R03 R03 R03 A26 A26 A26 A26 R03 USAR Revision 4 EP 15-4 October 1992

~-I Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page T=Table F=FicFure Amendment Number Page T=Table F Ficpure Amendment Number Page T=Table Amendment F FicFure Number 15B.5-3 15B.5-4 15B.6-1 15B.6-2 15B.6-3 15B.7-1 15B.7-2 15B.8-1 15B-8-2 App 15C 15C-i 15C-ii 15C-iii 15C-1 15C-2 15C-3 15C-4 15C-5 15C-6 15C-7 15C-8 15C-9 15C-10 15C-11 15C-12 15C-13 15C-14 15C-15 15C-16 15C-17 15C-18 15C-19 15C-20 App 15D 15D-i 15D-ii 15D-iii 15D-1 15D-1a 15D-1b 15D-2 15D-3 15D-4 15D-5 R03 A26 R03 A26 R03 A26 R03 A26 R03 A26 A26 R03 R03 R04 R03 R03 R03 R03 R03 A26 A26 R03 A26 R03 R03 A26 A26 R03 R03 R03 R03 R03 R03 R03 R04 R03 R03 R04 R04 R04 R03 R03 R03 R03 15D-6 15D-7 15D-8 T 15D-1 T 15D-2 T 15D-3 T 15D-4 T 15D-5 F 15D-1 F 15D-2 F 15D-3 F 15D-4 App 15E 15E-i 15E-ii 15E-iii 15E.1-1 15E.1-2 15E.2-1 15E.2-2 15E.3-1 15E.3-2 15E.3-3 15E.3-4 15E.3-5 15E.3-6 15E.3-7 15E.3-8 15E.3-9 15E.3-10 15E.3-11 15E.3-12 15E.3-13 15E.3-14 15E.3-15 15E.3-16 15E.3-17 15E.3-18 15E.4-1 15E.4-2 15E.4-3 15E.4-4 15E.4-5 15E.4-6 15E.5-1 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 A26 ROO ROO A26 A26 ROO ROO ROO ROO A26 ROO R01 ROO R01 A26 R03 A26 ROO ROO A26 A26 A26 A28 A26 A26 A26 A26 A26 ROO ROO A26 A26 ROO App 15F App 15G 15G-i 15G-ii 15G-iii 15G-1 15G-2 15G-3 15G-4 15G-5 15G-6 15G-7 15G-8 15G-9 15G-10 15G-11 15G-12 T 15G-1 T 15G-2 T 15G-3 T 15G-4 T 15G-5 T 15G-6 T 15G-7 T 15G-8 T 15G-9 T 15G-10 T 15G-11 S?1 1 T 15G-11 S?1 2 T 15G-12 T 15G-13 T 15G-14 F 15G-1 F 15G-2 F 15G-3 F 15G-4 F 15G-5 F 15G-6 F 15G-7 F 15G-8 F 15G-9 F 15G-10 App 15H 15H-1 ROO R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 ROO ROO USAR Revision 4 EP 15-5 October 1992 E

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 15 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 15H-2 15H-3 15H-4 15H-5 15H-6 15H-7 15H-8 15H-9 15H-10 15H-11 15H-12 15H-13 15H-14 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 EP 15-6 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 16 Page Page Page T=Table Amendment T=Table Amendment T=Table Amendment F=FicFure Number F=FicFure Number F=FicFure Number 16-1 ROO USAR Revision 4 EP 16-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 17 Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number 17 i 17 ii 17-iii 17-1v 17-v 17.0-1 17.0-2 17.0-3 T 17.0-1 17~1-1 17.1-1a 17.1-1b 17'-2 17.1-2a 17.1-2b 17~1 3 17'-4 17.1-4a 17.1-4b 17.1-5 17.1-5a 17.1-5b 17.1-6 17~1 7 17.1-8 17.1-9 17.1-10 17.1-10a 17.1-10b 17.1-11 17.1-12 17.1-13 17.1-13a 17'-13b 17.1-14 17.1-15 17.1-15a 17.1-15b 17.1-16 17.1-16a 17.1-16b 17.1-17 17.1-17a 17'-17b A13 A09 A15 ROO A24 A07 AOO A15 A07 ROO A26 A20 A28 ROO A09 A28 A28 A28 A28 A28 ROO A05 A28 ROO A28 AOO A28 A13 A13 ROO AOO A09 A28 A05 A28 A09 A09 A05 A05 A05 A05 A05 A05 A05 17.1-18 17.1-19 17.1-20 17.1-21 17.1-22 17.1-22a 17.1-22b 1701-23 17.1-23a 17'-23b 17.1-24 17.1-24a 17.1-24b 17.1-25 17.1-26 17'-27 17.1-27a 17.1-27b 17.1-28 17'-29 17.1-30 17.1-30a 17.1-30b 17.1-31 17.1-32 17.1-32a 17.1-32b 17~1 33 17.1-33a 17.1-33b 17.1-34 17.1-34a 17.1-34b 17.1-35 17.1-35a 17.1-35b 17.1-36 17.1-36a 17.1-36b 17~1 37 17.1-38 17.1-38a 17.1-38b 17.1-39 17.1-39a 17.1-39b AOO AOO AOO AOO A28 A28 A09 ROO A05 A05 A05 A05 A01 AOO A05 A09 A09 A09 AOO AOO A05 A05 A01 A09 A09 A09 A09 A05 A05 A05 A09 R01 A09 A28 A15 A15 A09 A28 A05 AOO A28 A28 A15 A05 A09 A05 17.1-40 17.1-40a 17.1-40b 17.1-41 17.1-42 17.1-43 17.1-43a 17.1-43b 17.1-44 17.1-44a 17.1-44b 17.1-45 17.1-46 17.1-47 17'-48 17'-49 17.1-50 17.1-50a 17.1-50b 17.1-51 17.1-52 17.1-53 T 17.1-1 Sh 1 T 17.1-1 S?1 2 T 17.1-1 Sh 3 T 17'-1 Sh 4 T 17.1-1 Sh 5 F 17 1-1 F 17.1-2 1 7~2 1 A09 A22 A05 A09 AOO A05 A05 A05 A05 A05 A05 A09 AOO A28 A28 A05 A01 A01 A01 AOO A28 A28 AOO AOO AOO AOO AOO A28 ROO R04 USAR Revision 4 EP 17-1 October 1992

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES CHAPTER 18 Page T=Table F=FicFure Amendment Number Page T=Table F Ficpure Page Amendment T=Table Amendment Number F Fiqure Number 18-i 18-ia 18-ib 18-ii 18-iii 18-iv 18.1-1 18.1-1a 18.1-1b 18.1-2 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 F 18.2-1 R03 F 18.2-2 R03 F 18.2-3 R03 F 18.2-4 R03 F 18.2-5 R03 F 18.2-6 Sh 1 R03 F 18.2-6 Sh 2 R03 F 18.2-7.R03 F 18.2-8 R03 18.2-1 18'-2 18'-3 18.2-4 18.2-5 18.2-6 18.2-7 18'-8 18.2-9 18.2-10 18.2-11 18.2-12 18.2-13 18.2-14 18.2-15 18.2-16 18.2-17 18.2-18 T 18.2-1 T 18.2-2 T'18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18'-2 T 18'-2 T 18'-2 T 18.2-2 T 18.2-2 T 18.2-2 T 18.2-2 Sh Sh Sh Sh Sh Sh Sh Sh Sh Sh sh Sh Sh Sh 1 2 3 4 5 6 7 8 9 10 11 12 13 14 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R03 R04 R03 R03 R03 R03 USAR Revision 4 EP 18-1 October 1992 0.L IP Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX A RELOAD ANALYSIS Page T=Table Amendment F=FicFure Number Page Page T=Table Amendment T=Table Amendment F=FicFFre Number F FicFure Number A-i A-ii A-iii A-iv A-iva A-ivb A-v A-vi A-vii A.0-1 A.0-2 A.0-3 A.0-4 F A.0-1 A.4.1-1 A.4.2-1 A.4.3-1 A.4.4-1 A.4.4-2 A.4.4-3 F A.4-1 A.5'-1 A.5.2-2 A.5.2-3 A.5.2-4 T A.5'-1 T A.5.2-2 T A.5.2-3 F A.5.2-1 A.6-1 A.6-2 A.6-3 T A.6-1 T A.6-2 F A.6-1 F A.6-2 F A.6-3 F A.6-4 A.15.0-1 R03 R03 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R03 R04 R04 R04 R04 R04 R04 R04 R03 R03 R03 R03 R04 A.15.0-2 A 15.0-3 A.15.0-4 A.15.0-5 A.15.0-6 A.15.0-7 T A.15.0-1 Sh 1 T A.15.0-1 S?1 2 T A.15.0-2 T A.15.0-3 T A.15.0-4 S?1 1 T A.15.0-4 S?1 2 T A.15.0-4 S11 3 F A.15'-1 F A.15.0-2 A.15'-1 A.15.1-2 A.15.1-3 A.15.1-4 A.15.1-5 A.15.1-6 A.15.1-7 A.15.1-8 A.15.1-9 T A.15.1-1 T A.15.1-2 T A.15'-3 F A.15'-1 F A.15.1-2 F A.15'-3 A.15.2-1 A.15.2-2 A.15.2-3 A.15'-4 A.15.2-5 A.15.2-6 A.15.2-7 A.15.2-8 A.15.2-9 A.15.2-10 A.15.2-11 A.15.2-12 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 T A.15.2-1 T A.15.2-2 F A.15.2-1 F A.15.2-2 A.15'-1 A.15'-2 A.15 4-3 A.15.4-4 A.15.4-5 A.15.4-6 A.15.4-7 A.15.4-8 A.15'-9 T A.15'-1 T A.15'-2 T A.15.4-3 T A.15'-4 F A.15.4-1a F A.15.4-1b F A.15'-2 F A.15'-3 Ae15B-1 A.15C-1 A.15D-1 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 R03 R04 R04 R04 R04 R04 R04 R04 R04 R04 R04 USAR Revision 4 EP A-1 October 1992 h~

Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table Amendment~Fi ere Number Page T=Tab le Amendment Page T=Table Amendment 6A-i 6A-ii 6A-iii 6A-iiia 6A-iiib 6A-iv 6A<<v 6A-vi 6A-vii 6A-viia 6A-viib 6A-viii 6A-viiia 6A-viiib 6A-ix 6A-ixa 6A-ixb 6A-x 6A-xi 6A-xii 6A-xiii 6A-xiv 6A-xv 6A-xvi 6A-xvii 6A-xviii 6A-xviiia 6A-xviiib 6A-xix 6A-xx 6A-xxi 6A-xxii 6A-xxiia 6A-xxiib 6A-xxiii 6A-xxiv 6A-xxv 6A-xxvi 6A-xxvii 6A-xxviii 6A.1-1 6A.1-2 6A.1-2a 6A.1-2b A28 AOO A24 A24 A24 A24 A24 A07 A24 A24 A09 A27 A09 A09 A21 A24 A17 ROO A24 ROO A27 A24 A25 A24 ROO A24 A22 A22 A24 A24 ROO ROO A24 A24 AOO A24 A24 A24 R04 A24 A26 A09 A09 A09 6A.1-3 6A.1-4 6A.1-5 T 6A.1-1 Sh 1 T 6A.1-1 Sh 2 T 6A.1-1 Sh 3 F 6A.1-1 F 6A.1-2 F 6A.1-3 6A.2-1 6A.2-2 6A.2-3 6A.2-4 6A.2-5 6A.2-6 6A.2-7 6A.2-8 6A.2-8a 6A.2-8b 6A.2-9 6A.2-10 6A.2-11 6A.2-12 6A.2-13 6A.2-14 T 6A.2-1 Sh 1 T 6A.2-1 Sh 2 T 6A.2-1a Sh 1 T 6A.2-1a Sh 2 T 6A.2-1b Sh 1 T 6A.2-1b Sh 2 T 6A.2-2 Sh 1 T 6A.2-2 Sh 2 T 6A.2-2 Sh 3 T 6A.2-3 Sh 1 T 6A.2-3 Sh 2 T 6A.2-3 Sh 3 F 6A.2-1 F 6A.2-2 F 6A.2-3 F 6A.2-4 F 6A.2-5 F 6A.2-6 F 6A.2-7 A09 AOO A23 R04 R04 R04 A17 AOO R02 AOO AOO AOO AOO AOO AOO R04 R04 R04 A05 R02 AOO R04 A23 R04 A27 AOO AOO A27 A27 A09 A09 A23 R04 A23 AOO A23 AOO AOO AOO AOO AOO ROO R02 R02 F 6A.2-8 F 6A.2-9 F 6A.2-10 F 6A.2-11 F 6A.2-12 F 6A 2-13 F 6A.2-14 F 6A.2-15 F 6A.2-16 F 6A.2-17 F 6A.2-18 F 6A.2-19 F 6A.2-20 F 6A.2-21 F 6A.2-22 F 6A.2-23 F 6A.2-24 F 6A.2-25 F 6A.2-26 F 6A.2-27 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-9a 6A.3-9b 6A.3-9c 6A.3-9d 6A.3-9e 6A.3-9f 6A.3-9g 6A.3-9h 6A.3-9i 6A.3-9j 6A.3-9k 6A.3-9L'6A.3-10 6A.3-11 6A.3-12 ROO ROO ROO ROO ROO R02 ROO ROO AOO ROO ROO ROO ROO ROO ROO ROO ROO R02 AOO A23 AOO AOO AOO AOO A26 R02 A26 AOO A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 A22 AOO R02 AOO USAR Revision 4 DAR-1 October 1992

Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number T T T T T T T T F F F F~F F F F F F F F F F F F F F F F F F F F F 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-10 6A.3-11 6A.3-12 6A.3-13 6A.3-14 6A.3-15 6A.3-1 6A.3-2 6A.3-3 6A.3-4 6A.3-5 6A.3-6 6A.3-7 6A.3-8 6A.3-9 6A.3-10 6A.3-11 6A.3-12 6A.3-13 6A.3-14 6A.3-15 6A.3-16 6A.3-17 6A.3-18 6A.3-19 6A.3-20 6A.3-21 6A.3-22 6A.3-23 6A.3-24 6A.3-25 6A.3-26 6A.3-27 6A.3-28 6A.3-29 6A.3-30 AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO ROO AOO AOO ROO ROO ROO AOO AOO AOO AOO ROO ROO ROO ROO ROO AOO ROO ROO ROO ROO ROO AOO AOO AOO AOO AOO AOO AOO AOO F 6A.3-31 F 6A.3-32 F 6A.3-33 F 6A.3-34 F 6A.3-35 F 6A.3-36 F 6A.3-37 F 6A.3-38 F 6A.3-39 F 6A.3-40 F 6A.3-41 F 6A.3-42 F 6A.3-43 F 6A.3-44 6A.4-1 6A.4-2 6A.4-2a 6A.4-2b 6A.4-3 6A.4-4 6A.4-4a 6A.4-4b 6A.4-5 6A.4-5a 6A.4-5b 6A.4-6 6A.4-7 6A.4-8 6A.4-8a 6A.4-8b 6A.4-9 6A.4-10 6A.4-11 6A.4-12 6A.4-12a 6A.4-12b 6A.4-13 6A.4-14 6A.4-15 6A.4-16 6A.4-16a 6A.4-16b 6A.4-17 6A.4-18 ROO AOO ROO ROO ROO ROO AOO ROO AOO AOO AOO ROO A23 A23 AOO ROO ROO ROO AOO A23 A21 A21 A23 A23 A21 ROO AOO A23 A23 A21 AOO AOO AOO A23 A23 A06 AOO A23 A26 A26 A06 A06 AOO AOO 6A.4-19 6A.4-19a 6A.4-19b 6A.4-20 6A.4-21 6A.4-22 6A.4-23 6A.4-24 6A.4-24a 6A.4-24b 6A.4-25 6A.4-25a 6A.4-25b 6A.4-26 6A.4-27 6A.4-28 6A.4-29 6A.4-30 6A.4-31 6A.4-32 6A.4-33 6A.4-34 6A.4-35 6A.4-36 6A.4-37 6A.4-37a 6A.4-37b 6A.4-38 6A.4-39 6A.4-40 6A.4-41 T 6A.4-1 T 6A.4-1 T 6A.4-2 T 6A.4-3 T 6A.4-3a Sh Sh T 6A.4-4 T 6A.4-5 T 6A.4-6 T 6A.4-7 T 6A.4-7 Sh Sh Sh sh T 6A.4-8 T 6A.4-9 T 6A.4-10 T 6A.4-10 1 2 1 2 1 2 A06 A21 A21 A23 AOO A28 A27 A23 A23 A19 A22 A22 A22 A23 A23 A23 A23 A26 A26 AOO A26 AOO AOO AOO A23 A21 A21 ROO ROO AOO A21 ROO ROO AOO ROO A21 A28 AOO AOO AOO A23 AOO AOO A17 A27 USAR Revision 4 DAR-2 October 1992 0 j O'S 4 Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=Ficcure Number Page T=Table Amendment F=FicFure Number T 6A.4-10 T 6A.4-11 T 6A.4-12 T 6A.4-13 T 6A.4-14 T 6A.4-15 T 6A.4-15 T 6A.4-16 T 6A.4-17 F 6A 4-1 F 6A.4-2 F 6A.4-3 F 6A.4-4 F 6A.4-5 F 6A.4-6 F 6A.4-7 F 6A.4-8 F 6A.4-9 F 6A.4-10 F 6A.4-11 F 6A.4-12 F 6A.4-13 F 6A.4-14 F 6A.4-15 F 6A.4-16 F 6A 4-17 F 6A.4-18 F 6A.4-19 F 6A.4-20 F 6A.4-21 F 6A.4-22 F 6A.4-23 F 6A.4-24 F 6A.4-25 F 6A.4-26 F 6A.4-27 F 6A.4-28 F 6A.4-29 F 6A.4-30 F 6A.4-31 F 6A.4-32 F 6A.4-33 F 6A.4-34 F 6A.4-35 F 6A.4-36 S11 3 Sb 1 S?1 2 A17 AOO AOO AOO A17 A17 A17 A17 AOO ROO AOO AOO AOO AOO AOO AOO AOO AOO AOO ROO AOO A17 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO c F 6A.4-37 F 6A.4-38 F 6A.4-39 F 6A.4-40 F 6A.4-41 F 6A.4-42 F 6A.4-43 F 6A.4-44 F 6A.4-45 F 6A.4-46 F 6A.4-47 F 6A.4-48 F 6A.4-49 F 6A.4-50 F 6A.4-51 F 6A.4-52 F 6A.4-53 F 6A.4-54 F 6A.4-55 F 6A.4-56 F 6A.4-57 6A.5-1 6A.5-2 6A.5-2a 6A.5-2b 6A.5-3 6A.5-3a 6A.5-3b 6A.5-4 6A.5-4a 6A.5-4b 6A.5-5 6A.5-6 T 6A.5-1 T 6A.5-2 Sh T 6A.5-2 Sh T 6A.5-3 T 6A.5-4 Sh T 6A.5-4 Sh T 6A.5-5 T 6A.5-6 S11 T 6A.5-6 Sh T 6A.5-7 T 6A.5-8 Sh ROO AOO R02 ROO ROO ROO AOO AOO AOO ROO ROO R01 ROO A21 A25 A21 A21 A21 A21 A21 A21 AOO R04 A07 A05 A07 A07 A07 A07 A07 A07 A07 AOO A26 A26 A26 A23 A24 A07 A07 A24 A07 A07 A07 T F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F 6A.5-8 Sh 6A.5-1 6A.5-2 6A.5-3 6A.5-4 6A.5-5 6A.5-6 6A.5-7 6A.5-8 6A.5-9 6A.5-10 6A.5-11 6A.5-12 6A.5-13 6A.5-14 6A.5-15 6A.5-16 6A.5-17 6A.5-18 6A.5-19 6A.5-20 6A 5-21 6A.5-22 6A.5-23 6A.5-24 6A.5-25 6A.5-26 6A.5-27 6A.5-28 6A.5-29 6A.5-30 6A.5-31 6A.5-32 6A.5-33 6A.5-34 6A.5-35 6A.5-36 6A.5-37 6A.5-38 6A.5-39 6A.5-40 6A.5-41 6A.5-42 6A.5-43 A07 AOO AOO AOO'OO AOO R04 AOO AOO AOO AOO AOO A23 AOO AOO AOO AOO AOO AOO AOO A16 AOO AOO AOO AOO AOO A23 A23 A23 A23 A23 A23 AOO A23 A23 AOO AOO A23 A23 A23 A23 A23 A23 A23 USAR Revision 4 DAR-3 October 1992

Nine Mile Point Unit 2 DAR LIST OF EFFECTIVE PAGES DESIGN ASSESSMENT REPORT APPENDIX 6A Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number 6A.6-1 6A.6-2 6A.6-3 6A.6-4 T 6A.6-1 T 6A~6-2 T 6A.6-2 F 6A.6-1 F 6A.6-2 F 6A.6-3 F 6A.6-4 F 6A.6-5 F 6A.6-6 F 6A.6-7 6A.7-1 6A.7-2 6A.7-3 6A.7-4 6A.7-5 6A.7-5a 6A.7-5b 6A.7-6 6A.7-7 T 6A.7-1 T 6A.7-2 F 6A.7-1 6A.8-1 6A.8-2 6A.9-1 6A.9-2 6A.9-3 6A.9-4 6A.9-4a 6A.9-4b 6A.9-5 6A.9-6 6A.9-7 6A.9-8 6A.9-9 6A.9-9a 6A.9-9b 6A.9-10 S?I 1 S?1 2 R04 R04 R04 AOO A23 A23 A23 R04 R04 R04 R04 R04 R04 R04 R04 A07 R04 R04 A23 A07 A07 A23 A23 R04 A23 AOO AOO AOO AOO AOO R02 ROO ROO ROO A27 ROO ROO A20 A20 A20 A20 A20 6A.9-11 6A.9-11al 6A.9-11b1 6A.9-11a 6A.9-1lb 6A.9-11c 6A.9-11d 6A.9-1le 6A.9-11f 6A.9-12 T 6A.9-1 T 6A.9-2 T 6A.9-2a T 6A.9-2b T 6A.9-3 T 6A.9-4 T 6A.9-5 T 6A.9-6 T 6A.9-7 F 6A.9-1 F 6A.9-2 F 6A.9-3 6A.10-1 6A.10-2 6A.10-3 6A.10-4 6A.10-5 6A.10-6 6A.10-7 6A.10-8 6A.10-9 6A.10-9a 6A.10-9b 6A.10-10 T 6A.10-1 T 6A.10-2 Sh 1 T 6A.10-2 S?1 2 T 6A.10-3 T 6A.10-4 T 6A.10-5 T 6A.10-6 T 6A.10-7 T 6A.10-8 T 6A.10-9 A20 A20 A20 A09 A09 A09 A09 A09 A09 A23 R01 ROO ROO ROO ROO ROO R03 ROO ROO A23 A23 A23 R01 ROO A21 A22 A21 A21 A21 A21 ROO A24 A24 ROO ROO ROO ROO A21 A21 A21 A21 R01 A21 A21 F 6A.10-1 F 6A.10-2 F 6A.10-3 F 6A.10-4 F 6A.10-5 F 6A.10-6 F 6A.10-7 F 6A.10-8 F 6A.10-9 F 6A.10-10 F 6A.10-11 F 6A.10-12 F 6A.10-13 F 6A.10-14 F 6A.10-15 F 6A.10-16 F 6A.10-17 F 6A.10-18 F 6A.10-19 F 6A.10-20 A21 ROO ROO ROO ROO ROO ROO ROO ROO ROO R01 R01 R01 A22 A22 A22 A22 A22 A22 A22 USAR Revision 4 DAR-4 October 1992 I-1 Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX R REVIEW SAFE SHUTDOWN ANALYSIS APPENDIX 9B Page T=Table Amendment F=FicFure Number Page T=Table Amendment F=FicFure Number Page T=Table F=FicFure Amendment Number 9B-i 9B-ia 9B-ib 9B-ii 9B-iii 9B-iv 9B.1-1 9B.2-1 9B.2-2 9B.2-3 9B.3-1 9B.4-1 9B.4-2 9B.4-3 9B.4-4 9B.4-5 9B.4-6 9B.4-7 9B.4-8 F 9B.4-1 F 9B.4-2 9B.5-1 9B.5-2 9B.5-3 9B.5-4 9B.5-5 T 9B.5-1 9B.6-1 9B.6-2 9B.6-3 9B.6-4 T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-1 Sh T 9B.6-2 A24 A24 A23 ROO A24 A12 A23 R02 R02 R02 A23 A04 A22 R02 R02 R02 R02 A04 A22 A22 R02 ROO A04 A04 A21 A23 ROO R02 R02 R02 All A28 A28 ROO R03 ROO ROO All T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 T 9B.6-3 F 9B.6-1 F 9B.6-2 F 9B.6-3 F 9B.6-4 F 9B.6-5 F 9B.6-6 9B.7-1 9B.8-1 9B.8-2 9B.8-3 9B.8-4 9B.8-5 9B.8-5a 9B.8-5b 9B.8-6 9B.8-7 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B-8-1 T 9B.8-1 T 9B.8-1 T 9B~8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1 T 9B.8-1'T 9B.8-1 T 9B.8-1 T 9B.8-1 Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6, Sh 7 Sh 7a Sh 8 Sh 9 Sh 1 Sh 2 Sh 2a Sh 3 Sh 4 Sh 5 Sh 5a Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 A23 All ROO All ROO All A23 ROO R03 All A04 All All All All All A23 ROO A23 Rol A23 Rol Rol ROO A25 R02 ROO R04 R02 R02 R03 R02 R02 All A28 R02 A28 ROG R02 R02 R02 All T T T T T T T T T T T T T T T T T T T T T T T T T T T 9B.8-1 T 9B.8-1 T.9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 T T T T T T 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-.1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B~8-1 9B.8-1 9B.8-1 9B~8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 Sh 22 Sh 23 Sh 24 Sh 25 Sh 26 Sh 27 Sh 28 Sh 29 Sh 30 Sh 30a Sh 31 Sh 32 Sh 33 Sh 34 Sh 35 Sh 36 Sh 37 Sh 38 Sh 39 Sh 40 Sh 41 Sh 42 Sh 43 Sh 44 Sh 45 Sh 46 Sh 47 Sh 48 Sh 49 Sh 50 Sh 51 Sh 52 Sh 53 Sh 54 Sh 55 Sh 56 Sh 57'OO R02 All ROO All A28 A28 A28 A28 A28 A28 R02 R02 R02 R02 R02 R02 R02 R02 ROO A28 A28 A23 A23 A23 A23 A23 A23 A23 A23 A23 A23 R02 A23 A23 A23 A23 R03 R02 R03 R02 R02 A19 A19 USAR Revision 4 SSA-1 October 1992 0

Nine Mile Point Unit 2 FSAR LIST OF EFFECTIVE PAGES APPENDIX R REVIEW SAFE SHUTDOWN ANALYSIS APPENDIX 9B Page T=Table F=FicFUFe Amendment Number Page T=Table F=FicFure Amendment Number Page T=Table Amendment F=FicFure Number T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T-T T T T T T T T T T 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B 8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-1 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 9B.8-2 Sh 58 Sh 59 Sh 60 Sh 60a Sh 61 Sh 62 Sh 63 Sh 64 Sh 65 Sh 66 Sh 66a Sh 67 Sh 68 Sh 69 Sh 70 Sh 71 Sh 72 Sh 73 Sh 73a Sh 74 Sh 75 Sh 75a Sh 75b Sh 1 Sh 2 Sh 3 Sh 4 Sh 5 Sh 6 Sh 7 Sh 8 Sh 9 Sh 10 Sh 11 Sh 12 Sh 13 Sh 14 Sh 15 Sh 16 Sh 17 Sh 18 Sh 19 Sh 20 Sh 21 ROO A11 ROO ROO R02 R02 R02 R02 R02 R02 R02 R02 ROO R02 R02 R02 R02 R02 ROO R02 ROO R02 R02 R02 R02 A28 A11 A28 R02 A28 A11 R02 A11 A11 A11 A28 A28 A28 A28, A28 A28 R02 R02 ROO T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-2 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 T 9B.8-3 9B.9-1 Sh 22 ROO Sh 23 ROO Sh 24 ROO Sh 25 A28 Sh 26 A28 Sh 27 A28 Sh 28 A23 Sh 29 A23 Sh 29a A23 Sh 29b A23 Sh 29c A23 Sh 29d A23 Sh 29e A23 Sh 291 A23 Sh 30 A11 Sh 31 R03 Sh 32 ROO Sh 33 A23 Sh 33a A23 Sh 34 ROO Sh 34a ROO Sh 35 A11 Sh 36 A23 Sh 37 R02 Sh 38 ROO Sh 38a A23 Sh 38b R01 Sh 1 R03 Sh 2 ROO Sh 3 ROO Sh 4 ROO Sh 5 ROO Sh 5a ROO Sh 6 ROO Sh 7 ROO Sh 8 ROO Sh 9 ROO Sh 10 ROO Sh 11 A23 Sh 12 ROO Sh 13 R01 Sh 14 ROO R02 9B.10-1 9B.11-1 9B.12-1 9B.12-2 9B.12-3 9B.12-4 9B.12-5 9B.12-6 9B.12-7 9B.12-8 9B.12-9 9B.12-10 9B.12-11 ROO A21 ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO ROO USAR Revision 4 SSA-2 October 1992 0

ED FKTY I NINE MILE POINT NUCLEAR STATION-UNIT 2 7 NIAGARA U MOHAWK VOL.1

Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont)Section 5.3 5.4 Appendixes CHAPTER 6 6.1 6.2 6.3 6.4 6.5 6.6 Appendixes CHAPTER 7 7.1 7'7.3 7.4 7.5 7'7~7 Appendixes CHAPTER 8 8.1 8.2 8.3 Appendix 8A CHAPTER 9 Title Reactor Vessel Component and Subsystem Design 5Ag 5B ENGINEERED SAFETY FEATURES Engineered Safety Feature Materials Containment Systems'mergency Core Cooling Systems Habitability Systems Fission Product Removal and Control Systems Inservice Inspection of Safety Class 2 and Class 3 Components through 6C INSTRUMENTATION AND CONTROL SYSTEMS Introduction Reactor Protection (Trip)System (RPS)Instrumentation and Controls Engineered Safety Feature Systems Systems Required for Safe Shutdown Safety-Related Display Instrumentation All Other Instrumentation Systems Required for Safety Control Systems Not Required for Safety 7Ag 7B ELECTRIC POWER Introduction Offsite Power System Onsite Power System AUXILIARY SYSTEMS Volume 13 13 13 13 13 14 15 15 15 15 15 15 15 15 16 16 16 16 16 16 16 16 16,17 17 I 17 9.1 9.2 9.3 9.4 9.5 Appendixes Fuel Storage and Handling Water Systems Process Auxiliaries Air Conditioning, Heating, Cooling, and Ventilation Systems Other Auxiliary Systems 9Ag 9C 17 18 19 20,21 21,22 I USAR Revision April 1989 Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont'd)Section Title Volume CHAPTER 10 STEAM AND POWER CONVERSION SYSTEM 23 10.1 10.2 10.3 10.4 Summary Description Turbine Generator Main Steam Supply System Other Features of Steam and Power Conversion System 23 23 24 CHAPTER 11 RADIOACTIVE WASTE MANAGEMENT 24 11.1 11.2 11.3 11.4 11.5 Appendix 11A Source Terms Liquid Waste Management Systems Gaseous Waste Management Systems Solid Waste Management System Process and Effluent Radiological Monitoring and Sampling Systems 24 24 25 25 25 25 CHAPTER 12 RADIATION PROTECTION 25 12.1 12.2 12.3 Ensuring That Occupational Radiation Exposures Are As Low As Reasonably Achievable (ALARA)Radiation Sources Radiation Protection Design Features Dose Assessment Radiation Protection Program 25 25 25 26 26 CHAPTER 13 CONDUCT OF OPERATIONS 26 13.1 13.2 13.3 13.4 13.5 13.6 Appendix 13A Organizational Structure of Applicant Training Site Emergency Plan Operation Review and Audit Plant Procedures Industrial Security 26 26 26 26 26 26 26 CHAPTER 14 INITIAL TEST PROGRAM 26 14.1 Specific Information To Be Included in Preliminary Safety Analysis Report (PSAR)26 USAR Revision iv October 1991 Nine Mile Point Unit 2 FSAR TABLE OF CONTENTS (Cont'd)Section Title Volume 14.2 CHAPTER 15 Specific Information To Be Included in Final Safety Analysis Report (FSAR)ACCIDENT ANALYSIS 26r 27 27 15.0 15.1 General Decrease in Reactor Coolant Temperature 15.2 Increase in Reactor Pressure 15.3 Decrease in Reactor Coolant System Flow Rate 15.4 Reactivity and Power Distribution Anomalies 15.5 Increase in Reactor Coolant Inventory 15.6 Decrease in Reactor Coolant Inventory 15.7 Radioactive Release From Subsystems or Components 15.8 Anticipated Transients without Scram (ATWS)Appendices 15A through 15H 27 27 27 27 27 27 27 27 27 28 CHAPTER 16 CHAPTER 17 17.0 17.1 17.2 CHAPTER 18 TECHNICAL SPECIFICATIONS QUALITY ASSURANCE Introduction Quality Assurance Program During Operation Quality Assurance Program During the Operations Phase HUMAN FACTORS ENGINEERING/SAFETY P2QMMETER DISPLAY SYSTEM 28 28 28 28 28 28 18.1 18.2 APPENDIX A Detailed Control Room Design Review Safety Parameter Display System RELOAD ANALYSIS 28 28 28 USAR Revision 3 October 1991

Nine Mile Point Unit 2 FSAR CHAPTER 1 INTRODUCTION AND GENERAL DESCRIPTION OF PLANT TABLE OF CONTENTS Section Title INTRODUCTION Pacae 1.1-1 1.2 1.2.1 1.2.1 1.2.1 1.2.1 1.F 1 1.2.1 1.2.1 1.2.1.1.2.2.1.3.3.1.3.2.3.3 1.2.1.3.8 1.2.2 1.2:2.1 1.2.2.2 1.2.2.3 1.2.3 1.2.4 1.2.4.1 1.2.4.2 1.2'.3 1.2.4.4 1.2.4.5 1.2.4.6 1.2.5 1.2.5.1 1.2.5.2 1~2'.3 1.2.1~3.4 1.2.1.3.5 1.2.1.3.6 1.'2.1.3.7 GENERAL PLANT DESCRIPTION Principal Design Criteria General Criteria Power Generation Design Criteria Safety Design Criteria System-by-System Approach Nuclear System Criteria Power Conversion Systems Criteria Electrical Power Systems Design Criteria Radwaste System Design Criteria Auxiliary Systems Design Criteria Shielding and Access Control Design Criteria Nuclear Safety Systems and Engineered Safeguards Design Criteria Process Control System Design Criteria Site Description Site Characteristics:

Site Location and Size Access to the Site Description of the Site and Environs Structures and Equipment Nuclear Steam Supply System Reactor Core and Control Rods Reactor Vessel and Internals Reactor Recirculation System Residual Heat Removal System Reactor Water Cleanup System Nuclear Leak Detection System Electrical, Instrumentation, and Contr'ol Systems Electrical Power System Nuclear System Process Control and Instrumentation Power Conversion Systems Process Control and Instrumentation 1~2-1 1~2 1 l.2-1 1~2 3 1.2-4 1~2-7 1.2-7 1.2-8 1.2-9 1.2-9 1.2-9 1.2-9 1.2-10 1.2-10 1.2-12 1.2-12 1.2-12 1.2-13 1.2-13 1.2-15 1.2-15 1.2-16 1.2-17 1.2-17 1.2-17 1.2-18 1.2-18 1.2-18 1.2-20 1.2-21 Amendment 24 February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABLE OF CONTENTS (Cont)Section 1.2 1.2 1.2 1.2 1.2 1.2~6.7.7.1.7.2.7.3.7.4 1.2 1.2 1~2 1~2 1.2 1.2 1.2.8.8.1.8.2.8.3.8.4.8.5~8.6 1.2 1.2 1.2 1~2.8.7~8.8.8.9.9 1.2 1~2 1.2 1.2 1.2 1.2 1~2 1.2 1.2 1.2.9.1.9.2.9.3.9.4.9.5.9.6.9.7.9.8.9.9.9.10 1.2 1.2 1.2.9.11.9.12.9.13 1.2.9.14 1.2.9'5 1.2.9.18 1.2.9.16 1.2.9.17 Title Radioactive Waste System Fuel Handling and Storage Systems New Fuel Storage Spent Fuel Storage Fuel Handling System Spent Fuel Pool Cooling and Cleanup System Power Conversion System Turbine Generator Main Steam System Main Condenser Main Condenser Air Removal System Turbine Gland Sealing System Steam Bypass System and Pressure Control System Circulating Water System Condensate and Feedwater Systems Condensate Demineralizer System Nuclear Safety Systems and Engineered

'Safety Features Reactor Protection System Neutron Monitoring System Control Rod Drive System Control Rod Drive Housing Supports Control Rod Velocity Limiter Nuclear System Pressure Relief System Reactor Core Isolation Cooling System Emergency Core Cooling Systems Containment Systems Containment and Reactor Vessel Isolation Control.System MainSteam Isolation Valves Main Steam Flow Restrictors Main Steam Radiation Monitoring System Residual Heat Removal System Ventilation Exhaust Radiation Monitoring System Standby Gas Treatment System Safety-Related Electrical Power Systems Standby Liquid Control System Pa<ac 1.2-22 1.2-23 1.2-23 1.2-23 1.2-24 1.2-24 1.2-24 1.2-24 1.2-,25 1.2-25 1.2-25 1.2-25 1.2-26 1.2-26 1.2-26 l.2-26 1.2-27 1~2 2 7 1.2-27 1.2-27 1.2-27 1.2-28 1.2-28 1.2-28 1.2-28 1.2-29 1'-30 1.2-30 1.2-31 l.2-31 1.2-31 1.2-32 1.2-32 1.2-32 1.2-33 Amendment 24 1-ii February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABIE OF CONTENTS (Cont)Section 1.2.9.19 1.2.9.20 1.2.9.21 1.2.10 1.2.10.1 1.2.10.2 1.2.10.3 1.2.10.4 1.2.10.5 1.2.10'1.2.10.7 1.2.10.8 1.2.10.9 1.2.10.10 1.2.10.11 1.2.10.12 1.2.10.13 1.2.10.14 1.2.10.15 1.2.10'6 1~2~11 1.3 1.3.1 1.3.2 1.3'1.4 1.4.1 1.4.2 1.4.3 1.4.4 Title Safe Shutdown from Outside the Control Room Main Control Room Heating, Ventilating and Air Conditioning System Redundant Reactivity Control System Cooling Water and Auxiliary Systems Reactor Building Closed Loop Cooling Water System Turbine Building Closed Loop Cooling Water System Service Water System Ultimate Heat Sink Plant Chilled Water System Heating, Ventilating, and Air Conditioning Systems Process Sampling Condensate Makeup and Drawoff System Water Treatment and Makeup Water'Systems Domestic Water and Sanitary Drains and Disposal Systems Compressed Air Systems Auxiliary Steam System Standby Diesel Generator Fuel Oil Storage, and Transfer System Fire Protection System Communication Systems Lighting Systems References COMPARISON TABLES Comparison with Similar Facility Designs Comparison of Final and Preliminary Information Reference IDENTIFICATION OF AGENTS AND CONTRACTORS Applicant Architect-Engineer Nuclear Steam Supply System Turbine Generator Supplier Pa<ac 1.2-33 1.2-33 1.2-33 1.2-34 1.2-34 1.2-34 1.2-34 1.2-34 1.2-34 1.2-35 1.2-35 1.2-35 1.2-35 1.2-36 1.2-36 1.2-37 1~2 3 7 1~2 3 7 1~2-37 1'-38 1.2-41'~3 1 1.3-1 1~3 1 l.3-1 I 1.4-1 1.4-1 1.4-2 1.4-3 1.4-4 Amendment 24 1 iii February 1986 Nine Mile Point Unit 2 FSAR CHAPTER 1 TABLE OF CONTENTS (Cont)Section 1.4.5 1.4.6 Title Technical Consultants Reference Pacae 1.4-4 1.4-8 24 24 1.5 1.5.1 1.5.1.1 1.5.1.2 1.5.1.3 1.5.1.4 1.5.1.5 1.5.2 1.5.3 1.6 1.7 1.7.1 1.7.2 1.8 1.9 1.10 1.11 l.12 1.12,.1 1.12.2 1~13 REQUIREMENTS FOR FURTHER TECHNICAL INFORMATION Current BWR Development Programs Instrumentation for Vibration Detection Core Spray Distribution Core Spray and Core Flooding Heat Transfer Effectiveness Verification of Pressure Suppression Design Boiling Transition Testing Geotechnical Investigations References MATERIAL INCORPORATED BY REFERENCE DRAWINGS AND OTHER DETAILED INFORMATION Electrical, Instrumentation,,and Control Drawings Piping and Instrumentation Drawings CONFORMANCE TO NRC REGULATORY GUIDES STANDARD REVIEW PLAN CONFORMANCE TO ACCEPTANCE CRITERIA UNIT 2 RESPONSE TO REGULATORY ISSUES RESULTING FROM TMI ABBREVIATIONS AND ACRONYMS GENERIC LICENSING ISSUES Introduction Iicensing Issues UNIT 2 POSITION ON UNRESOLVED SAFETY ISSUES 1.5-1 1.5-1 1.5-1 1.5-1 1.5-1 1.5-2 1.5-3 1.5-3 1.5-5 1.6-1 1.7-1 1.7-1 1.7-1 1.8-1 1.9-1 1.10-1 1.11-1 1;12-1 1.12-1 1.12-1 1.13-1 Amendment 24 1-3.V February 1986 Nine Mile Point Unit 2 FSAR CHAPTER, 1 INTRODUCTION AND GENERAL DESCRIPTION OF THE PLANT

1.1 INTRODUCTION

This Final Safety Analysis Report (FSAR)is submitted by the Niagara Mohawk Power Corporation (Applicant) and its co-owners (Central Hudson Gas and Electric Corporation, Long Island Lighting Company, New York State Electric and Gas Corporation, and Rochester Gas and Electric Corporation) in support of the application for a Class 103 operating license for 0he nuclear power station designated Nine Mile Point Nuclear Station-Unit 2 (Unit 2).Unit 2 is located on a 364-ha (900-acre) site owned by Niagara Mohawk Power Corporation (NMPC), and is situated on the southeast shore of Lake Ontario, Oswego County, NY, approximately 10 km (6.2 mi)northeast of the city of Oswego.Unit, 2 and support facilities occupy about 18.2 ha (45 acres), and share the site with the existing Unit 1 (Docket No.50-220)which has been in commercial operation since 1969.,The Nine Mile Point site is adjacent to the James A.FitzPatrick Nuclear Power Plant owned by the NYPA;Unit 2 is located 274 m (900 ft)east of Nine'Mile Point Unit 1 and about 716 m (2,350 ft)west of the James A.FitzPatrick Plant.Unit 2 employs a nuclear steam supply system (NSSS)consisting of a single cycle, forced circulating boiling water reactor (BWR).The plant rated core thermal power level (Figure 1.1-1-)is 3,323 MWt corresponding to a net electrical output of 1,080 MWe, and design thermal power of 3,463 MWt corresponding to a gross electrical output of 1,202 MWe.The thermal power used for the plant transient and loss-of-coolant

'accident (LOCA)analyses is 3,463 MWt.All safety systems have been designed for a thermal power.of 3,489 MWt.The NSSS supplier is General Electric Company-Nuclear Energy Operations (GE-NEO).The balance of the plant is designed and constructed by Stone Ec Webster Engineering Corporation (SWEC).Other plants designed by SWEC that are similar in concept are currently under review by the Nuclear Regulatory Commission.

These are the Shoreham Nuclear Power Station, Brookhaven, Long Island, NY, and the River Bend Station, St.Francisville, LA.The containment design employs the BWR Mark II concept of over-under pressure suppression with multiple , downcomers Amendment 19 1.1-1 May 1985 Nine Mile Point Unit 2 FSAR connecting the reactor drywell to the water-filled pressure suppression chamber.The primary containment,.-

is.a steel-lined, reinforced concrete enclosure housing the reactor and the suppression pool.The reactor building completely encloses the.primary containment.

The structure provides secondary containment when the primary containment is closed and in service, and provides primary containment when the primary containment is open, as during refueling.

The reactor building houses the refueling and reactor servicing equipment, new and spent fuel storage facilitie's,'and--other reactor auxiliary and service equipment.

The primary purpose of the reactor building is to minimize ground.-level release of airborne radioactive material.The outer wall of the reactor building is reinforced concrete up to the crane rail level above the refueling floor.Above the crane'ail level, the superstructure is a steel frame using metal wall panels with sealed joints.Access to the building is through airlocks.II The power generation complex includes several contiguous buildings:

the reactor building with two auxiliary bays, the control building, the turbine building, and the radwaste building.Other buildings, such as the security facility, are'lso located in the general plant area.A screenwell for the circulating and service water systems is located approximately 107 m (350 ft)northwest of the centerline of the reactor building.Condenser cooling for Unit 2 is provided from a counterflow, natural-draft, hyperbolic, concrete cooling, tower located approximately 330 m (1,000 ft)south of the centerline of the reactor building.The ultimate heat.sink for emergency core cooling is Lake Ontario.Below grade and north of the screenwell building, there are two concrete tunnels'hat convey the ,service water intake, service water discharge, and cooling tower blowdown.A safety-related intake pipe is enclosed in'each tunnel.The intake pipes extend from the intake shaft approximately 396 m (1, 300 f t)northward under Lake Ontario to the submerged intake structures.

One tunnel also contains the discharge pipe which extends approximately 550 m (1,800 ft)to the discharge diffuser.Radionuclides are emitted to the atmosphere from two locations at Unit 2.These are the stack and the combined vent for the radwaste-and reactor buildings.

Fiquid radwaste is stored for decay or concentrated to a solid waste for controlled disposal at regulated storage sites.1~1 2 Nine Mile Point Unit 2 FSAR The shielding design'and plant layout are based on extensive experience of NMPC and SWEC in controlling radiological exposures to as low as reasonably achievable levels.Estimated radiological doses for normal operations and postulated accidents are all fractional parts of the doses listed in federal radiological guidelines for siting and operation of nuclear power plants.Environmental impacts are described in the separate Environmental Report Operating License Stage being submitted for Unit 2.This FSAR is written in accordance with Regulatory Guide 1.70, Standard Format and Content of Safety Analysis Reports for Nuclear Power Plants.The content of this FSAR addresses applicable regulatory guides issued up to July 1982.The Unit 2 Preliminary Safety Analysis Report (PSAR)was submitted on June 15, 1972 (Docket No.50-410).The NRC Safety Evaluation Report was issued on June 15, 1973, and the construction permit (CPPR-112) was issued on June 24, 1974.Environmental impacts related to the plant are discussed in the Environmental Report-Construction Permit Stage submitted on June 15, 1972.The NRC Final Environmental Statement was issued in June 1973.The approximate schedule for Unit 2 fuel loading and commercial operation is as follows: Fuel loading Commercial operation March 1986 October 1986 Amendment 24 1.1-3 February 1986 I

Nine Nile Point Unit 2 FSAR 1.2 GENERAL PLANT DESCRIPTION 1.F 1 Principal Design Criteria The principal architectural and engineering criteria for the design, construction, and operation of Unit 2 are summarized in this Section.There are two ways of considering principal design criteria: on a classification-by-classification basis, or on a system-by-system (system group)basis.Safety analyses generally utilize the information formatted in the classification-by-classification approach but/system descriptions are more easily understood through the system-by-system method.This section uses both methods for summarizing the principal design criteria.1.2.1.1 General Criteria Some of the criteria are generally applicable to more than one classification or more than one system group.These general criteria are as follows: Unit 2 is designed, fabricated, and erected to produce electric power in a safe and.reliable manner.Unit design generally conforms with applicable codes and regulations.

Exceptions are evaluated and justified.

The General Design Criteria of 10CFR50 Appendix A have been satisfied in the Unit 2 design.2.3.Unit 2 is designed, fabricated, and erected to operate in such a way that the release of radioactive materials to the environment is limited to less than the limit and guideline values of applicable federal regulations pertaining to the release of radioactive materials for normal operations and abnormal events.Unit 2 is designed to support a GE boiling water reactor (BWR)and nuclear steam supply system (NSSS)to produce steam for direct use in a turbine generator unit.This design incorporates ,features typical of many other BWR plants.4.Certain portions of the plant are designed to withstand extreme natural phenomena such as earthquakes, flooding, or tornadoes, and unnatural phenomena such as fige, flooding from in-plant leakage, internally or externally generated missiles, and others.1.2-1 Nine Mile Point Unit 2 FSAR The reactor core and reactivity control systems are designed so that control rod action is capable of bringing the core to subcritical condition and maintaining it, even with the rod of highest reactivity worth fully withdrawn and unavailable for insertion.

Design margins for the nuclear safety systems and engineered safeguards are conservative.

Nuclear abnormal damage.environs material Appendix safety systems are designed to respond to operation transients to preclude fuel'ny fission products released to the via normal discharge paths for radioactive will not exceed the limits of 10CFR50 I.Nuclear safety systems and engineered safeguards are designed to assure that no damage to the reactor coolant pressure boundary (RCPB)results from internal pressures caused by abnormal operational transients or accidents.

Where positive, precise action is immediately required in response to accidents, such action is automatic and requires no decision or manipulation of controls by station operations personnel.

Essential safety actions are carried out by safety-related equipment of sufficient redundancy and independence so that no single failure of active components can prevent required actions.Any single failure within the safety-related protection system shall n'ot prevent proper protective action at the system level when required.Provisions have been made for control of the components of nuclear safety systems and engineered safeguards from the control room.C Nuclear safety systems and engineered safeguards are designed to permit demonstration of their functional performance requirements.

Unit 2 features essential to the mitigation of accident consequences are designed, fabricated, and erected to quality standards that reflect the importance of the safety function to be performed.

1.2-2 Nine Mile Point Unit 2 FSAR I 1.2'~2 Power Generation Design Criteria Principal power generation design criteria are as follows: 1.Fuel cladding'designed to retain integrity as a radioactive material barrier throughout the full operational range of the plant and any abnormal operation transient.

The fuel cladding is designed to accommodate, without loss of integrity, pressures generated by fission gases released from fuel material throughout the design life of the fuel.2.Heat removal systems are provided in sufficient capacity and redundancy to remove heat generated in the reactor core for the full range of normal operating conditions from plant shutdown to design power, and also for any abnormal operational"transient.

The capacity'f such systems is adequate to prevent fuel cladding damage.3.Backup heat removal systems are provided to remove decay heat generated in the core under circumstances where normal operational heat removal systems have become inoperative.

The capacity of such systems is adequate to prevent fuel cladding damage.4 Control equipment is provided to allow the reactor to respond automatically to major or minor load changes and other abnormal operational transients, including bringing the reactor to a hot shutdown condition.

5.Reactor power level is manually controlled.

6.Control of the NSSS, including the reactor, is'ossible from a single location.NSSS and reactor controls, including alarms, are arranged to allow the operator to rapidly assess the condition of the nuclear system and locate process system malfunctions.

8.Fuel handling and storage facilities are designed to maintain adequate shielding, cooling, and water quality for spent fuel and to prevent inadvertent criticality.

Amendment 21 1.2-3 September 1985 Nine Mile Point Unit 2 FSAR Interlocks or other automatic equipment are provided as backup to procedural controls to avoid conditions requiring the functioning of nuclear safety systems or engineered safeguards.

Safety Design Criteria The.unit is designed, fabricated, and erected to operate so that the release of radioactive materials to the environment is significantly less than the requirements of 10CFR20 or 10CFR100.Those portions of the nuclear system that form part of the RCPB are designed to retain integrity as a radioactive barrier following abnormal operational transients or an accident event.The reactor core is designed so its nuclear characteristics do,not contribute to a divergent power transient.

The NSSS and supporting systems are designed so that there is no tendency for divergent oscillation of any operating characteristic, considering the interaction of the nuclear system with other appropriate unit systems'aseous, liquid, and solid waste disposal faci'lities are designed so the discharge of radioactive effluents and offsite shipment of radioactive materials can be made in accordance with applicable regulations'esign of the radwaste system provides means by which Unit 2 operators can be alerted when limits on the release of radioactive material are approached.

Sufficient indications are provided to determine that the reactor is operating within the limits of applicable regulations in any mode of unit operations.

Adequate radiation shielding is provided and access control patterns are established to allow a properly trained operating staff to control radiation doses to-a level that is as low as reasonably achievable during normal operation.

1.2-4 Nine Mile Point Unit 2 FSAR Essential safety actions are designed to be carried out by equipment of sufficient redundance and independence that no single failure can prevent the required actions.Any single failure within the protection system shall not prevent proper action at the system level when required.Provisions are made for control of the components of nuclear safety systems from the control room.Nuclear safety systems are designed to demonstrate functional performance requirements.

1 The design of nuclear safety systems includes design allowances for environmental disturbances at the site such as earthquakes, floods, high winds, storms and other disturbances such as fire and flooding from leakage of fluid systems, internally and externally generated missiles, and others.Standby electrical power sources are of suf f icient capacity to power all-necessary nuclear safety systems requiring electrical power.Standby ac and dc power sources are provided to remove decay heat when the offsite power supply is not available.

Engineered safeguards are designed to assure that no damage to the RCPB results from internal pressures caused by an accident or abnormal transient.

A primary containment is provided that completely encloses the reactor vessel.The primary containment uses the pressure suppression concept.The primary containment is designed to retain integrity as a radioactive material barrier during and following accidents that release radioactive material into the primary containment volume.It is possible to test primary.containment integrity and leaktightness at periodic intervals.

A reactor building is provided that completely encloses both the primary containment and the fuel storage areas.The secondary containment includes a method for controlling release of radioactive materials from the barrier and includes a capability for filtering radioactive materials within the barrier.1.2-5 Nine Mile Point Unit 2 FSAR 18.The reactor building is designed to act as a radioactive material barrier, if required, when the primary containment is open for expected operational purposes.19.The primary containment and reactor building, in conjunction with other engineered safeguards, limits radiological effects of accidents resulting in the release of radioactive material to the primary containment volume to significantly less than the requirements of 10CFR100.20.Provisions are made for removing energy from within the primary containment to maintain the integrity of the primary containment system following accidents that release energy to the primary containment.

21.Piping that penetrates the primary containment structure and serves as a path for the uncontrolled release of radioactive material to the environs is automatically isolated whenever such potential for radioactive material release exists.Such isolation is effected in time to limit radiological effects to significantly less than the requirements of 10CFR100.22.The emergency core cooling system (ECCS)is provided to limit fuel cladding temperature to 2,200 F as a result of a loss-of-coolant accident (IOCA).23.The ECCS provides for continuity of core cooling over the complete range of postulated break sizes in the RCPB.24.The ECCS is diverse, reliable, and redundant.

25.-Operation of the ECCS is initiated automatically when required,'regardless of the availability of offsite power.26.The main control room is shielded against radiation to permit continued occupancy under accident conditions.

27.In the event that the main control room becomes uninhabitable, it is possible to bring the reactor from power range operation to a cold shutdown 1.2-6 Nine Mile Point Unit 2 FSAR condition by manipulating local controls and equipment available outside the main control room.28.Backup reactor shutdown capability is provided independent of normal reactivity control provisions.

This backup system shuts down the reactor from any normal operating condition and maintains the shutdown condition.

I 1.2.1.3 System-by-System Approach The principal architectural and engineering criteria for design are summarized below on a system-by-system or system-group basis.The system-by-system presentation facilitates understanding of the actual design of any one system.Only the most restrictive of any related criteria are stated for a system.Where the most restrictive criterion is classified as a power generation consideration, less restrictive safety criteria may not be stated in the system-by-system presentation.

However, the actual design of a system must reflect all criteria that pertain to it.1.2.1.3.1 Nuclear System Criteria Principal design criteria for the reactor, ECCS, RCPB, and reactivity control systems are as follows: The nuclear system is designed to support a GE BWR rated at 3,323 MWt.2.Fuel cladding is designed to retain integrity as a radioactive material barrier throughout the design power range.Fuel cladding is designed to accommodate, without.loss of integrity, the pressures generated by the fission gases released from fuel material throughout the design life of the fuel.3.Fuel cladding, in conjunction with other unit systems, is designed to retain integrity throughout any abnormal operational transient.

Those portions of the nuclear system that form part of the RCPB are designed to retain integrity as a radioactive material barrier following abnormal operational transients and accidents.

5.Heat removal systems including the ECCS and makeup water supplies are provided in sufficient capacity, redundancy, and operational adequacy to remove heat 1%2 7 Nine Mile Point Unit 2 FSAR generated in the reactor core for the full range of normal operational conditions from unit shutdown to design power and for any abnormal operational transient or accident.The capacity of such systems is adequate to prevent fuel cladding damage.6.The reactor core and reactivity control system is designed to-ensure that control rod action is capable of bringing the core subcritical and maintaining it thus, even with the rod of highest reactivity worth fully withdrawn and unavailable for insertion.

An alternate reactivity control system is provided should the control rods or drive system become inoperable.

The alternate system is capable of shutting down the reactor and maintaining it subcritical.

7.The reactor core is'designed so that, its nuclear characteristics do not contribute to'divergent power transient.

8.The nuclear system is designed so there is no tendency for divergent oscillation of any operating characteristic, considering the interaction of the nuclear system with'other appropriate unit systems.1.2.1.3.2 Power Conversion Systems.Criteria Components of the power conversion systems are designed to perform these basic objectives:

Reliably produce electrical power from the steam supplied by the reactor, condense the steam into water, and return the water to the reactor as heated feedwater, with a major portion of its gaseous and particulate impurities removed.2.Assure that any fission products or radioactivity associated with the steam and condensate during normal operation or accident conditions are safely contained within the system or are released under controlled conditions in accordance with waste disposal regulations.

1.2-8 Nine Mile Point Unit 2 FSAR 1.2.1.3.3 Electrical Power Systems Design Criteria Sufficient preferred and standby ac and dc power sources are provided to attain prompt shutdown and continued maintenance of the unit in a safe condition under all credible circumstances.

Power sources are adequate to accomplish all required engineered safeguard functions under postulated design basis accident conditions.

1.2.1.3.4 Radwaste System Design Criteria Radwaste systems are designed to limit release of radioactive materials from the unit during normal operation to significantly less than the requirements of 10CFR20, and within the guidelines of Appendix I to 10CFRSO.Gaseous, liquid,, and solid waste disposal systems are designed so that offsite shipments will be in accordance with applicable regulations, including 10CFR20, 10CFR71, and 49CFR171 through 179, as appropriate.

3.The design provides means by which unit operations personnel can be alerted whenever operational limits on the release of radioactive material are approached.

1.2.1.3.5 Auxiliary Systems Design Criteria Auxiliary systems are provided to support the NSSS and power generation system to provide for maintenance of the plant environment, in-plant radiation and airborne contamination control, compressed air supplies, sealing steam, etc.2.Essential auxiliary systems are designed to function during accident conditions.

1.2.1.3.6 Shielding and Access Control Design Criteria Radiation shielding is provided and access control patterns are established to allow a properly trained operating staff to control radiation doses within the limits of published regulations during normal operation.

Shielding design, equipment layout, and zoning have been performed to ensure radiation doses are maintained as low as reasonably achievable.

1.2-9 Nine Nile Point Unit 2 FSAR 2.The main control room is shielded against, radiation so that in conjunction with the control room air conditioning system occupancy is allowed under accident conditions.

1.2.1.3.7 Nuclear Safety Systems and Engineered Safeguards Design Criteria Principal design criteria for nuclear safety systems and engineered safeguards are as follows: 1.These criteria correspond to 10CFR50 General Design Criteria 1 through 64 as described in Section 3.1.2~2.Standby ac and dc power sources are, designed to have sufficient capacity to power all necessary nuclear safety systems and engineered safeguards requiring electrical power.3.Standby ac power sources-are provided to allow reactor shutdown and removal of decay heat when offsite power is not available.

ln the event that the main control room is uninhabitable, it is possible to bring the reactor from power range operation to a cold shutdown condition by use of the shutdown room or manipulating local controls and equipment that are available outside the control room.5.Backup reactor shutdown capability is provided independently of normal reactivity control provisions.

This backup system has the capability to shut down the reactor from any normal or upset operating condition and subsequently to maintain the shutdown condition.

1.2.1.3.8 Process Control Syst: em Design Criteria Principal design criteria for process control systems are listed as follows: NSSS Process Control Desi n Criteria 1.Control equipment is provided to allow the reactor to respond automatically to load changes within design limits.1.2-10 Nine Mile Point Unit 2 FSAR 2.Controls are provided to manually control reactor power level.3.Control of the nuclear system is possible from-a--single"location.

Nuclear systems process controls and alarms are arranged to allow the operator to rapidly assess the condition of the nuclear system and to locate process system malfunctions.

5.Interlocks or other automatic equipment are provided as a backup to procedural controls to avoid conditions r'equiring actuation of nuclear safety systems or engineered safeguards.

Power Conversion S stems Process Control Desi n Criteria Control equipment is provided to control reactor pressure throughout its operating range.2.The turbine is capable of responding automatically to minor changes in load.3.,The feedwater system is controlled to maintain the water level in the reactor vessel at the optimum level range.4 Control of the power conversion equipment is possible from one location.5.Interlocks or other, automatic equipment are provided as a backup to procedural controls to avoid conditions requiring the actuation of nuclear safety systems or engineered safeguards.

Electrical Power S stem Process Control Desi n Criteria The safety-related (Class 1E)electrical power system is designed as a three-division system, any two out of three divisions being adequate to safely shut down the unit.2.The protection system is designed to detect and isolate faulted equipment from the system with a minimum of disturbance in the event of any fault in the system.Amendment 21 1.2-11 September 1985 Nine Mile Point Unit 2 FSAR 3.In the event of a loss of offsite power the protection system isolates the emergency buses from the offsite system and initiates the starting of the standby ac power sources.4.In the event of loss of offsite power and LOCA the protection system isolates the: emergency buses from the offsite system and the normal electrical system, and the standby diesel generators are started and sequentially loaded by a programmed control system to energize all safety-related loads.5.All electrically-operated breakers are controllable from the control room.6'.Metering for generators, transformers, and other essential circuits is available in the control room.1.2.2 Site Description 1.2.2.1 Site Characteristics:

Site Location and Size The project site comprises approximately 364 ha (900 acres)and is located on the south shore of Lake Ontario in the town of Scriba, Oswego County, NY, on land owned by the Niagara Mohawk Power Corporation (NMPC).The Nine Mile Point Nuclear Station-Unit 2 (Unit 2)shares the site with existing Unit 1;Unit 2 and support facilities occupy about 18.2 ha (45 acres)of the total site acreage.The James A.FitzPatrick plant, owned by the NYPA, is located east of the project site.The centerline-to-centerline distance between Unit 2 and the FitzPatrick plant reactors is about 716 m (2, 350 ft).The distance between the Nine Mile Point Unit 1 and Unit 2 reactor centerlines is about 274 m (900 ft).The site plan is shown on Figure 1.2-1.All activities at the site are under the direct control of NMPC"'.1.2.2.2 Access to the Site The protected area of the site is isolated from the surrounding area by fencing.Access to the site is controlled at the gate of the main entrance to the plant by security personnel.

All other gates are kept locked"'.USAR Revision 4 1.2-12 October 1992 Nine Mile Point Unit 2 FSAR 1~2.2.3 Description of the Site and Environs Most of the land immediately to the south and west of the site is pasture or inactive farmland.For the region west, south, and east of the site, the country is characterized by rolling terrain rising gently up from Lake Ontario which lies immediately to the north of the site.Within an approximate 8-km (5-mi)radius of Unit 2, the 1980 population was 3,468.The population for this same area is projected to be 5,301 in 1990 and 7,213 in 2010.The nearest dwellings are on Lakeview Road approximately 1.6 km (1 mi)from the station.The Ontario Bible Conference operates a summer camp on the lakefront adjacent to the western boundary of the site'swego, which is the nearest city, is located about 10 km (6.2 mi)southwest of the site and had a 1980 population of 19,793.The nearest population center with a population in excess of 25,000 is the city of Syracuse, approximately 53 km (32.8 mi)southeast of the site.Buffalo is approximately 217 km (135 mi)west of the site.Figure 2.1-1 shows the location of the site relative to the larger cities in New York State which are within the 80-km (50-mi)radius of the site.1.2.3 Structures and Equipment The buildings and structures essential to the safe operation and shutdown of the plant are designed to withstand extreme environmental and abnormal loading conditions.

The structures and/or portions thereof so designated are designed to provide the protection as required from tornadoes, missiles, earthquakes, pipe whip, and internal or external flooding.Additional discussions of design considerations are found in Chapter 3.Locations and orientation of the structures are shown on Figures 1.2-1 and 1.2-2.The general arrangement of personnel access between structures is shown on Figures 1.2-3 through 1.2-5.The general arrangement of the major structures and equipment is shown on Figures 1.2-6 through 1.2-40.The principal structures located at the site are listed below along with the brief description of the major equipment, within each structure.

The primary containment structure (Figures 1.2-6'through 1.2-12)houses the reactor pressure vessel, reactor 1.2-13 Nine Mile Point Unit, 2 FSAR recirculation pumps and motors, drywell cooling system unit, coolers, safety relief valves, accumulators, and other equipment.

The reactor building and auxiliary bays (Figures-1.2-6 through l.2-12)enclose the primary containment structure.

These structures house the remaining portions of the NSSS, refueling and fuel storage equipment, control rod drive (CRD)hydraulic units, equipment for the reactor water cleanup system (RWCU), equipment for the standby liquid control system (SLCS), equipment for the reactor building closed loop cooling water system, and other equipment.

The radwaste building (Figures 1.2-13 and 1.2-14)houses primarily the tanks and equipment associated with the liquid and solid radwaste systems.The control building (Figures 1.2-15 and 1.2-16)houses the main control room, standby switchgear, batteries and associated instrumentation, cables, and equipment.

The diesel generator building (Figures 1.2-17 and 1.2-18)houses three standby diesel generators, diesel oil storage tanks, and associated controls and instrumentation.

The turbine building including heater bay (Figures 1'-19 through 1.2-25)houses the turbine generator, condensers, moisture separator reheater, condensate demineralizer system, feedwater heaters, steam jet air ejectors, reactor feed pumps, turbine building closed loop cooling water system, and miscellaneous tanks and equipment to support the power conversion system and other related systems.The screenwell building (Figures 1.2-26 through 1.2-28)houses the circulating water pumps and the service water pumps with associated equipment and instrumentation.

The intake and discharge tunnels and intake structures (Figures 1.2-29'and 1.2-30)are used for transporting service water to and from the lake.The intake tunnels also supply makeup water for the circulating water system.The main stack (Figure 1.2-31)is used to provide elevated release of gases from the off-gas, standby gas treatment, and other systems.The off-gas regeneration and condensate demineralizer rooms (Figures 1.2-19 through 1.2-25)house the catalytic recombiners, off-gas filter, condensate demineralizer, and related equipment.

1.2-14 Nine Mile Point Unit 2 FSAR The normal switchgear building (Figures 1.2-32 and 1.2-33)houses the normal switchgear and associated equipment.

The auxiliary boiler building (Figure 1.2-34), located north of the screenwell building, houses the electric boilers and accessories to supply steam to the plant during shutdown.The standby gas treatment building and railroad access area (Figures 1~2-35 and 1.2-36)house the standby gas treatment, filters and associated equipment and allow access for spent fuel shipping.I The condensate storage tank building (Figure 1.2-37)houses the condensate storage tanks and associated equipment.

The natural-draft cooling tower (Figures 1.2-38 and 1.2-39)provides the normal heat, sink for heat transferred to the circulating water system from the main condensers.

The auxiliary service building (Figures 1.2-7 and 1.2-8), adjacent to the reactor building, houses the HVAC room and decontamination and shower facilities for personnel.

The decontamination area (Figures 1.2-19 through 1.2-21, 1.2-23, and 1.2-24), immediately south of the radwaste building, provides the facility for decontamination of large tools and equipment, and a sample room.It also houses clean steam reboilers and related equipment.

The hydrogen storage area (for hydrogen cooling of the turbine generator, Figure 1.2-40)is located west of the off-gas area.The hydrogen storage bottles are mounted on concrete.pads and are in a fenced area.1.2.4 Nuclear Steam Supply System The nuclear system includes a direct.-cycle, forced circulation, GE BWR that produces steam for direct use in the steam turbine.A heat balance showing the major parameters of the nuclear system for the warranted power condition is shown on Figure 1.1-1.The nuclear steam supply system is further discussed in Chapters 4 and 5.1.2.4.1 Reactor Core and Control Rods The reactor fuel and core design are described in Se'ction 2 of Reference 5 and Section 1 of Reference 6.Amendment 21 1.2-15 September 1985 Nine Mile Point Unit 2 FSAR Experience has shown that the control rods are.not susceptible to distortion and have an average life expectancy many times the residence time of a fuel loading.1.2.4.2 Reactor Vessel and Internals The reactor vessel contains the core and supporting structures; the steam separators and dryers;the jet pumps;the control rod guide tubes;the distribution lines for the feedwater, core sprays, and standby liquid control;the incore instrumentation; and other components.

The main connections to the vessel include the steam lines, coolant recirculation lines, feedwater lines, CRD and incore nuclear instrument housings, core spray lines, residual heat removal lines, standby liquid control line, core differential pressure line, jet pump pressure sensing lines, and water level instrumentation.

The reactor vessel is designed and fabricated in accordance with applicable codes for a pressure of 1,250 psig.The nominal operating pressure in the steam space above the separators is 1,020 psia.The vessel is fabricated of low-alloy steel and is clad internally with stainless steel (except for the top head nozzles and nozzle weld zones which are unclad).The reactor core is cooled by demineralized water that enters the lower portion of the core and boils as it flows upward around the fuel rods.The steam leaving the core is dried by steam separators and dryers located in the upper portion of the.reactor pressure vessel (RPV).The steam is then directed to the turbine through the main steam line'.Each steam line has two isolation valves in series, one on either side of the primary containment barrier.Amendment 21 1.2-16 September 1985 Nine Mile Point Unit 2 FSAR 1.2.4.3 Reactor Recirculation System The reactor recirculation system consists of two recirculation pump loops external to the RPV.These, loops provide the piping path for the driving flow of water to the RPV~jet pumps.Each external loop contains one high capacity motor-driven recirculation pump, two motor-operated maintenance valves, and one hydraulically operated flow control valve.The variable position hydraulic flow control valve operates in conjunction with a low.frequency motor generator set to control reactor power level through the effects of'coolant flow rate on moderator void.content.The jet pumps are RPV internals.

They provide a continuous internal circulation path for the major portion of the core coolant flow.The jet pumps are located in the annular region between the core shroud and the vessel inner wall.Any recirculation line break still allows core flooding to approximately two-thirds of the core height, the level of the inlet of the jet pumps.1.2.4.4 Residual Heat Removal System The residual, heat removal (RHR)system is a system of pumps, heat exchangers, and piping that fulfills the following functions:

1~Remove's decay and sensible heat during and after plant shutdown.2.Injects water into the RPV following a LOCA to reflood the, core independently of other core.cooling systems.3.Removes heat from the primary containment following a LOCA, to limit the increase in primary containment pressure.This is accomplished by cooling and recirculating" the suppres'sion pool water.and by spraying the drywell and suppression pool air spaces with suppression pool water.1.2.4.5 Reactor Water Cleanup System The RWCU system recirculates a portion of reactor coolant through a filter-demineralizer to remove particulate and dissolved.

impurities from the.reactor coolant.It also removes excess coolant from the reactor system under controlled conditions.

1.2-17 Nine Mile Point Unit 2 FSAR 1.2.4.6 Nuclear Leak Detection System The nuclear leak detection and monitoring system consists of temperature, pressure, flow, and fission-product sensors with associated instrumentation and alarms.This system detects and annunciates leakage in the following.

systems: 1~Main steam lines.2.Reactor water cleanup system.3.Residual heat removal system.4.Reactor core isolation cooling (RClC)system.5.Feedwater system.6.Emergency core cooling systems~7.Miscellaneous systems.Small leaks generally are detected by monitoring area temperatures, radiation levels, and dcain sump fillup and pumpout rates.Large leaks are also detected by changes in reactor water level, primary containment pressure and changes in flow rates in process lines.1.2.5 Electrical, Instrumentation, and Control Systems 1.2.5.1 Electrical Power System The plant electrical power system consists of the unit generator, the switchyard, and the unit auxiliary power distribution system.'I The unit generator is connected directly to the generator step-up.transformers and the normal station service transformer through isolated phase bus duct.The generator step-up transformers step up the output of the unit generator from 25 kV to a nominal 345-kV transmission system voltage.The normal station service transformer steps down the unit generator voltage from 25 to 13.8 kV and provides an onsite (ac)power source to the unit auxiliary power~distribution system.The switchyard has two separate and independent sections: the 345-kV switchyard and the 115-kV switchyard.

The output of the generator step-up.transformers is connected to the 345-kV switchyard which connects the unit Amendment 18 1.2-18 March 1985 Nine Mile Point Unit 2 FSAR generator to the outgoing transmission system.-The 115-kV switchyard receives power from two separate offsite power sources through'wo physically and electrically independent incoming circuits.'he two circuits feed'two separate reserve station service transformers and an auxiliary boiler transformer.

The reser've station service transformers step down the offsite power from 115 to 13.8 and 4.16 kV, and provide two independent"offsite power sources for the unit auxiliary-power distribution system.The auxiliary boiler transformer steps down the offsite power from 115 to 13.8 and 4.16 kV.Its'3.8-kV winding supplies power to the auxiliary boiler and associated equipment; the 4.16-kV tertiary winding provides a backup source'or the emergency 4.16-kV buses.The unit auxiliary power distribution system feeds all unit auxiliary loads through 13.8-kV switchgear, 4.16-kV switchgear, 600-V load centers, 600-V motor control centers, and various ac and dc distribution panels.The system is divided'into'nuclear nonsafety-related and nuclear safety-related systems.The nuclear nonsafety-related auxiliary power'distribution system feeds all non-Class 1E unit auxiliary loads.'nder normal plant operating conditions, it is energized from the normal station service transformer..

During'-startup and normal shutdown conditions, it.is energized from offsite power sources through reserve station service transformers' normal 125-V dc system, consisting of batteries, battery chargers, and distribution panels, provides a reliable source of power for protection, control, and instrumentation loads and dc motors under normal and emergency conditions of the plant.A i24-V dc system provides'a reliable source for the neutron monitoring system.The nuclear safety-related auxiliary power distribution system supplies all Class 1E unit auxiliary loads.This system is, divided into three independent divisions.

Division I and Division II are independent redundant divisions and supply all nuclear safety-related auxiliary loads except the high pressure core spray (HPCS)system.The HPCS system ,and related equipment are supplied by Division.III..All three divisions are normally energized from the offsite power sources through reserve station service transformers.

The auxiliary boiler transformer can be connected manually to act as a backup source for either the Division I or Division II supply.Each of the three divisions of the nuclear safety-related auxiliary power distribution systems has its own independent standby diesel generator.

In the event of a LOCA and/or 1.2-19 Nine Mile Point Unit 2 FSAR.loss of offsite power, each division is energized from its,, own standby diesel generator.

A 125-V emergency.

dc power;system feeds all safety-related dc,protection, control, and instrumentation loads and safety-related dc motors under normal.operation of the plant as well as during emergency.

conditions.

, The system is divided into three, independent divisions each consisting of its own battery, primary and backup battery chargers, switchgear, motor control centers, and distribution panels.Each division feeds the dc.loads associated with the.corresponding divisions of the nuclear safety-related auxiliary power distribution system.t Chapter 8 describes the electrical, power system in detail.1.2.5.2 Nuclear System Process Control and Instrumentation Reactor Manual Control S stem The reactor manual control system (RMCS)provides the means by which control rods are positioned from the control room for power control.The system operates valves in each hydraulic control unit to change control rod position.One control rod can be manipulated at a time.The RMCS includes the logic that restricts abnormal control rod movement (rod block)under certain conditions as a backup to procedural controls.Recirculation Flow Control S stem P f During normal power operation, a variable position discharge valve is used'to control flow.Adjusting this valve changes the coolant flow rate through the core and thereby changes the core power level.Neutron Monitorin S stem!'he neutron monitoring system (NMS)is a system of incore neutron detectors and out-of-core electronic monitoring equipment.

The system provides indication of neutron flux, which'an be correlated to thermal power level for the entire range of flux conditions that can exist in the core.The source range monitors (SRMs)and the" intermediate range monitors (IRMs)provide flux level indications during reactor startup and low-power operation.

The local power range monitors (LPRMs)and average power range monitors (APRMs)allow assessment of local and overall flux conditions during power range operation.

The traversing incore probe (TIP)'system provides a'eans to calibrate the USAR Revision 0 1.2-20 April 1989 Nine Mile Point Unit 2 FSAR individual LPRM.sensors.The NMS provides inputs to the RMCS to initiate rod blocks if preset flux limits are exceeded, and inputs to the reactor protection system to initiate a scram if other limits are exceeded.Refuelin Interlocks A system of interlocks that restrict movement of refueling equipment and control rods when the reactor is in the refueling and startup modes is provided to prevent an inadvertent criticality during refueling operations.

The interlocks back up procedural controls that have the same objective.

The interlocks affect the refueling platform, refueling platform hoists, fuel grapple, and control rods.Reactor Vessel Instrumentation reactor vessel head ann Process Com uter S stem In addition to instrumentation for the nuclear safety systems and engineered safety features, instrumentation is provided to monitor and transmit information that can be used to assess conditions existing inside the reactor vessel and the physical condition of the vessel itself.This instrumentation monitors reactor vessel pressure, water level, coolant temperature, reactor core differential pressure, coolant flow rates, and er seal ring leakage.An online process computer is provided to monitor and log process variables and to make certain analytical computations.

The nuclear measurement analysis and control rod worth minimizer (NUMAC RNM)prevents rod withdrawal under low-power conditions if the rod to be withdrawn is not in accordance with a preplanned pattern.The effect of the rod block is to limit the reactivity worth of the control rods by enforcing adherence to the preplanned rod pattern.Chapter 7 describes these systems in detail.1.2.5.3 Power Conversion Systems Process Control and Instrumentation Pressure Re lator and Turbine Generator Control The pressure regulator maintains control of the turbine control and turbine bypass valves to allow proper generator and reactor response to system load-demand changes while maintaining the nuclear system pressure essentially constant.USAR Revision 3 1.2-21 October 1991 Nine Mile Point Unit 2 FSAR The turbine generator speed-load controls can initiate rapid closure of the turbine control valves (rapid opening of the turbine bypass valves)to prevent turbine overspeed on loss of the generator electric load.Feedwater Control S stem The feedwater control system automatically controls the flow of feedwater into the reactor pressure.vessel to maintain the water within the vessel at predetermined levels.A three-element control system (main steam flow rate, feedwater flow rate, and reactor vessel water level)is used to accomplish this function.Chapter 10 describes the system in greater detail.1.2.6 Radioactive Waste System The disposal of radioactive wastes from the site is managed by waste systems designed to meet all applicable regulatory

>9[requirements, including 10CFR20, 10CFR60, 10CFR61, General Design Criterion 60, and Regulatory Guide 1.21.There are three interrelated radioactive waste treatment systems: radioactive liquid waste, radioactive gaseous waste, and radioactive solid waste.These systems are described in Chapter 11.The radioactive liquid waste (LWS)system collects and processes radioactive waste liquids generated during plant operation and refueling, either for recycle within the plant or for discharge offsite.The process operations available to treat the liquid wastes are filtration, evaporation, demineralization, and decantation.

Process descriptions and flow charts illustrate the number and sequence of.processing steps to be applied to each type of liquid waste.Gaseous radwaste from the main condenser is processed through a recombiner to remove hydrogen, after which the gas is cooled, then dried.Waste gas is then passed through a charcoal bed and filter system, which holds up radioactive components and removes particulate matter before release.Contaminated drywell and building ventilation exhausts are processed by the standby gas treatment and ventilation systems.The radioactive solid waste system provides holdup, packaging, and storage facilities for eventual offsite shipment and ultimate disposal of solid radioactive waste material.The process operations consist of volume Amendment 19 1.2-22 May 1985 Nine Mile Point Unit 2 FSAR reduction and solidification with asphalt of radioactive wastes such as LWS evaporator concentrates, spent resins, and filter sludges.Dry radioactive wastes such as contaminated paper, clothing, and tools are compacted and packaged.After processing, the solid waste materials are stored for additional decay and then'shipped offsite for appropriate disposal.Shielding, as required during the processing and shipment of the solid wastes, is included in the planned operation of the solid waste system.A description and flow diagram of the processing and handling sequences for the solid wastes generated onsite is provided in Chapter 11.1.2'Fuel Handling and Storage Systems 1.2.7'New Fuel Storage The new fuel facility is designed to prevent inadvertent criticality and load buckling of the new fuel assemblies.

Both the new fuel storage vault and storage racks are designed to comply with Category I requirements.

The new fuel storage vault is designed with sufficient drainage to preclude flooding.The vault is also equipped with a monitoring system to warn of radiation level increases above normal operating conditions.

t The design of the new fuel storage racks limits keff 50.90 in the dry condition and keff 60.95 in a flooded condition.

1.2.7.2 Spent Fuel Storage The spent fuel storage racks are designed to maintain spent fuel in a space geometry that prevents criticality in normal and abnormal conditions.

The racks are capable of withstanding maximum uplift forces generated without effect on the subcritical array.The design of the spent fuel racks will limit keff 50.95 in normal and abnormal storage conditions.

There is sufficient shielding, a cooling system, and radiation monitoring to prevent overheating and excessive personnel exposure.The spent fuel storage pool and racks are corrosion resistant, and adhere to Category I requirements.

1.2-23 Nine Mile Point Unit 2 FSAR 1.2.7.3 Fuel Handling System The fuel handling equipment includes the following:

1.Fuel inspection stand.2~Fuel preparation machine.3.125-ton crane.4.Refueling platform.5~General purpose grapple.6;Jib cranes.7.Other related tools for fuel and reactor servicing.

All equipment conforms to applicable codes and standards.

1.2.7.4 Spent Fuel Pool Cooling and Cleanup System The spent fuel cooling and cleanup (SFC)system provides removal of decay heat from the stored spent fuel and maintains specified water temperature, purity, clarity, and level.This process prevents the spent fuel from overheating

'nd the buildup of excessive radioactive materials in the cooling water, thereby minimizing radiation levels.The system includes.two heat exchangers, each of which is capable of removing the full decay heat from a normal refueling offload of spent fuels A cross connection to the RHR system provides additional emergency backup cooling and cooling during a full core offload.Chapter'gives further details of the fuel handling and storage system.1.2.8 Power Conversion System Chapter 10 provides a detailed discussion of the following equipment systems.1.2.8.1 Turbine Generator The turbine is an 1,800-rpm tandem-compound, six-flow, single-stage reheat unit with an electrohydraulic governor control.The turbine generator has an emergency trip system for turbine overspeed.

The output of the turbine generator Amendment 21 1.2-24 September 1985 Nine Mile Point Unit 2 FSAR is 1,165, 663 kWe at turbine guarantee conditions with 2.0 in Hg abs backpressure and 0 percent makeup.The generator is a direct driven, three-phase, 60-Hzt 25)000 Vf 1,800-rpm hydrogen inner-cooled, synchronous generator rated at 1,348,400 kVA at 0.90 power factor, 0.58 short-circuit ratio at maximum hydrogen pressure of 75 psig.1.2.8.2 Main Steam System The main steam system delivers steam from the nuclear boiler system through four 26-/28-in OD steam lines to the turbine generator, turbine bypass valves, steam jet air ejectors, off-gas preheaters, steam seal evaporator, and radwaste steam reboiler.1.2.8.3 Main Condenser The main condenser maintains 2.0 in Hg abs when operating at turbine guarantee conditions with 67.97 F circulating water inlet temperature.

The condenser includes provisions for accepting steam bypassed around the turbine generator.

Deaeration of condensate is accomplished in the condenser.

1.2.8.4 Main Condenser Air Removal System The main condenser air removal system, using air ejectors for normal operation and vacuum hogging pumps for startup, evacuates gases from the main turbine and condenser during plant startup and maintains the condenser essentially free of gases during operation.

This system handles all inleakage of noncondensable gases through the turbine seals, condensate, feedwater, and steam systems, and noncondensables that are generated in the reactor by disassociation of water.1.2.8.5 Turbine Gland Sealing System The turbine gland sealing system provides mildly radioactive steam to the seals of the turbine throttle valve stem glands and the turbine shaft glands.The sealing steam is supplied by a clean steam reboiler using condensate.

The unit auxiliary boiler provides an auxiliary steam supply for startup and when reactor heating steam is not available.

The steam packing exhauster collects and condenses the air and steam mixture and discharges the air and other noncondensables to the plant exhaust duct to the atmosphere, using a motor-driven exhauster.

USAR Revision 3 1.2-25 October 1991 Nine Mile Point Unit 2 FSAR 1.2.8.6 Steam Bypass System and Pressure Control System A turbine bypass system is provided which passes steam directly to the main condenser under control of the pressure regulator.

Steam is bypassed to the condenser whenever the reactor steaming rate exceeds the load passed to the turbine generator.

The capacity of the turbine bypass system is 25 percent of the turbine rated steam flow.The pressure regulation system provides main turbine control valve and bypass valve flow demands to maintain a nearly constant reactor pressure during normal plant operation.

It also provides demands to the recirculation system to adjust power levels by changing reactor recirculation flow rates.l.2.8.7 Circulating Water System The circulating water system provides the condenser with a continuous supply of cooling water.The circulating water system is a pumped closed loop system utilizing an air-cooled natural-draft cooling tower as a heat sink.Six one-sixth capacity circulating water pumps are provided to pump cooling water from the cooling tower basin through the main condenser and back to the top of the cooling tower.Makeup water is provided from?ake Ontario by the service water system.1.2.8.8 Condensate and Feedwater Systems The condensate and feedwater systems supply condensate from the condenser hotwell to the RPV~The condensate is pumped by two of the three condensate pumps through the full flow condensate demineralizer system, the intercooler of the air ejectors, and the steam packing exhauster to the condensate booster pumps.The condensate booster pumps pump the flow through three strings consisting of two drain coolers and five stages of low pressure heaters each.In addition, three heater drain pumps provide approximately one-third of the feedwater flow requirements.

The last low pressure heaters discharge to the suction of three parallel motor-driven reactor feedwater pumps.The discharge of the reactor feedwater pumps passes through three one-third capacity parallel heaters and into the RPV.The feedwater flow is controlled by varying the feedwater flow control valve position.1.2.8.9 Condensate Demineralizer System A full flow, deep bed condensate demineralizer system complete with regeneration facilities, instrumentation, and 1.2-26 Nine Mile Point Unit 2 FSAR semiautomatic controls is designed to ensure a constant supply of high quality water to the reactor.1.2.9 Nuclear Safety Systems and Engineered Safety Features Chapters 3, 4, 5, 6,=7, 9, and 10 give further details for)ie the following equipment and systems.1.2.9.1 Reactor Protection System The reactor protection system (RPS)initiates a rapid, automatic shutdown (scram)of the reactor.It acts in time to prevent fuel cladding damage and any nuclear system process barrier damage following abnormal operational transients.

The RPS overrides all operator actions and process controls and is based on a fail-safe design philosophy that allows appropriate protective action even if a single failure occurs.1 1.2.9.2 Neutron Monitoring System The neut"on monitoring system is a system of incore neutron detectors and oat-of-core electronic monitoring equipment.

The system provides indication of neutron flux, which can be correlated to thermal-power level for the entire range of flu".conditions that can exist in the core.The SRMs and tne IRMs provide flux lev'el'indications during reactor ste.tup and low power operation.

The LPRMs and~'iPRMs allow assessment of local and overall flux conditions during power range operation.

The TIP system provides=a means to calibrate the individual LPRM sensors.The NMS provides inputs to the RMCS to initiate rod blocks if preset flux limits are exceeded, and inputs to the RPS to initiate a scram if other limits are exceeded.1.2.9'Control Rod Drive System When a scram is initiated by the RPS, the CRD system inserts negative reactivity necessary to shut down the reactor.Each control rod is individually controlled by'a hydraulic control unit (HCU).When a scram signal is received, high pressu're water stored in an accumulator in the HCU or reactor pressure forces the control"rod into the core.1.2.9.4 Control Rod Drive Housing Supports CRD housing supports are located underneath the reactor vessel near the control rod housings.The supports limit the travel of'control rod in the event that a control rod housing is ruptured.The supports prevent a nuclear Amendment 18 1.2<<27 March 1985 Nine Mile Point Unit 2 FSAR excursion as a result of a housing failure and thus protect the fuel barrier.1.2.9.5 Control Rod Velocity Limiter A control rod velocity limiter is attached to each control rod to limit the velocity at which a control rod can fall out of the core should it become detached from the CRD.This action limits the rate of reactivity insertion resulting from a rod drop accident.The limiters contain no moving parts.1.2.9'Nuclear System Pressure Relief System A pressure relief syst: em consisting of safety/relief valves (SRV),mounted on the main steam lines is provided to prevent excessive pressure inside the nuclear.system from operational transients or accidents.

The SRV discharge steam is directed to the suppression pool within the primary containment.

1.2.9.7 Reactor Core Isolation Cooling System The RCIC system provides makeup water to the RPV when the vessel is isolated.The RCIC system uses a steam-driven turbine-pump unit and automatically operates to maintain adequate water level in the RPV for events defined in Section 5.4.6.1.1.2.9.8 Emergency Core Cooling Systems Four ECCSs are provided to maintain fuel cladding below the temperature.

limit in 10CFR50.46 in the event of a breach in the RCPB that results in a loss of reactor coolant.The systems are as follows.Hi h Pressure Core S ra HPCS The HPCS system provides and maintains an adequate coolant inventory inside the RPV to limit fuel cladding temperatures in the event of breaks in the RCPB.The system is initiated by either high pressure in the drywell or low water level in the vessel.It operates independently of all other systems over the entire range of pressure differences from greater than normal operating pressure to zero.The HPCS cooling decreases vessel pressure to enable the low pressure cooling systems to function.The HPCS system pump motor is powered by an onsite diesel generator if.offsite power is not available.

The system may also be used as a backup for the RCIC system.1.2-28 Nine Mile Point Unit 2 FSAR Automatic De ressurization S stem ADS The ADS rapidly reduces RPV pressure in a LOCA situation in which the HPCS system fails to maintain the RPV water level.The depressurization provided by the system enables the low pressure ECCS to deliver cooling water to the RPV.The ADS uses some of the relief valves that are part of the nuclear system pressure relief system.The automatic relief valves are arranged to open on conditions indicating both that a break in the RCPB has occurred and that the HPCS system is not delivering sufficient cooling water to the RPV to maintain the water level above a preselected value.Set points are discussed in Section 5.2.2.The ADS is not activated unless either the low pressure core spray (LPCS)or low pressure coolant injection (LPCI)pumps are operating.

This is to ensure that adequate coolant is available to maintain reactor water level after the depressurization.

Low Pressure Core S ra The LPCS system consists of one independent pump and valves and piping to deliver cooling water to a spray sparger over the core.The system is actuated by either low water level in the reactor vessel or high pressure in the drywell, but, water is delivered to the core only after RPV pressure'is reduced.This system provides the capability to cool the fuel by spraying.water into each fuel channel.The LPCS loop functioning in conjunction with the ADS or HPCS can provide sufficient fuel cladding cooling following a LOCA.Low Pressure Coolant In ection LPCI is an operating mode of the RHR system, but is discussed here because the LPCI mode acts as an engineered safety feature in conjunction with the other ECCSs.LPCI uses the pump loops of the RHR to inject cooling water into the RPV.LPCI is actuated by either low water level in the reactor vessel'or high pressure in the drywell, but water is delivered to the core only after RPV pressure is reduced.LPCI operation provides the capability of core reflooding, following a LOCA, in time to maintain the fuel cladding below the prescribed temperature limit.1.2.9.9 Containment Systems Primar Containment The primary containment is a Mark II design that incor-porates a drywell pressure suppression system and utilizes a 1.2-29 Nine Nile Point Unit 2 FSAR large reservoir of water to function as a heat sink to absorb energy.1.Functional Desi n The primary containment is a steel lined reinforced concrete structure.

It consists of a conical drywell chamber above a cylindrical suppression pool chamber separated by a drywell floor.This floor contains a piping system which would direct drywell steam into the suppression chamber reservoir in the event of a LOCA.2.Heat Removal The containment heat removal system is summarized in Section 1.2.9.14.3.Containment S ra The containment spray system consists of two redundant subsystems, each with its own full-capacity spray header.Each subsystem is supplied from a separate redundant RHR subsystem.

4.Combustible Gas Control The containment combusti-ble gas control system is summarized in Section 6.2.5.1.2.9.10 Containment and Reactor Vessel Isolation Control System The primary containment and RPV isolation control system automatically initiates closure of isolation valves to close off all process lines that are potential leakage paths for radioactive material to the environs.This action is taken upon indication of a breach in the RCPB.1.2.9.11 Nain Steam Isolation Valves 28 Although all pipelines that both penetrate the primary containment and offer a potential release path for radioactive material have redundant isolation capabilities, the main steam lines, because of their large size and large mass flow rates, are given special isolation consideration.

Automatic isolation valves are provided in each main steam line (MSIVs).Each is closed by spring force and pneumatic force and opened by pneumatic force.These valves fulfill the following objectives:

Prevent excessive damage to the fuel barrier by limiting the loss of reactor coolant from the RPV resulting from either a major leak from the steam piping outside the primary containment or a Amendment, 28 1.2-30 Nay 1987 Nine Mile Point Unit 2 FSAR malfunction of the pressure control system resulting in excessive steam flow from the RPV.2.Limit, the release of radioactive materials by isolating the RCPB in case of a gross release of radioactive materials from the fuel to the reactor cooling water and steam.3.Limit the release of radioactive materials by closing the containment barrier in case of a major leak from the nuclear system inside the containment.

1.2.9.12 Main Steam Flow Restrictors A venturi-type flow restrictor is installed in each steam line.These devices limit the loss of coolant from the RPV before the MSIVs are closed in case of a main steam line break outside the pr'imary containment.

1~2.9.13 Main Steam Radiation Monitoring System The main steam radiation monitoring system consists of four gamma radiation monitors located externally to the main steam lines just.outside the primary containment in the main steam tunnel.The monitors are designed to detect a gross release of fission products from the fuel.On detection of high radiation, the trip signals generated by the monitors are used by the RPS to initiate a reactor scram and to close the MSIVs.1.2.9.14 Residual Heat Removal System The RHR system is placed in operation to limit the temperature of the water in the suppression'ool and of the atmospheres in the drywell and suppression ch'amber following a design basis LOCA, to control the pool temp'erature during normal operation of the SRVs and the RCIC system, and to reduce the pool temperature following an isolation transient.

In the containment cooling mode of operation, the RHR main system pumps take suction from the suppression pool and pump the water through the RHR.heat.'e'xchangers Amendment 28 1.2-31 May 1987 Nine Mile Point Unit 2 FSAR where cooling takes place by transferring heat to the service water.The coolant is then discharged back to the suppression pool, the drywell spray header, the suppression chamber spray header, or the RPV.1.2.9.15 Ventilation Exhaust Radiation Monitoring System Permanently installed process and area radiation monitors provide indications and alarms on airborne radiation in the reactor building ventilation system, drywell atmosphere, fuel storage and refueling areas, and control room atmosphere.

Additionally, connections are provided in the reactor building ventilation system ductwork for continuous airborne monitors (CAMs).1,.2.9.16 Standby Gas Treatment System The standby gas treatment system (SGTS)processes exhaust.air from various plant systems to limit the release of airborne radioactivity, maintaining offsite dose rates below the specified limits.During a design basis accident the SGTS system is automatically actuated.When high radiation levels are sensed in any exhaust system connected to the SGTS system it is automatically placed in operation.

The SGTS consists of two identical, parallel but physically separated air filter train assemblies.

Each'ssembly is capable of handling the maximum design air flow rate.1.2'.17 Safety-Related Electrical Power Systems A standby power supply system is provided for the operation of emergency systems and engineered safety features during and following the shutdown of the reactor when the preferred power supply is not available.

The standby power supply system consists of three standby diesel generators.

One generator is dedicated to each of the three divisions of the safety-related electric power distribution system feeding each'lass 1E load group.Any two of the three standby diesel generators have sufficient, capacity to start and supply all needed engineered safety features and emergency shutdown loads in case of a LOCA and/or loss of offsite power.The standby diesel generator fuel oil storage tanks are sized to hold a 7-day supply of fuel oil based on the engine running continuously at full load.A LOCA and/or loss of offsite power signal initiates start of the standby diesel generators and the generators pick up the loads in a programmed sequence.Standby diesel generators are independent, and feed separate load groups through separate, physically and electrically isolated distribution systems'.2-32 Nine Mile Point Unit 2 FSAR Failure of any one unit will not jeopardize the capability of the remaining standby'iesel generators to start and run the required shutdown system and engineered safety feature loads.A 125-V emergency dc power system feeds all safety-related dc protection, control and instrumentation loads, and safety-related dc motors under normal operation of the plant as well as during emergency conditions.

The system is divided into three redundant divisions each consisting of its own battery, primary and backup battery chargers, switchgears/motor control centers, and distribution panels.Each division feeds dc loads associated with corresponding divisions of the safety-related electric power distribution system.Batteries and battery chargers are redundant and feed separate load groups through separate and isolated distribution systems, and failure of any one unit will not jeopardize the capability of remaining units to feed associated loads.1.2.9'8 Standby Liquid Control System Although not intended to provide prompt reactor shutdown, as the control rods are, the SLCS provides a redundant, independent, and alternate way to bring the nuclear fission reaction to subcriticality and to maintain subcriticality as the reactor cools.The system makes possible an orderly and safe shutdown in the event that not enough control rods can be inserted into the reactor core to accomplish shutdown in th'e normal manner.The system is sized to counteract the positive reactivity effect from rated power to the cold shutdown condition.

1.2.9.19 Safe Shutdown from Outside the Control Room In the event that the control room becomes inaccessible, the reactor can be brought from power range operation to cold shutdown conditions by use of neccessary controls located in the remote shutdown room.1.2.9.20 Main Control Room Heating, Ventilating and Air Conditioning System The main control room HVAC system provides and maintains an environment necessary for the safety and comfort of control room personnel during shutdown of the plant and in the event of a LOCA.1.2.9.21 Redundant Reactivity Control System The redundant reactivity control system (RRCS)determines if there is an existing transient that exceeds certain RPV Amendment 23 1.2-33 December 1985 Nine Mile Point Unit 2 FSAR pressure and wate'r level parameters and immediately activates ATWS prevention equipment.

, If the logic has determined, that a controlled shutdown is not occurring, the RRCS activates ATWS mitigation equipment..

Amendment 18 1.2-33a March 1985 Nine Mile Point Unit 2 FSAR THIS PAGE INTENTiONALLY BLANK Amendment 18 1.2-33b March 1985 Nine Mile Point Unit 2 FSAR 1.2.10 Cooling Water and Auxiliary Systems Chapter 9 provides a detailed discussion of these systems.1.2.10.1 Reactor Building Closed Loop Cooling Water System The RBCLCW system is a demineralized water, closed-circuit heat transfer system that consists of three 50-percent capacity pumps and heat exchangers, along with appropriate controls and instrumentation to ensure adequate cooling capacity for reactor plant auxiliary systems and components during normal plant operations'eat removed from components by the RBCLCW system is transferred, to the service water system.1.2.10'Turbine Building Closed Loop Cooling Water System The TBCLCW system is a demineralized water, closed-circuit heat transfer system that consists of three 50-percent capacity pumps and heat exchangers, along with appropriate controls and instrumentation to ensure adequate cooling capacity for the turbine building and radwaste building auxiliary systems and components, during normal plant operation.

Heat removed from components by the TBCLCW water system is transferred to the service water system.1.2.10.3 Service Water System The service water syst: em provides cooling water to various essential and nonessential components throughout the plant.Essential components are serviced by two 100-percent redundant subsystems.

T2;e nonessential components will be automatically isolated upon receipt of a LOCA signal coincident with a loss of offsite power.The service water pumps take their suction from Lake Ontario via the screenwell complex and intake tunnels.After passing through'he system, the discharge is returned to the lake and to the circulating water system as makeup.1.2.10.4 Ultimate Heat, Sink The ultimate heat sink is Lake Ontario, which provides water to the intake/discharge tunnels and is available at the screenwell building for plant use.1.2.10.5 Plant Chilled Water System The plant chilled water system consists of two subsystems, one serving the turbine, normal switchgear, and radwaste buildings, and one serving the control building.The 1.2-34 Nine Mile Point Unit 2 FSAR subsystems provide space cooling by distributing chilled water through cooling coils located in air moving units.The control building subsystem is an essential system designed to provide chilled water for cooling during all modes of plant operation.

Each subsystem contains mechanical refrigeration water chillers, circulation pumps, piping valves, cooling coils, accessories, instrumentation, and controls.1.2.10.6 Heating, Ventilating, and Air Conditioning Systems Individual heating, ventilating, and air conditioning systems are provided throughout the plant to maintain indoor temperature and humidity design conditions as required for optimum performance o f plant equipment and, where applicable, for human comfort.1.2.10.7 Process Sampling The process sampling system consists of the reactor plant, turbine plant, and radwaste sampling subsystems.

These subsystems are composed of the necessary piping, valves, coolers, instrumentation, and analyzers to draw and analyze samples of various plant process streams.Representative samples are taken automatically and/or manually for online and laboratory analyses of pH, conductivity, turbidity, oxygen, hydrogen, gaseous activity, fission product activity, dissolved gas concentration, and various metallic concentrations (such as copper, iron, and silica).'1.2.10.8 Condensate Makeup and Drawoff System The condensate makeup and drawoff system consists of two storage tanks, piping, and instrumentation.

It receives drawoff water from and supplies makeup water to the main condenser and fuel pool, and provides makeup of reactor coolant inventory for the RCIC and HPCS systems.Water in the condensate storage tanks is replenished from the makeup water treatment system.1.2.10.9 Water Treatment and Makeup Water Systems The water treatment system is composed of a water filter, an activated carbon filter, an'acid exchanger unit, a'orced-draft degasifier, a base anion exchanger, and a mixed-bed ion exchange demineralizer.

The system'purifies lake water supplied from the service water system and delivers it to the demineralized water storage tanks.1.2-35 Nine Mile Point Unit 2 FSAR The makeup water system provides demineralized makeup water from the storage tanks for the power conversion system and the TBCLCW and RBCLCW systems.In addition, the makeup water system satisfies various miscellaneous plant requirements for demineralized water, including the suppression pool and the spent fuel pool.1.2'0.10 Domestic Water and Sanitary Drains and Disposal Systems Domestic Water S stem Domestic water for drinking and to satisfy the flow and pressure requirements of all installed plumbing fixtures is supplied from an existing city main.Water quality is in accordance with applicable standards promulgated by the State of New York.Sanitar Drains and Dis osal S stem Raw sanitary waste from Unit 2 is directed to the Nine Mile Point Unit 1 sanitary waste treatment plant.This plant conforms to all applicable local, state, and federal discharge limitations.

1.2.10.11 Compressed Air Systems The compressed air systems are composed of a service and instrument air system and a breathing air system.Service and Instrument Air S stem Three air compressors, each discharging through an aftercooler, a filter, and an air receiver into a common header, supply all the service and instrument.

air required by the plant.The service air is taken directly from the common header.The instrument air is passed through one of two 100-percent capacity air dryers and then through one of two 100-percent capacity air filters before delivery to the various plant instruments.

Breathin Air S stem A single air compressor discharges through an aftercooler to a receiver.Air from this receiver is filtered to comply with OSHA requirements for breathing air.1.2-36 Nine Nile Point Unit 2 FSAR 1.2.10.12 Auxiliary Steam System An auxiliary steam system furnishes a separate and independent steam supply.Process steam.is generated in high voltage, electrode boilers and distribut d throughout the plant by an auxiliary steam header.Auxiliary steam is required for main turbine shaft sealing steam during startup and for the radwaste building during plant shutdown.1.2.10.13 Standby Diesel Generator Fuel Oil Storage and Transfer System The standby diesel generator fuel oil storage and transfer system supplies fuel oil for operation of the standby diesel generators.

This system is an essential system and is capable of supplying fuel oil during all modes of plant operation, including loss of offsite power coincident with a LOCA.1.2..10.14 Fire Protection System The fire protection system consists of fire hydrants, hose stations, and automatic sprinkler and deluge systems.Where required, automatic or manually actuated carbon dioxide, foam, or Halon fire suppression systems are provided.Automatic fire detectors are provided in selected areas.Portable fire extinguishers and fire hose reels are located throughout the plant.1.2.10.15 Communication Systems The station communication systems are designed to provide reliable communication between all essential areas of the station and to locations remote from the station during normal and emergency conditions and under maximum potential noise levels.This is achieved through five different communication systems as follows: 1.A dial telephone system for voice communication between selected-office areas and selected locations inside and outside the station.The dial telephone system is connected to the telephone tie system for offsite communication including communication with local law enforcement authorities and the local fire department.

2.A portable radio communication system for communication between station personnel and NNPC personnel located outside the station in case the dial telephone system between the station and the 1.2-37 Nine Mile Point Unit 2 FSAR points outside the station becomes inoperable.

The radios are powered by rechargeable batteries and are independent of any electrical system of the plant.3.A page party/public address (PP/PA)communication system with five party channels and one page channel for communication between all buildings and locations within the plant, even under extremely noisy conditions.

This is also-used for the emergency alarm and evacuation system and is powered from an uninterruptible power supply (UPS).A separate.maintenance and calibration communication (M/CC)system for use in areas requiring communication for testing, instrument calibration, maintenance, and for use during construction and startup.5.One of the channels of the M/CC system is capable of being operated as a sound-powered communication (SPC)system.This system can be used in case of a total loss of electric power to the PP/PA and M/CC systems.This system requires no plant electric power and works through M/CC system wiring.The design of the communication systems permits routine surveillance and testing without disrupting normal communication facilities.

The paging system is electrically

.supervised, permitting immediate corrective action to be taken if the line becomes inoperative.

1.2.10.16 Tighting Systems The station lighting systems are designed to-provide adequate lighting in all necessary areas of the station during both emergency and normal operating conditions.

This is achieved through the following lighting subsystems:

1.Normal station lighting system.2~Emergency lighting system.3.Essential lighting system.4.Egress lighting system.The normal station lighting system provides adequate lighting in all areas of the station under normal operating conditions.

This is fed from the station normal 600-V load 1.2-38 Nine Mile Point Unit 2 FSAR centers through the main lighting dry-type distribution transformers, panels.distribution panels, and subdistribution The emergency lighting system provides adequate lighting required for operating the safety-related equipment during emergency conditions in the control room, diesel generator rooms, emergency'switchgear areas, and relay and computer room.This is treated as a Class 1E system except for the lighting fixtures.The lighting fixtures are seismically supported.

The emergency lighting system is divided into'three separate divisions corresponding to Divisions I, II, and III of the plant emergency ac distribution system and is fed from the corresponding Class 1E load centers/motor control centers through the main lighting distribution panels,.dry-type distribution transformers, and subdistribution panels.In case of a loss of offsite power, the emergency lighting system is fed from the standby diesel generators through manually operated circuit breakers.The emergency lighting system fixtures are constantly energized.

The essential lighting system provides partial lighting for certain cri'tical areas of the station requiring continuous lighting such as the control room, relay and computer room, standby diesel generator rooms, and emergency switchgear rooms'he essential lighting system receives power from the station normal UPS system and is fed through dry-type distribution transformers and subdistribution panels.The essential lighting fixtures powered by the UPS system are constantly energized.

The egress lighting system provides adequate lighting for all egress signs inside the plant.This is designed as a separate system specifically for the inside building egress emergency conditions in accordance with OSHA requirements.

The egress lighting system receives power from the station normal UPS system as part of the essential lighting distribution system.The egress lighting fixtures are constantly energized.

The 8-hr battery pack lighting provides illumination in all areas required for operation of any safe shutdown equipment and in access and egress routes thereto in case of a fire.23 Fluorescent, incandescent, and high pressure sodium lamps are used for station lighting.Fluorescent lamps are used for all offices and for most of the operating areas such as the control room, relay and computer room, and emergency and normal switchgear rooms.Incandescent lamps are used in the primary containment, primary containment access hatches, main steam tunnel, new fuel storage vault, spent fuel pool filter room, and in all other areas where lighting is infrequently required.High pressure sodium lamps are used Amendment 23 1.2-39 December 198S Nine Mile Point.Unit 2 FSAR for all high bay lighting such as in the turbine building and reactor building general areas.1.2-40 Nine Mile Point Unit 2 FSAR 1.2.ll References Niagara Mohawk Power Corporation.

Preliminary Safety Analysis Report, Volume I, Nine Mile Point Nuclear Station-Unit 2, June 1972.2.3.Niagara Mohawk Power Corporation.(Construction Permit Stage), Nine Station-Unit 2, June 1972.I Oswego County Planning Board.Plan, August 1976.Environmental Report Mile Point Nuclear Preliminary Land Use Gulf 6 Western Topical Report.GGW-FSD 2538, Nuclear Main Steam Isolation Valve Systems, January 1979.5.General Electric Licensing Topical Report.General Electric Standard Application for Reactor Fuel.NEDE-24011-P-A (latest approved revision)~6~General Electric Licensing Topical Report.General Electric Standard Application for Reactor Fuel (U.ST Supplement), NEDE-24011-P-A-US (latest approved r'evision).

Amendment 21 1.2-41 September 1985