ML090780780
| ML090780780 | |
| Person / Time | |
|---|---|
| Site: | Indian Point |
| Issue date: | 03/18/2009 |
| From: | Public Commenter Public Commenter |
| To: | Division of License Renewal |
| NRC/NRR/DLR | |
| References | |
| 73FR80440 | |
| Download: ML090780780 (76) | |
Text
1 IPRenewalCEmails From:
Deborah Brancato [DBrancato@riverkeeper.org]
Sent:
Wednesday, March 18, 2009 8:51 PM To:
IndianPointEIS Resource
Subject:
Riverkeeper, Inc.'s Comments on the Indian Point License Renewal DSEIS, Docket Nos.
50-247 and 50-286 Attachments:
Riverkeeper's Comments on Indian Point License Renewal DSEIS.pdf; Exhibit A - Pisces Expert Report (March 2009).pdf; Exhibit B - Letter from NMFS to NRC, Re BA (Feb. 24, 2009).pdf; Exhibit C - Map of Intake Site of Proposed Rockland County Desalination Plant.pdf; Exhibit D - Google map showing proximity of IP to proposed desalination plant.pdf; Exhibit E - Letter from DEC to Riverkeeper re DEC lead agency status for desalination project.pdf
Dear Rulemaking,
Directives and Editing Branch Chief:
Attached for submission, please find Riverkeeper, Inc.s Comments on the Indian Point License Renewal DSEIS along with four (4) supporting Exhibits, each attached separately, in the above referenced matter. A courtesy hard copy of Riverkeepers submission will follow in the mail.
Thank you for your consideration.
Deborah Brancato Staff Attorney Riverkeeper, Inc.
828 South Broadway Tarrytown, NY 10591 914-478-4501 (ext. 230)
Fax: 914-478-4527 dbrancato@riverkeeper.org www.riverkeeper.org Riverkeeper -- Defending the Hudson. Protecting Our Communities.
This message contains information that may be confidential or privileged and is intended only for the individual or entity named above. No one else may disclose, copy, distribute or use the contents of this message. Unauthorized use, dissemination and duplication is strictly prohibited, and may be unlawful. All personal messages express views solely of the sender, which are not to be attributed to Riverkeeper, Inc. and may not be copied or distributed without this disclaimer. If you received this message in error, please notify us immediately at info@riverkeeper.org or call 914-478-4501.
Federal Register Notice:
73FR80440 Comment Number:
87 Mail Envelope Properties (034515570463034C82F8EE369F60E8BE76E4256C2C)
Subject:
Riverkeeper, Inc.'s Comments on the Indian Point License Renewal DSEIS, Docket Nos. 50-247 and 50-286 Sent Date:
3/18/2009 8:50:31 PM Received Date:
3/18/2009 8:51:14 PM From:
Deborah Brancato Created By:
DBrancato@riverkeeper.org Recipients:
"IndianPointEIS Resource" <IndianPoint.EIS@nrc.gov>
Tracking Status: None Post Office:
halfmoon.riverkeeperny.com Files Size Date & Time MESSAGE 1402 3/18/2009 8:51:14 PM Riverkeeper's Comments on Indian Point License Renewal DSEIS.pdf 546032 Exhibit A - Pisces Expert Report (March 2009).pdf 291372 Exhibit B - Letter from NMFS to NRC, Re BA (Feb. 24, 2009).pdf 136406 Exhibit C - Map of Intake Site of Proposed Rockland County Desalination Plant.pdf 4186092 Exhibit D - Google map showing proximity of IP to proposed desalination plant.pdf 2075933 Exhibit E - Letter from DEC to Riverkeeper re DEC lead agency status for desalination project.pdf 125438 Options Priority:
Standard Return Notification:
No Reply Requested:
No Sensitivity:
Normal Expiration Date:
Recipients Received:
1 828 South Broadway, Tarrytown, NY 10591 x 914.478.4527 x f: 914.478.4527 x www.riverkeeper.org VIA E-MAIL AND FIRST-CLASS MAIL March 18, 2009 Chief, Rulemaking, Directives and Editing Branch Division of Administrative Services Office of Administration Mailstop T-6D59 U.S. Nuclear Regulatory Commission Washington, DC 20555-0001 IndianPoint.EIS@nrc.gov Re: 5LYHUNHHSHU,QF¶V&RPPHQWVRQWKH861XFOHDU5HJXODWRU\\&RPPLVVLRQ¶V*HQHULF
Environmental Impact Statement for License Renewal of Nuclear Plants, Supplement 38, Regarding Indian Point Nuclear Generating Unit Nos. 2 and 3, Draft Report for Comment, Docket Nos. 50+/-247 and 50+/-286
Dear Rulemaking,
Directives and Editing Branch Chief:
5LYHUNHHSHU,QF³5LYHUNHHSHU'KHUHE\\UHVSHFWIXOO\\VXEPLWVWKHIROORZLQJFRPPHQWV on the U.S. Nuclear RegXODWRU\\&RPPLVVLRQ6WDII¶V³15&6WDII'Generic Environmental Impact Statement for License Renewal of Nuclear Plants, Supplement 38, Regarding Indian Point Nuclear Generating Unit Nos. 2 and 3, Draft Report for Comment (also known as the Draft Supplemental Environmental Impact Statement, and hereinafter referred to as ³'6(,6' Notice of availability of and opportunity to comment on the DSEIS was published in the Federal Register on December 22, 2008.1 Introduction Riverkeeper has been actively involved in the Indian Point relicensing proceeding due to the serious concerns relating to the continued operation of the facility, including the environmental damage caused by its antiquated once-through cooling system and leaking spent fuel pools, the vulneraELOLW\\RIWKHSODQW¶VVSHQWIXHOSRROVWRWHUURULVWDWWDFNs and serious accidents, and the failure of any long-term solution for permanent nuclear waste disposal. As the NRC Staff is well aware, Riverkeeper filed a successful petition to intervene in IndiDQ3RLQW¶VUHOLFHQVLQJ
1 Nuclear Regulatory Commission, Indian Point Nuclear Generating Unit Nos. 2 and 3; Notice of Availability of the Draft Supplement 38 to the Generic Environmental Impact Statement for License Renewal of Nuclear Plants and Public Meeting for the License Renewal of Indian Point Nuclear Generating Unit Nos. 2 and 3, Docket Nos. 50+/-247 and 50+/-286, 73 Fed. Reg. 80,440 (2008).
2 proceeding, and is currently litigating three contentions which have been admitted for an adjudicatory hearing.2 On October 17, 2007, Riverkeeper submitted Scoping Comments to LQIRUPWKH15&6WDII¶VHQYLURQPHQWDOUHYLHZpursuant to NEPA in the license renewal proceeding.3 Disappointingly, the NRC Staff has failed to meaningfully address any of the LVVXHVUDLVHGE\\5LYHUNHHSHU¶VFRPPHQWV
An exhaustive review of the DSEIS reveals glaring deficiencies which wholly undermine the NRC SWDII¶VLQLWLDOFRQFOXVLRQWKDWWKHHQYLURQPHQWDOLPSDFWVRI,QGLDQ3RLQW¶VRSHUDWLRQDUHQRW severe enough to preclude renewing its operating license.4 Riverkeeper absolutely disagrees with this determination and submits that if the NRC Staff had performed the proper assessments as outlined in the following comments, then they would have reached the opposite conclusion.
Riverkeeper urges the NRC Staff to fully consider and address the following comments prior to issuing the Final Supplemental Environmental Impact Statement for License Renewal of Indian 3RLQW³)6(,6'LQRUGHUWRFRPHWRDPRUHDFFXUDWHUHFRPPHQGDWLRQWRWKH&RPPLVVLRQ
DSEIS Section 1.0
- 1. Improper Reliance on Outdated GEIS In Section 1.0 of the DSEIS, the NRC Staff explains its use of the 1996 License Renewal Generic Environmental Impact Statement, NUREG-³*(,6'5 +RZHYHUDV5LYHUNHHSHU¶V
Scoping Comments explained at length, such reliance is misplaced. The GEIS is inadequate if evidence exists of material changes affecting the baseline environment since the GEIS was written.6 It has been 13 years since the GEIS was written. Since that time, various new circumstances have arisen that have materially changed the baseline environment, including heightened risks of terrorism, the failure of a permanent nuclear waste disposal solution, changes in population density, and progress in the viability of renewable energy technologies.
Accordingly, the GEIS is no longer adequate to dispose of such issues, and they must be specifically assessed in the environmental review process for Indian Point. Unfortunately, as discussed in further detail where applicable in the comments herein, the NRC Staff has ignored VXFKQHZLQIRUPDWLRQDQGFRQWLQXHVWRUHO\\RQWKHRXWGDWHG*(,67KH15&¶VUHIXsal to consider such material changes violates the fundamental requirements of NEPA.
$VH[SODLQHGLQ5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVWKH15&KDVIDLOHGWRXSGDWHWKH*(,6LQD
timely fashion as required by law.7 The law requires the GEIS to be updated every 10 years.
2 5LYHUNHHSHU,QF¶V5HTXHVWIRU+HDULQJDQG3HWLWLRQWR,QWHUYHQHLQ,QGLDQ3RLQW/LFHQVH5HQHZDO3URFHHGLQJ
1RYHPEHUKHUHLQDIWHU³5LYHUNHHSHU3HWLWLRQIRU+HDULQJ'See Entergy Nuclear Operations, Inc. (Indian Point Nuclear Generating Units 2 and 3), LBP-08-15&BBVOLSRS-XO\\³-XO\\$6/%
2UGHU'
3 Riverkeeper Comments on Environmental Scoping for the Indian Point License Renewal Proceeding, Docket Nos.
50-247, 50-286 (Oct. 12, 2007), available at http://www.riverkeeper.org/document.php/642/101207_Scoping_.pdf
KHUHLQDIWHU³5LYHUNHHSHU6FRSLQJ&Rmments).
4 DSEIS, Main Report § 9.3, at 9-8.
5 Id. § 1.2.1.
6 Blanco v. Burton, Slip Copy, 2006 WL 2366046 (E.D. La.); League of Wilderness Defenders v. Marquis-Brong, 259 F.Supp.2d 1115 (U.S. Dist. Ct. Or. Apr. 2003).
7 See 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWV at 1-2; 10 C.F.R. Part 51, Subpart A, Appendix B.
3 7KHVFKHGXOHH[SODLQHGLQ5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVSURMHFWHGDILQDO*(,6E\\)HEUXDU\\
2009. That deadline has obviously passed, without any public notice or mention by the NRC of any pending review or update of the GEIS. Internal communications between DEC and NRC Staff indicates that NRC Staff have thus far failed to complete even a draft for public notice and comment by this coming summer. At this time, the required deadline for the GEIS review is three years overdue, and counting. It is ridiculous that the environmental review process for
,QGLDQ3RLQW¶VOLFHQVHUHQHZDOUHOLHVXSRQDGRFXPHQWZKLFKKDVQRWEHHQXSGDWHGDVOHJDOO\\
required. Accordingly, the NRC Staff should not rely on the GEIS until the NRC has completed
³-year UHYLHZ'DQGGHWHUPLQHGZKHWKHURUQRWWKH*(,6ZLOOEHXSGDWHG
0RUHRYHUDVGLVFXVVHGLQ5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVWKHPDQGDWHVRIWKH1DWLRQDO
(QYLURQPHQWDO3ROLF\\$FW³1(3$'UHTXLUHWKDWIHGHUDODJHQFLHVWDNHD³KDUGORRN'DWWKH
environmental impacts of a proposed action.8 7KLVLQFOXGHVDVVHVVLQJ³VLJQLILFDQWQHZ
circumstances or information relevant to the environmental concerns that bear on the SURSRVHGDFWLRQRULWVLPSDFWV'9
- 2. Failure to Assess Deficient Emergency Planning Anywhere in the DSEIS The deficiencies of the DSEIS comes starkly into focus when it comes to the issue of emergency planning. Indeed, the NRC Staff has classified emergency planning issues as outside the realm of license review, and no mention whatsoever of the seriouVFRQFHUQVZLWK,QGLDQ3RLQW¶V
emergency plan is made in the DSEIS.10 This flies in the face of logic given the changes in population density and traffic pattern in the area surrounding the facility since the plant started operating. In particular, since,QGLDQ3RLQW¶VLQLWLDOOLFHQVLQJWKHSRSXODWLRQDURXQGWKHIDFLOLW\\
has nearly doubled, resulting in significant traffic congestion that would prevent authorities from evacuating the residents living within the ten-PLOH(PHUJHQF\\3ODQQLQJ=RQH³(3='LQthe event of an accident or terrorist attack. Roads and bridges would not be able to handle the amount of traffic leaving the 10-mile radius and beyond in the event of an accident or attack.11 Clearly the environmental impacts on public health will be far greater if the population within the 10-mile emergency planning zone cannot be evacuated in a timely manner.
$FFRUGLQJWRDQLQGHSHQGHQWDQDO\\VLVRI,QGLDQ3RLQW¶VHPHUJHQF\\SODQVFRPPLVVLRQHGE\\
former New York Governor George Pataki in 2003 and authored by former FEMA director James Lee Witt found, the radiological emergency plan for Indian Point is badly flawed, XQZRUNDEOHDQGNH\\FRPSRQHQWVDUHXQIL[DEOH:LWWIRXQGWKDW³WKHFXUUHQWUDGLRORJLFDO
response system and capabilities are not adequate to... protect the people from an unacceptable GRVHRIUDGLDWLRQLQWKHHYHQWRIDUHOHDVHIURP,QGLDQ3RLQW'12 8 See generally 42 U.S.C. § 4332; Riverkeeper Scoping Comments at 2-4.
9 &)5FLL)RUW\\0RVW$VNHG4XHVWLRQV&RQFHUQLQJ&(4¶V1DWLRQDO(QYLURQPHQWDO3ROLF\\$FW
Regulations, 46 Fed. Reg. 18036.
10 Environmental Impact Statement Scoping Process, Summary Report, Indian Point Nuclear Generating Station 8QLW1RVDQG9LOODJHRI%XFKDQDQ1HZ<RUN'HFHPEHU³15&6WDII6FRSLQJ6XPPDU\\5HSRUW'DW
ILQGLQJWKDW³RIIVLWHHPHUJHQF\\SODQQLQJLVQRWZLWKLQWKHVFRSHRIWKH15&¶VHQYLURQPHQWDOUHYLHZ'VLQFHWKH
15&³PRQLWRUVHPHUJHQF\\SODQQLQJXQGHUUHTXLUHPHQWVRIWKHFXUUHQWRSHUDWLQJOLFHQVH'
11 See Riverkeeper Scoping Comments at 5 n.11.
12 Review of Emergency Preparedness of Areas Adjacent to Indian Point and Millstone, p. viii, James Lee Witt Associates, 2003.
4 In 2003 KLD Associates conducted a traffic study for Entergy and determined that evacuation times for the Emergency Planning Zone around Indian Point doubled since 1994. The original estimate was 2.5 hours5.787037e-5 days <br />0.00139 hours <br />8.267196e-6 weeks <br />1.9025e-6 months <br /> for people to proceed with evacuation, with a total of 5.5 hours5.787037e-5 days <br />0.00139 hours <br />8.267196e-6 weeks <br />1.9025e-6 months <br /> for complete evacuation. KLD estimates increased mobilization time to four hours, while complete evacuation of the region in good weather conditions could take up to 9.5 hours5.787037e-5 days <br />0.00139 hours <br />8.267196e-6 weeks <br />1.9025e-6 months <br /> and in snow conditions up to 12 hours1.388889e-4 days <br />0.00333 hours <br />1.984127e-5 weeks <br />4.566e-6 months <br />.13 Shadow evacuation would increase this time.
The NRC itself has recognized the concerns associated with the location of Indian Point and increased population density, even prior to the September 11th terrorist attacks.14 Were Entergy applying for a license to build a new nuclear power plant where Indian Point is now located, it is unlikely they would be allowed to do so, based on its proximity to such a highly populated area.15 In fact, in the evaluation factors for stationary power reactor site applications before January 1997 the regulations state that residences within the exclusion area shall normally be prohibited.16 In exclusion areas with residents, the regulations recommend low population zones
- the total number and density of which are such that there is a reasonable probability that appropriate protective measures could be taken in their behalf in the event of a serious accident.17 The regulations state where very large cities are involved, the regulations find that a greater distance may be necessary because of total integrated population dose consideration.18 The regulations for reactors built after 1997 require that every site must have an exclusion area and a low population zone.19 7KHVHUHJXODWLRQVGHILQHORZSRSXODWLRQ]RQHDV³WKHDUHD
immediately surrounding the exclusion area which contains residents, the total number and density of which are such that there is a reasonable probability that appropriate protective PHDVXUHVFRXOGEHWDNHQLQWKHLUEHKDOILQWKHHYHQWRIDVHULRXVDFFLGHQW'20 There are 300,000 people living within the ten-mile EPZ of Indian point and the only means of evacuation are primarily one and two lane roads. The regulations do not specify a permissible population density or total population within this zone because the situation may vary from case to case.21 The regulations go on to say whether a specific number of people can, for example, be evacuated from a specific area, or instructed to take shelter, on a timely basis will depend on many factors such as location, number and size of highways, scope and extent of advance planning, and actual distribution of residents within the area.22 As far as Indian Point is concerned, there is no low population zone, therefore if Entergy were applying to build a new nuclear power plant as opposed to a relicensing it would likely not be permitted.
13 Indian Point Energy Center Evacuation Time Estimate, Tbl. 1-1, p. 1-12, KLD Associates, Inc., 2003.
14 Report of the Office of the Chief Counsel on Emergency Preparedness to the President's Commission on the
$FFLGHQWDW7KUHH0LOH,VODQG2FWREHUS5REHUW5\\DQWKH15&¶V'LUHFWRURIWKH2IILFHRI6WDWH
SURJUDPVVWDWLQJ³,WKLQNLWLVLQVDQHWRKDYHDWKUHH-unit reactor on the Hudson River in Westchester County, 40 miles from Times Square, 20 miles from the Bronx... [Indian Point is] one of the most inappropriate sites in H[LVWHQFH')
15 See 10 C.F.R. Pts. 100.3, 100.10(b), 100.11, & 100.21(h).
16 10 C.F.R. § 100.3.
1710 C.F.R. § 100.10(b).
18 Id.
19 10 C.F.R. § 100.21(h).
20 10 C.F.R. § 50.2.
21 Id.
22 Id.
5 Based on the foregoing, it is absurd to exclude emergency planning from review during the license renewal process. The NRC Staff must assess the changes to population density and traffic concerns during its environmental review process in the context of assessing the environmental impacts of an accident or attack on Indian Point that results in a radiological release.23 Failing to do so leaves the DSEIS fundamentally flawed.
DSEIS Section 4.0
$IWHU³REMHFWLYHO\\'GHVFULELQJKRZ,QGLDQ3RLQWLQWHUDFWVZLWKWKHHQYLURQPHQWLQ6HFWLRQRI
the DSEIS, Section 4.0 SUHVHQWVWKH15&6WDII¶VDVVHssment of the environmental impacts of FRQWLQXHGRSHUDWLRQRIWKHIDFLOLW\\7KLVVHFWLRQRIWKH15&6WDII¶VUHYLHZLVULGGOHGZLWK
GHILFLHQFLHVDVIROORZVLPSURSHUDQDO\\VLVRIWKHHQYLURQPHQWDOLPSDFWVRI,QGLDQ3RLQW¶V
once-through-cooling system, (2) improper analysis of the impacts to endangered or threatened species, (3) improper analysis of groundwater contamination caused by spent fuel pool leaks, (4) failure to consider the Rockland County Desalination Project, (5) failure to properly consider impacts to the communities utilizing Hudson River water as a supply source, and (6) improper conclusions regarding the cumulative environmental impacts of continued operation.
- 1. Improper Analysis of Environmental Impacts of Once-Through Cooling System NRC regulations implementing NEPA classify the effects of entrainment, impingement, and heat VKRFNRQWKHSURWHFWLRQDQGSURSDJDWLRQRIILVKDQGVKHOOILVKDV³&DWHJRU\\'HQYLURQPHQWDO
issues which must be assessed in the site-specific SEIS. 10 C.F.R. Part 51, Appendix B to 6XESDUW$7KH'6(,6³PXVWFRQWDLQDQDQDO\\VLVRIWKRVHLVVXHVLGHQWLILHGDV&DWHJRU\\'LQ
$SSHQGL[%WRVXESDUW$&)5G7KH'6(,6LV15&6WDII¶VLQGHSHQGHQWHYDOXDWLRQ
of such Category 2 issues. 10 C.F.R. § 51.70. Despite this mandate, as demonstrated below herein, NRC Staff has failed to adequately analyze the adverse impacts on aquatic resources by LPSLQJHPHQWHQWUDLQPHQWDQGKHDWVKRFNFDXVHGE\\,QGLDQ3RLQW¶VRQFH-through cooling system. As a result, the DSEIS violates NEPA and NRC implementing regulations at 10 C.F.R.
§§ 51.70, 51.71.
5LYHUNHHSHU¶VFRPPHQWVUHJDUGLQJ15&6WDII¶VDQDO\\VLVRI,QGLDQ3RLQW¶VRQFH-through cooling system were prepared with the expert assistance of Drs. Peter Henderson and Richard Seaby of 3LVFHV&RQVHUYDWLRQ/WG³3LVFHV'3LVFHV¶H[SHUWUHSRUWLQVXSSRUWRIWKHVHFRPPHQWV+/-
³&RPPHQWV5HODWLQJWRWKH,QGLDQ3RLQW15&GUDIW(,6RQWKH&RROLQJ6\\VWHP'KHUHLQWKH
³3LVFHV5HSRUW'+/- is attached as Exhibit A.24 In short, Pisces concludes WKDWWKH15&6WDII¶V
DVVHVVPHQWRILPSLQJHPHQWDQGHQWUDLQPHQWíXQGHUWDNHQRQWKHUHSUHVHQWDWLYHLPSRUWDQW
VSHFLHV³5,6'RIILVKVSHFLHVDQGWKHEOXHFUDEíLVEDVHGRQDVFRULQJV\\VWHPWKDWLQLWLDOO\\
appears objective and quantitative. However, detailed examination of the method shows that it 23 For details regarding how the NRC Staff incorrectly excluded terrorism and certain accidents from review, see comments on DSEIS Section 5.0 below.
24,Q3LVFHVSUHSDUHGDUHSRUWHQWLWOHG³(QWUDLQPHQW,PSLQJement and Thermal Impacts at Indian Point Power 6WDWLRQ'³3LVFHV5HSRUW'DFRS\\RIWKH3LVFHV5HSRUWZDVSURYLGHGWR15&6WDIILQ1RYHPEHURI
DVDQDWWDFKPHQWWR5LYHUNHHSHU¶V5HTXHVWIRUD+HDULQJDQG3HWLWLRQWR,QWHUYHQHZLWKUHVSHFWWo the license renewal proceeding for the Indian Point Nuclear Power Station (Attachment 4 to the Declaration of Peter Henderson).
6 makes assumptions about the statistical properties of populations, the impact of cooling water systems on invertebrates prey species, and the relative importance of local and larger-scale changes in population number, which are unjustified and arbitrary.
$OWKRXJKLPSLQJHPHQWDQGHQWUDLQPHQWHIIHFWVDUHFRQVLGHUHGWRJHWKHUE\\15&6WDIIíDQ
DSSURDFKWKDWKDVPHULWíWKHLPSDFWRI,QGLDQ3RLQW¶VFRROLQJV\\VWHPLVDVVHVVHGXVLQJDIODZHG
scoring system that takes into account changes in species abundance (the trend) and strength of connection (connection), and which attempts to measure the relationship between abundance in WKHHQYLURQPHQWDQG,QGLDQ3RLQW¶VGLUHFWILVKPRUWDOLW\\7KLVDSSURDFKGLIIHUVVLJQLILFDQWO\\
from the New York State Department of EnvirRQPHQWDO&RQVHUYDWLRQ³1<6'(&'HYDOXDWLRQ
and overall conclusion regarding these impacts, which focuses on fish mortality rather than fish populations, and has determined that the cooling system results in significant adverse environmental impacts. The N5&6WDIIVKRXOGGHIHUWR1<6'(&¶VHYDOXDWLRQSXUVXDQWWR15&
precedent.
$SDUWLFXODUSUREOHPZLWK15&6WDII¶VDVVHVVPHQWLVWKHGLVWLQFWLRQEHWZHHQµ/DUJH¶ DQGµ6PDOO¶ population impacts, which is hard to support from an examination of the overall population trend data. The use of both river-wide and river segment 4 data (where Indian Point is located), and the use of population decline criteria that include a measure of the deviation from the mean of a normal distribution produce results that do not necessarily reflect the actual population trends, and have the potential to understate the importance of recent changes in abundance.
Another concern is the scoring method used to assess the strength of connection line of evidence to determine whether operation of the Indian Point cooling system has the potential to influence RIS populations near the facility or within the lower Hudson River; this is a poor measure of the impact of the power plant on the species. The strength of connection is a flawed measure because it is based on rank abundance. Furthermore, the lack of importance given to impacts on invertebrates makes low to moderate levels of impact for many species almost inevitable.
15&6WDII¶VFRPSDULVRQRIVSHFLHV¶proportional rank abundance in the power station kill with that living in the river results in potentially misleading conclusions. For example, the fish that contributes the highest proportion of the number of individuals killed by the power plant, and which is also the commonest in the riYHURQO\\KDVDPHGLXPVWUHQJWKRIFRQQHFWLRQ,Q3LVFHV¶
opinion, such a situation where a fish is killed in high numbers and is locally common would suggest a high degree of linkage. A number of the RIS species have a prey score for impingement and entrainment of 1, and thus are unlikely to score highly for the strength of connection. This feature of the scoring protocol is thus central to the final outcome. Another key XQGHUO\\LQJSRLQWWRQRWHDERXW15&6WDII¶VDQDO\\VLVRILPSLQJHPHQWDQGHQWUDLQPHQWLVthe reliance on data collected between 1981 and 1990. These data are old and may not reflect current conditions. In fact, many populations have shown marked changes since that period. This calls into question the reliability of the conclusions when applied to the future.
NRC staff also concludes that thermal impacts associated with the discharge are small to moderate, principally on the grounds that there is no evidence for the scale of the impact. The assertion that, because no appropriate evidence has been collected, there is therefore only a small to moderate impact, is not logical and contrary to NEPA. In addition, NRC staff state that they
7 cannot determine the effects of climate change, particularly in relation to thermal issues. We believe they should have, at the very least, concluded that they needed more data on thermal issues before reaching a conclusion.
- a. 15&6WDII¶V)ODZHG$VVHVVPHQWRI,PSLQJHPHQWDQG(QWUDLQPHQW As noted above, impingement and entrainment effects are considered together by NRC Staff, which is an approach that has merit because the goal is to measure the well-being of all fish VWDJHV+RZHYHUWKHLPSDFWRI,QGLDQ3RLQW¶VFRROLQJV\\VWHPLVDVVHVVHGXVLQJDIDXOW\\VFRULQJ
system which attempts to measure the relationship between abundance in the environment and
,QGLDQ3RLQW¶VGLUHFWILVKPRUWDOLW\\
15&6WDII¶VPHWKRGRORJ\\KDVPDQ\\SUREOHPVZKLFKDUHH[SODLQHGLQGHWDLOLQWKH3LVFHV
Report. With respect to the trend (the so-FDOOHG³$VVHVVPHQWRI3RSXODWLRQ7UHQGVí7KH)LUVW
/LQHRI(YLGHQFH'WKH3LVFHV5HSRUWGHPRQVWUDWHVWKDWWKH15&6WDII¶VGLVWLQFWLRQEHWZHHQ
µ/DUJH¶ DQGµ6PDOO¶ impingement and entrainment impacts is hard to support.25 Indeed, the ZHLJKWRIHYLGHQFH³:2(') scoring system to measure such impacts, which uses both river-wide and river segment 4 data (where Indian Point is located), and uses population decline criteria that include deviation from the mean of a normal distribution, produces results that do not necessarily reflect the actual population trends, and have the potential to understate the importance of recent changes in abundance.26 For instance, examination of the river-wide abundance trends for white fish and weakfish indicates that both species have, since 1990, DSSUHFLDEO\\GHFOLQHGLQDEXQGDQFH<HWZKLOHWKHGHFOLQHLQZKLWHFDWILVKLVFODVVLILHGDVµ/DUJH¶
WKDWLQZHDNILVKLVµ6PDOO¶27 Such differences are more a reflection of the arbitrary nature of the statistical and quantitative approach taken, than a real difference in the state and health of the populations.
Turning to the strength of connection (the so-FDOOHG³$VVHVVPHQWRI6WUHQJWKRI&RQQHFWLRQíThe 6HFRQG/LQHRI(YLGHQFH'WRGHWHUPLQHZKHWKHURSHUDWLRQRIWKH,QGLDQ3RLQWFRROLQJV\\VWHP
has the potential to influence RIS populations near the facility or within the lower Hudson River, the Pisces Report also unveils serious problems.28 NRC StafI¶VGHVFULEHVKRZVWUHQJWKRI
connection is measured, as follows:
Impingement and/or entrainment can also remove and reintroduce RIS prey into the aquatic system in a manner that alters food web dynamics and produces indirect effects that may result in decreased recruitment, changes in predator-prey relationships, changes in population feeding strategies, or movements of populations closer to or farther away from the cooling system intakes or discharges. Staff based the analysis of impingement on the concordance of two ranked proportions. The first proportion was the ratio of the number of YOY and yearling fish of each 25 Pisces Report at 2-5.
26 Id. at 4-5.
27 Id. DWFLWLQJWR'6(,6¶7DEOH-4).
28 Id. at 5-9.
8 species impinged in relation to the sum of all fish impinged. The second proportion was the ratio of each species abundance in the river near IP2 and IP3 relative to the total abundance of all 18 RIS.
A large rank for both proportions would mean that the proportion impinged for the given RIS and the proportion abundance in the river were both large. The ratio of these two ranks would then be close to 1, suggesting that the stationary sampler was sampling proportionately to the abundance in the river (a medium strength of connection).29 7KHILUVWSRLQWWRQRWHLVWKDWWKHDQDO\\VLVLVXQGHUWDNHQE\\FRPSDULQJDVSHFLHV¶proportional rank abundance LQ,QGLDQ3RLQW¶VDFWXDONLOOZLWKWKDWOLYLQJLQWKHULYHU5DWKHURGGO\\DILVKWKDW
contributes the highest proportion to the number of individuals killed by the power plant, and which is also the commonest in the river, only has a medium strength of connection.30,Q3LVFHV¶
opinion, such a situation where a fish is killed in high numbers and is locally common would suggest a high linkage.31 This is a point that needs reconsideration and critical appraisal. The effect is to reduce the assessment of the pRZHUSODQW¶VLPSDFWRQDEXQGDQWFRPPRQO\\-caught fish.
7KHVHFRQGSRLQWWRQRWHLVWKDWDVSHFLHVZKLFKLVUDQNHGOHVVFRPPRQLQ,QGLDQ3RLQW¶VNLOOWKDQ
in the river will be scored small to moderate.32 The key point is that the power plant kill may actually reflect the abundance in the Hudson River, however the rank could decline if other species are killed in unusually high numbers.33 Thus, each species is not being fairly assessed on its own merits.
7RLOOXVWUDWHWKHZHDNQHVVHVLQ15&6WDII¶VDSSURDFK3isces points to Juvenile rainbow smelt, a species that has disappeared from fish surveys since the mid 1990s.34 This species is assessed in WKHWUHQGVWKHSRSXODWLRQOLQHRIHYLGHQFHDVµ/DUJH¶.35 However, NRC Staff considers the impact of Indian Point on this species to be moderate because the strength of connection is DVVHVVHGDVµ0HGLXP¶.36 The strength of connection is only medium because both the impingement and entrainment prey scores are 1. The example demonstrates that an unsubstantiated and unproven assumption by NRC Staff, that invertebrate prey species are not affected by the cooling water system, leads in turn to the conclusion that the rainbow smelt, a species which has effectively disappeared from the data in recent years and has been assessed as potentially highly impacted by entrainment, is only given a moderate impact. The Atlantic tomcod makes another telling example.37 The tomcod population shows long-term decline, thus the population line of evidence is large, however, NRC Staff assigns a low-to medium strength of connection and the final conclusion is an impact small to moderate.
29 DSEIS, Appendix H, at H-29.
30 Pisces Report at 6.
31 Id.
32 Id.
33 Id.
34 Id. at 7-8.
35 Id. DWFLWLQJWR'6(,6¶7DEOH-4).
36 Id.
37 Id. at 8.
9 The Pisces Report observes that before conclusions of this nature can be justified, the assertion that the cooling water system has no impact on invertebrate prey species needs to be demonstrated.38 There is considerable evidence that large numbers of invertebrates are entrained and potentially killed by the cooling water system. There is therefore no reason to believe that invertebrate prey species are not adversely affected. This impact may extend beyond entrainment effects as the heated discharge water may also adversely affect them.
Another problem with NRC Staff impingement and entrainment assessment is the age of the data.39 NRC Staff is relying on data collected between 1981 and 1990. These data are old, and may not reflect current conditions. Further, there are hints that the NRC staff did wonder if the data reflected present conditions. If impinged data were available for 2008 would we find that entrained and impinged fish had changed even more? The risks inherent with the use of old data are not addressed. In addition, it is worth noting that, although the impingement and entrainment data are over 17 years old, the population data that shows the decline in so many of these species is current. The differences in the population of fish between the 1990s and the present are great.
- b. 15&6WDII¶V,PSURSHU$QDO\\VLVRI7KHUPDO,PSDFWV The NRC Staff conclude that thermal impacts associated with the discharge are small to moderate, principally on the grounds that there is no evidence for the scale of the impact:
In the absence of specific studies, and in the absence of effects sufficient to make a determination of a LARGE impacts, the NRC staff concludes that thermal impacts from IP2 and IP# [sic] could thus range from SMALL to MODERATE depending on the extent and magnitude of the thermal plume, the sensitivity of various aquatic species and lifestages likely to encounter the thermal plume, and the probability of an encounter occurring that could result in lethal or sublethal effects.40 The assertion that, because no appropriate evidence has been collected, therefore there is only a small to moderate impact is not logical and contrary to NEPA.41 Linked to thermal impacts must be a consideration of climate change impacts. The following conclusion is reached in the DSEIS:
Thus, the NRC staff has concluded that the cumulative effects of climate change cannot be determined.42 Therefore, NRC Staff is willing to conclude that thermal effects are small to moderate and can therefore be dismissed, but Staff cannot determine the effects of climate change. We believe that 38 Id.
39 Id. at 9.
40 DEIS, Main Report at 4-27.
41 Pisces Report at 11.
42 DSEIS, Appendix H, at H-60.
10 NRC Staff should have, at the very least, acknowledged that they needed more data on thermal issues before reaching a conclusion.43
- c. NRC Staff has Failed to Defer to the New York Department of Environmental Conservation The NRC Staff has failed to defer to, and coordinate with the responsible state agency in charge of protecting aquatic impacts under federal delegation and state law +/- the New York State
'HSDUWPHQWRI(QYLURQPHQWDO&RQVHUYDWLRQ³NYSDEC' í as required by NRC regulations and precedent. 15&UHJXODWLRQVLPSOHPHQWLQJ1(3$UHTXLUHWKDWWKH15&FRRSHUDWH³WRWKHIXOOHVW
H[WHQWSRVVLEOH'ZLWK6WDWHDQGORFDODJHQFLHVWRUHGXFHGXSOLFDWLRQDQGLQFRQVLVWHQFLHV44 Despite this mandate, however, NRC 6WDIIKDVODUJHO\\LJQRUHG1<6'(&¶VHQYLURQPHQWDOUHYLHZ
DQGSHUPLWWLQJRI,QGLDQ3RLQW¶VFRROLQJV\\VWHPXQGHUWKHIHGHUDO&OHDQ:DWHU$FW³&:$'
1<6'(&¶VUHYLHZDQGUH-SHUPLWWLQJRI,QGLDQ3RLQW¶VFRROLQJV\\VWHPKDVEHHQRQJRLQJVLQFH
1992, and is currently in the final adjudicatory phase. )ROORZLQJWKH15&¶VLQVWUXFWLRQVLQWKH
Seabrook case, the 15&6WDIIPXVWGHIHUWR1<6'(&¶VDVVHVVPHQWRIHQWUDLQPHQWDQG
impingement, and its permitting determinations.45 Indian Point is operating a once-through cooling system under an administratively extended State 3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\\VWHP³63'(6'SHUPLWLVVXHGE\\WKH1<6'(&IRUWKH
period 1987-1992.46,Q-XO\\WKH$WRPLF6DIHW\\DQG/LFHQVLQJ%RDUG³$6/%'UXOHG
that Entergy can rely on this permit for purposes of satisfying 10 C.F.R. § 51.53(c)(3)(ii)(B);
thus, it need not assess the impacts of impingement, entrainment, and heat shock in the Environmental Report.47,QGLDQ3RLQW¶V63'(6SHUPLWKDVEHHQDGPLQLVWUDWLYHO\\
continued, however, pending issuance of a final SPDES permit currently subject to adjudication by the NYSDEC.
Beginning in 1992, the NYSDEC has required a specific environmental impact statement
(³EIS'XQGHUWKH6WDWH¶V(QYLURQPHQWDO4XDOLW\\5HYLHZ$FW48 ³6(45$' to consider Indian 3RLQW¶VHQWUDLQPHQWLPSLQJHPHQWDQGWKHUPDOLPSDFWVDVZHOODVPLWLJDWLRQDOWHUQDWLYHV As a result, the prior owners of Indian Point and other Hudson River power plant generators prepared the 1999 Draft Environmental Impact Statement for permit renewal.49 The final environmental LPSDFWVWDWHPHQW³SPDES )(,6'ZDVSUHSDUHGDQGUHOHDVHGE\\WKH1<6'(&LQDIWHU
Hudson River advocates filed an action against the NYSDEC in New York State Supreme Court.50 43 Pisces Report at 11.
44 10 C.F.R. § 51.70 (c); 40 C.F.R. § 1506.2 (b) and (c).
45 See Public Service Co. of N.H. (Seabrook Station, Units 1 and 2), Seabrook, CLI-78-1, 7 NRC at 26 (1978);
Entergy Nuclear Vt. Yankee (Vermont Yankee Nuclear Power Station), CLI-07-16, 65 NRC 371, 389 (2007).
46 1<6'(&6WDWH3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\\VWHP³63'(6''LVFKDUJH3HUPLW1<-000-4472, Indian Point Generating Stations (NYSDEC, 1987 SPDES Permit.
47 July 31, 2008 ASLB Order, supra.
48 New York State Environmental Conservation Law, Article 17.
49 1999 Draft Environmental Impact Statement Concerning the Applications to Renew SPDES Permits for the Roseton 1 and 2, Bowline 1 and 2 and Indian Point 2 and 3 Electric Generating Stations (1999 DEIS).
50 See Matter of Brodsky v. Crotty, Sup. Ct., Albany County, Keegan, J., Index No. 7136-02.
11 In the SPDES FEIS, the NYSDEC dHWHUPLQHGWKDW,QGLDQ3RLQW¶VGUDPDWLFLQWDNHDQGXVHRI
Hudson River water has significant adverse environmental impacts and must be mitigated.51 Consequently, NYSDEC prepared a draft SPDES permit requiring closed cycle cooling at Indian Point.52 In 2008, the NYSDEC advanced the SPDES proceeding to the evidentiary phase, at the time when it resolved various appeals by the parties to the proceeding. Notably, NYSDEC GHWHUPLQHGWKDWWKHUHLVQRQHHGWRDGMXGLFDWHZKHWKHU,QGLDQ3RLQW¶VFRROLQJV\\VWHPUHVXOWVin adverse environmental impacts because this issue has already been established as a matter of law and fact, and required that a supplemental EIS be prepared during the adjudication.53 The DSEIS not only contradicts the key findings and conclusions on entrainment and impingement at Indian Point contained in the SPDES FEIS but completely ignores the 2008 NYSDEC Ruling.54 Tellingly, the 2008 NYSDEC Ruling relied on the United Stated Court of Appeals for the Second Circuit, in its decisions referred to as Riverkeeper I (2004) and Riverkeeper II (2007).55 $VWKH1<6'(&5XOLQJVWDWHGWKH6HFRQG&LUFXLW³VSHFLILFDOO\\
rejected the view that the EPA should only have sought to regulate impingement and entrainment where they have deleterious effects on the overall fish and shellfish populations in the ecosystem DQGHPSKDVL]HGWKDWWKH(3$¶VIRFXVRQWKHQXPEHURIRUJDQLVPVNLOOHGRULQMXUHGE\\FRROLQJ
water intake structures is eminently reasonable.56 7KXVWKH15&6WDII¶VPDUNHGUHOLDQFHRQ
population trends is LQFRQVLVWHQWZLWK1<6'(&¶VDQG(3$¶VIRFXVRQWKHQXPEHURIRUJDQLVPV
killed or injured by the cooling system.
The DSEIS also includes, in its alternatives analysis (in Section 8.1.2), a Restoration Alternative that is unlawful based on the Second Circuit rulings in its Riverkeeper I and Riverkeeper II decisions. Pursuant to Riverkeeper I and Riverkeeper II ³UHVWRUDWLRQ'DOWHUQDWLYHVERWKDW
existing and new facilities are contrary to the CWA. Therefore, Section 8.1.2 should be stricken in its entirety. 7KHVHIDLOXUHVDQGLQFRQVLVWHQFLHVUXQVFRQWUDU\\WR15&¶VRZQSUHFHGHQWVHWIRUWK
in Seabrook, CLI-78-1, 7 NRC at 26, and Entergy Nuclear Vt. Yankee, 65 NRC at 387, indicating that NRC Staff must defer to the responsible permitting authority, here the NYSDEC.
1<6'(&¶V5XOLQJDOVRUHTXLUHVWKDWDVXSSOHPHQWDO(,6EHSUHSDUHGWRH[DPLQHWKH
environmental impacts that were not already addressed in the SPDES FEIS for closed cycle cooling, the proposed interim measures, and any alternative technologies that Entergy may propose in order to minimize adverse environmental impact at Indian Point.57 There is no 51 NYSDEC, 2003, Final Environmental Impact Statement Concerning the Applications to Renew SPDES Permits for the Roseton 1 and 2, Bowline 1 and 2 and Indian Point 2 and 3 Electric Generating Stations (hereinafter NYSDEC, 2003 FEIS).
52 NYSDEC, 2003, Draft SPDES Permit for Entergy Nuclear Indian Point Units 2 & 3 (NYSDEC, 2003 Draft SPDES Permit).
53 See Matter of Entergy Nuclear Indian Point 2 and Entergy Nuclear Indian Point 3, Interim Decision of the Assistant Commissioner (August 13, 2008), at http://www.dec.ny.gov/hearings/45956.html ³1<6'(&
5XOLQJ'DW-18 & 36-41.
54 NYSDEC, 2003 FEIS, at 58.
55 NYSDEC, 2008 Ruling, at 17 (citing to Riverkeeper I, [358 F.3d 174] at 196; Riverkeeper II, [475 F.3d 83] at 125.
56 Id. fn 12 (FLWLQJWR³5LYHUNHHSHU,,DWTXRWLQJ5LYHUNHHSHU,DW'
57 Id. at 39.
12 indication whatsoever that NRC Staff will defer to, and/or coordinate ZLWKWKH1<6'(&¶V
supplemental EIS, as required by NRC regulations and precedent.58
)LQDOO\\15&6WDIIKDVQRWUHFRJQL]HG1<6'(&¶VVWDWHPHQWVDQGFRQFHUQVZLWKUHVSHFWVWR
,QGLDQ3RLQW¶VWKHUPDOLPSDFWV7KH'6(,6¶ODFNRIDWKHUPDODQDO\\VLVGLVFXVVHGLQWKHSUHYLRXV
VHFWLRQLVSODLQO\\DWRGGVZLWKWKHDYDLODEOHGDWDRQ,QGLDQ3RLQW¶s thermal plume, which shows that the facility does not comply with New York water quality standards for thermal discharges.
As noted in the scoping comments filed by the State of New York í later incorporated in New
<RUN6WDWH¶V3HWLWLRQWR,QWHUYHQHZLWKUHVSHFWWRDTXDWLFLPSDFWV
The available data -- generated from the applicant and the other Hudson River power plant generators as part of the HRSA --
regarding the thermal discharge at Indian Point demonstrates that state water quality criteria are not being met.59 In addition, the 2007 Pisces Report on Entrainment, Impingement and Thermal Impacts, submitted to NRC Staff in November of 2007, clearly shows that temperature increases in the
+XGVRQ5LYHUFDXVHGE\\,QGLDQ3RLQW¶VRSHUDWLRQKDYHKDGVLJQLILFDQWHIIHFWVRQDTXDWLFOLIH
- 2. Improper Analysis of Impacts to Endangered or Threatened Species
- a. Listed Species +/- Shortnose Sturgeon The license renewal of the Indian Point nuclear facilit\\LVDIHGHUDODFWLRQZKLFK³PD\\DIIHFWD
OLVWHGVSHFLHVRUFULWLFDOKDELWDW'60 In the DSEIS, the NRC Staff admits that the license renewal ZLOOUHTXLUHFRQVXOWDWLRQXQGHU6HFWLRQRIWKH(QGDQJHUHG6SHFLHV$FWRI³(6$'61 Because the operation of the Indian Point nuclear facility has resulted in the taking of the endangered shortnose sturgeon without a permit,62 and the continued operation will continue to affect the fish if the license is renewed and Indian Point operates without a closed-cycle cooling system, such renewal is a federal action which may affect a listed species.
The shortnose sturgeon was listed under the Endangered Species Preservation Act on March 11, 1967 and remained on the Endangered Species List when the ESA became law in 1973. Females live significantly longer than males; while females have reportedly reached 67 years, males usually will not live past 30.63 This being the case, the sexes are nearly equal in number when young, but when the shortnose reaches 90 cm, females outnumber males by approximately four to one.64 Also, because they are long living fish, in the mid-Atlantic region, the males will reach 58 10 C.F.R. § 51.70 (c); 40 C.F.R. § 1506.2 (b) and (c); Seabrook, CLI-78-1, 7 NRC at 26 (1978); Entergy Nuclear Vt. Yankee, CLI-07-16, 65 NRC 371, 389 (2007).
59 NYS, Scoping Comments, at 8 (emphasis in original text).
60 50 C.F.R. § 402.14(a) (2008).
61 See 16 U.S.C. § 1536 (2006); See also DSEIS, Main Report § 4.6, at 4-49.
62 See id. § 4.6, at 4-51 (reporting that 714 endangered shortnose sturgeon were impinged at Indian Point from 1975 to 1990).
63 NOAA Fisheries Office of Protected Resources, Shortnose Sturgeon, http://www.nmfs.noaa.gov/pr/species/fish/shortnosesturgeon.htm (last visited March 13, 2009).
64 Id.
13 reproductive maturity between four and seven years and the females at approximately eleven years.65 Even still, while males may spawn every year, females will often go three years between spawning.66 Because of this slow maturation process, any impacts on the shortnose sturgeon will have noticeable effects. It is, thus, critical that impacts on the shortnose species are kept to a minimum.
Riverkeeper recognizes that Section 7 consultation is based on astute principles designed to further the basic purpose of the ESA, which is to conserve endangered and threatened species and the ecosystems on which they depend.67 Of particular relevance here are section 7
³SKLORVRSKLHV'ZKLFKHQFRXUDJHUHOLDQFHRQELRORJ\\ILUVWHPSKDVL]HWKHHFRV\\VWHPDSSURDFKWR
VSHFLHVFRQVHUYDWLRQDQGVWUHVVWKHLPSRUWDQFHRIWKH³EHVWDYDLODEOHVFLHQWLILFDQGFRPPHUFLDO
GDWD'68 These are commendable standards of practice, and NRC Staff should adhere to them during the relicensing process.
Although the NRC Staff admits that the continued operation of the Indian Point nuclear facility will impinge the shortnose sturgeon, the data relied upon in the DSEI6DQGWKH15&6WDII¶V
Biological AsseVVPHQW³%$'DSSHQGHGWKHUHWRfor assessing those impacts is incomplete at best.69 The data provided by Entergy accounts only for shortnose sturgeon impinged at Indian Point Units 2 and 3 from 1975 through 1990.70 Furthermore, there are several years during this period that have no reported data at all71 and the data can be questioned due to the fact that over 90% of the recorded impingements occurred in only two years.72 In a letter from Mary A.
Colligan (National MarinH)LVKHULHV6HUYLFH³10)6'WR'DYLG-:URQD15&10)6
HFKRHG5LYHUNHHSHU¶VFRQFHUQVDERXWWKHODFNRIUHSRUWLQJGDWDDQGWKHLQFRQVLVWHQFLHVLQWKRVH
reports.73,Q&ROOLJDQ¶VOHWWHU10)6LQVWUXFWHGWKH15&WKDWWKHUHZDVLQVXIILFLHQWLQIRUPDWLRQ
provided in the DSEIS and BA to start formal consultation.74 Specifically, NMFS was concerned with the gaps in the reported impingements at the Indian Point nuclear facility.75 More importantly, the impingement data provided in the DSEIS was from a period when the Indian Point nuclear facility did not use Ristroph screens to minimize fish impingement, which were installed in 1991.76 65 Id.
66 Id.
6716 U.S.C. § 1531(b).
68 U.S. Fish and Wildlife Service and National Marine Fisheries Service, ESA § 7 Consultation Handbook, § 1.1, at 1-2, available at http://www.fws.gov/endangered/pdfs/Sec7/handbook/CH1-3.PDF.
69 See generally DSEIS § 4.6; see also id. Appendix E, Biological Assessment of the Potential Effects on Federally Listed Endangered or Threatened Species from the Proposed Renewal of Indian Point Nuclear Generating Plant, 8QLW1RVDQG³%$'DW(-88 +/- E-100.
70 Id.
71 Id. (no reported impingements in 1980-1983, 1985, 1986, 1988-1990).
72 Id. (out of 317 total impinged shortnose sturgeon, 176 were recorded in 1984 and 116 were recorded in 1987).
73 Colligan (NMFS) to Wrona (NRC), RE: Biological Assessment for License Renewal of the Indian Point Nuclear Generating Unit Nos. 2 and 3 (Feb. 24, 2009), attached to RiverkeepeU¶V&RPPHQWVDV([KLELWB.
74 Id.
75 Id.
76 DSEIS, Appendix E, BA § 4.3.2, at E-96.
14 Moreover, the impingement data cited in the BA, which the NRC Staff included in order to comply with Section 7 of the ESA,77 is self-conflicting and does not create a complete, accurate or current illustration of the status of impinged shortnose sturgeon at the Indian Point nuclear facility. Included in the BA are two impingement reports, one each from NMFS and Entergy.78 The NRC StDIIFRQFOXGHGWKDWEHFDXVH(QWHUJ\\¶VUHSRUWVRILPSLQJHGVWXUJHRQZHUHODUJHUWKDQ
those of NMFS, they would disregard the NMFS reports.79 Although it is important for the BA WREHDFRQVHUYDWLYHDQDO\\VLVRIWKHLPSDFWVWRWKHVWXUJHRQWKH15&6WDII¶VRQOy reasoning disregarding the NMFS reports was that they were significantly lower than the data supplied by Entergy.80 Entergy and the NRC Staff state that the implementation of the Ristroph screens, installed in 1991, may have resulted in reduced the impacts to shortnose sturgeon.81 Despite these assurances from Entergy and the NRC Staff that these screens are mitigating the impingement of shortnose sturgeon, there is no data to support this conclusion. Because the NRC Staff fails to rely on any impingement monitoring after the screens were installed,82 it cannot be assumed or concluded that these screens have had any mitigating effects. In order to properly assess the impacts of the Ristroph screens, the NRC Staff must rely on actual impingement data. The NRC Staff even admits that they cannot assess the extent to which the installation of the screens might reduce impacts to the sturgeon.83 7KHODFNRIFRPSOHWHDQGUHFHQWLPSLQJHPHQWGDWDVLJQLILFDQWO\\OLPLWVWKH15&6WDII¶VDELOLW\\WR
form a conclusion about the actual affects on the shortnose sturgeon. Indeed, the NRC Staff readily admits that it is unable to come to a definitive conclusion based on this incomplete data.
Based on its review of the impingement data supplied by Entergy, the NRC Staff finds in the
'6(,6WKDWGXHWR³WKHXQFHUWDLQW\\RIWKHFXUUHQWLPSLQJHPHQWORVVHVRIVWXUJHRQDQG
EHFDXVHLQVXIILFLHQWGDWDH[LVWWRXVHWKH>ZHLJKWRIHYLGHQFH@DSSURDFK'WKHHIIHFWVRQ
endangered shortnose sturgeon due to license renewal could range IURP³60$//WR/$5*('84 In fact, the NRC Staff explicitly admits that the supplied data was insufficient and current monitoring is needed to form a conclusion about the effects of impingement on the shortnose sturgeon.85 However, instead of gathering data to support a rational and reasonable assessment of the affects to the shortnose sturgeon, the NRC Staff was content to leave their analysis as incomplete and uncertain. NMFS has also shown concern with this lack of recording data.86 Riverkeeper agrees with NMFS that unless the NRC Staff gathers impingement data or studies 77 50 C.F.R. § 402.14 (2008).
78 DSEIS, Appendix E, BA § 4.3.2, at E-96, E-97.
79 Id. at E-97.
80 Id.
81 See id. at E-98.
82 See DSEIS, Main Report Table 4-11 Impingement Data for Shortnose and Atlantic Sturgeon at IP2 and IP3, 1975-1990 (data from Entergy 2007b), at 4-52.
83 DSEIS, Appendix E, at E-99.
84 DSEIS, Main Report § 4.6.1, at 4-52.
85 DSEIS, Appendix E, BA § 4.3.2, at E--98 -- E-99 (concluding that the license renewal would likely affect the species, but without current monitoring data, it is impossible to gauge the extent of the impact).
86 Colligan (NMFS) to Wrona (NRC), RE: Biological Assessment for License Renewal of the Indian Point Nuclear Generating Unit Nos. 2 and 3 (Feb. 24, 2009).
15 reflecting accurate estimates of impinged shortnose sturgeon, the impact assessment in the DSEIS is inadequate.87 7KH15&6WDII¶VLQFRQFOXVLYHGHWHUPLQDWLRQDOVRUHVWVLQSDUWRQWKHlack of data regarding entrainment and heat shock. While the NRC Staff says that there is likely no entrainment of shortnose sturgeon occurring, this determination is based on a review of data dating back to the 1980s.88 The NRC Staff admits that entrainment cannot be ruled out and that there is currently no monitoring program at Indian Point.89 Similarly, in regards to potential heat shock, the NRC 6WDIIDGPLWVWKDWLQFUHDVHGWHPSHUDWXUHVFDQKDYHD³VLJQLILFDQWHIIHFWRQWKHVKRUWQRVH
VWXUJHRQ'KRZHYHU could not determine the extent to which the population would be affected because additional studies are required.90 7KH15&6WDII¶VXOWLPDWH³FRQFOXVLRQ'WKDWWKHUDQJHRILPSDFWVWRVKRUWQRVHVWXUJHRQLV
³60$//WR/$5*('91 lacks any definitiveness and is essentially meaningless, improperly flouting the requirements of NEPA.92 While the lack of monitoring data and studies inhibits the ability to form specific conclusions, this does not excuse the NRC Staff from their obligation to accurately assess the impacts on endangered species affected by Indian Point. It is clear that the NRC Staff did not effectively or sufficiently analyze the impacts that license renewal would have on the shortnose sturgeon, and the NRC Staff cannot justify its inadequate conclusion simply by pointing to the unavailability of relevant data.
3LVFHV¶H[SHUWUHSRUWFRUURERUDWHVWKHGHILFLHQF\\RIWKH15&6WDII¶VUHYLHZ93 Pisces points out that the data used by the NRC Staff to assess the number of shortnose and Atlantic sturgeon impinged at Indian Point is old, and that the lack of monitoring of impingement means that they do not know if current impingement rates are similar to those between the 1970s and 1990s. In addition, Pisces points out that the NRC Staff admit that they cannot assess the thermal impact on these species. The Pisces expert report concludes that, given these large uncertainties, the NRC Staff came to no conclusion on the impact of Indian Point on sturgeon, giving a range of small to large for the future impacts.94 7KH15&6WDII¶VDQDO\\VLVRIWKHLPSDFWVWRVKRUWQRVHVWXUJHRQLVDOVRZDQWLQJVLQFHLWGRHVQRW
consider the impacts caused by IP1. If the license for Indian Point Units 2 and 3 is renewed, Entergy will use some of the systems from Indian Point Unit 1 in the continued operations of the facility.95 6SHFLILFDOO\\WKHLQWDNHVWUXFWXUHIRU8QLWZLOOEHXVHGWR³>S@URYLGHVXSSRUWVKHOWHU
DQGSURWHFWLRQIRUHTXLSPHQWFUHGLWHGIRUUHJXODWLRQVDVVRFLDWHGZLWKILUHSURWHFWLRQ'96 The 87Id.
88 DSEIS, Main Report § 4.6.1. at 4-51; DSEIS, Appendix E at E-96.
89 DSEIS, Appendix E at E-96.
90 DSEIS, Main Report § 4.6.1. at 4-51; DSEIS, Appendix E at E-99-100.
91 DSEIS, Main Report § 4.6.1, at 4-52.
92 See 42 U.S.C. § 4332; Marsh v. Oregon Natural Resources Counsel, 490 U.S. 360, 374 (1989).
93 Pisces Report at 10.
94 See Pisces Report at 10.
95 See generally, NRC: Indian Point Nuclear Generating Unit Nos. 2 and 3 +/- License Renewal Application (Apr. 30, 2007), available at http://www.nrc.gov/reactors/operating/licensing/renewal/applications/indian-point.html#application ³(QWHUJ\\/5$'
96 Entergy LRA § 2.4.2, at 2.4-5.
16 License Renewal Application states that travelling screens have been installed at the Unit 1 intake structure97, but neither the DSEIS nor the application analyze the impingement impacts on the shortnose sturgeon. Moreover, neither of these documents cites to any reports of past shortnose impingements at the Unit 1 intake structure. By failing to analyze the effects of the continued use of the Unit 1 Intake Structure, the NRC has ignored another point of impact on the shortnose sturgeon. If Entergy is going to use the intake structure from Unit 1 in the continued operation of Indian Point, the NRC staff must take into account past and future impingement from Unit 1 in order to accurately analyze the total impacts on the species.
The NRC Staff also fails to recognize that the Indian Point nuclear facility will require an incidental take permit in order to comply with the ESA.98 The NRC admits that future operation of the facility will likely impinge shortnose sturgeon, and this future impingement is considered D³WDNH'XQGHUWKH(6$99 Any reliance on the fact that shortnose sturgeon appear to be rebounding in the River, is unfounded, since the fact remains that impingement is still occurring.100 Every impingement of shortnose sturgeon that occurs without an incidental take permit is a violation of the ESA. Because the taking of shortnose sturgeon would be incidental to the operation of the plant, the ESA requires that the facility obtains a permit to regulate and PLQLPL]HWKHLPSDFWRQWKHVSHFLHV5LYHUNHHSHU¶VFRQFHUQVDERXWIXWXUHtakings were echoed in a letter from Mary Colligan, Assistant Regional Administrator for Protected Resources for NMFS Northeast Region, to James Thomas at Enercon Services, a company assisting Entergy in its preparation of its Environmental Report (ER).101 In this letter, Colligan stated that NMFS is aware that Indian Point has impinged shortnose sturgeon and that such impingement is a take under the ESA.102 Colligan also wrote that since Indian Point has operated without a permit, such takes were violations of the ESA.103 The DSEIS failed to note that any future impingements of shortnose sturgeon at the Indian Point nuclear facility without a permit will also be violations of the ESA. In the absence of recent data showing that impingement is not occurring, the NRC Staff and NMFS must assume that the shortnose sturgeon are continuing to be impacted by impingement, and comply with the law accordingly.
Moreover, the DSEIS is inadequate due to a complete lack of assessment of the potential effects on federally listed species caused by groundwater contamination at Indian Point. As discussed in more detail below, the IP1 and IP2 spent fuel pools are have leaked extensive amounts of highly toxic radionuclides, including strontium-90 and tritium, into the groundwater around the plant.
The NRC Staff at no point in the DSEIS assesses the effects of this toxic contamination on the
+XGVRQ5LYHU¶VIHGHUDOO\\OLVWHGVKRUWQRVHVWXUJHRQ5LYHUNHHSHULVKLJKO\\FRQFHUQHGDERXWWKH
97Id. § 2.3.3.19, at 2.3-157.
98 See 15 U.S.C. § 1539(a)(1)(B) (2006); see also 50 C.F.R. § 402.14(i) (2008) (NMFS may also include an incidental take statement in a biological opinion after formal consultation, but there is no reference to this option either).
99 See 15 U.S.C. § 1532(19) (2006).
100 See DSEIS, Main Report § 2.2.5.5, at 2-77 to 2-78; DSEIS, Appendix E, at E-95. In fact, the NRC Staff admits that increased population of shortnose sturgeon will likely result in increased impingement. Id. at E-97.
101 See (QWHUJ\\,QF/LFHQVH5HQHZDO$SSOLFDWLRQ$SSHQGL[($SSOLFDQW¶V(QYLURQPHQWDO5HSRUW2SHUDWLQJ
License Renewal Stage, Indian Point Energy Center (ER), Attachment A, Colligan (NMFS) to Thomas (Enercon)
(Mar. 19, 2007), available at http://www.nrc.gov/reactors/operating/licensing/renewal/applications/indian-point/ipec-er-attachment-a2.pdf.
102 See id.
103 See id.
17 lack of analysis here, particularly because of the known dangers of exposure to radioactive substances such as strontium-90 and tritium. Strontium-90 imitates calcium by concentrating in fish bones and shells of clams and blue crab. Clams are a major part of the diet of sturgeon found in the Hudson River. Riverkeeper is therefore concerned that Hudson sturgeon are being exposed to elevated levels of this dangerous substance. Without reference to additional studies done to scrutinize the effects of such contamination on listed species and humans, the 15&6WDII¶V
DSEIS is woefully incomplete.
- b. Candidate Species +/- Atlantic Sturgeon The Atlantic sturgeon is currently a candidate species under the ESA, and is thus being considered for listing as threatened or endangered. As such, it does not currently receive any substantive federal protections. However, if the decision is made to list the Atlantic sturgeon the NRC may have to reinitiate Section 7 consultation with NMFS to assess the effects of relicensing on this species. The chances of re-initiation are particular strong because the listing decision will likely be released well before a final decision is made regarding the relicensing of Indian Point.
5LYHUNHHSHULVFRQFHUQHGZLWKWKH15&6WDII¶VDVVHVVPHQWRILPSDFWVRQWKH$WODQWLFVWXUJHRQ
Similar to the data on shortnose sturgeon impingement, entrainment, and heat shock, the DSEIS relies on insufficient records to assess the impacts on the Atlantic sturgeon. Although the data for the impingement of Atlantic sturgeon is more complete than that for the shortnose sturgeon, there is no record of impinged fish after 1987.104 The NRC Staff does not give a reason for why the monitoring of impingement was halted over 20 years ago and also fails to make its current impact assessments on best estimates or currently available data. Riverkeeper is also concerned that the reporting of impinged Atlantic sturgeon reflects the impingement of over 4,000 fish from 1976 to 1987.105 If the Atlantic sturgeon is indeed listed under the Endangered Species Act, the NRC will be required to engage in the ESA Section 7 consultation process, in order to address WKH³WDNLQJ'RI$WODQWLFVWXUJHRQE\\,QGLDQ3RLQW¶VRSHUDWLRQDQGWRFRQVLGHUPLWLJDWLRQ
measures necessary to minimize impingement and entrainment losses. The DSEIS lacks the current data that is necessary to assess potential impacts to the species and recommend mitigation strategies that could lessen the harm of those impacts. As a result, the NRC Staff has failed to provide sufficient factual support for its conclusion regarding the impacts of relicensing Indian Point to the Atlantic sturgeon.
- 3. Improper Analysis of Groundwater Contamination Caused by Spent Fuel Pool Leaking Sections 4.3, 4.5, and 4.7 RIWKH'6(,6FRQWDLQWKH15&6WDII¶Vevaluation of the environmental impacts of spent fuel pool leaking at Indian Point.106 The NRC Staff discusses the status of the leaking and its investigation findings earlier in the DSEIS, in section 2.2.7, but reserves 104 DSEIS, Main Report § 4.6.1, at 4-52.
105 Id.
106 Id. §§ 4.3, 4.5, 4.7.
18 judgment on the environmental impacts of the leaking until section 4.0.107 These brief portions RIWKH'6(,6WDNHQWRJHWKHUWRWDOLQJDSDOWU\\SDJHVDWEHVWFRQVWLWXWHVWKH15&6WDII¶VHQWLUH
evaluation of the extensive spent fuel pool leaking that has been ongoing at the Indian Point facility for years. A review oIWKH15&6WDII¶VFROOHFWLYHDVVHVVPHQWLQWKH'6(,S of the spent fuel pool leaks reveals an utter failure WRDGGUHVVDQ\\RIWKHFRQFHUQVUDLVHGLQ5LYHUNHHSHU¶V
Scoping Comments or by the contention filed by Riverkeeper on this issue.
5LYHUNHHSHU¶V6FRSLng Comments urged the NRC Staff to comprehensively assess the environmental impacts of the IP1 and IP2 spent fuel pool leaks.108 Riverkeeper explained the JURVVLQDGHTXDF\\RI(QWHUJ\\¶V(QYLURQPHQWDO5HSRUW³(5'DQGWKXVXUJHGWKH15&6WDIIQRW
to rely upon it to prepare its draft supplemental environmental impact statement.109 Riverkeeper highlighted the importance of fully evaluating the ever-accumulating contamination caused by the leaks on the Hudson River ecosystem, including on fish, shellfish, and river sediments.110 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVDOVRVXJJHVWHGDVVHVVLQJWKHIHDVLELOLW\\RIUHTXLULQJ(QWHUJ\\WR
move more fuel to dry casks as a reasonable mitigation measure.111 5LYHUNHHSHU¶VVXEVHTXHQWO\\
filed contention on spent fuel pool leaks further HODERUDWHGRQWKHGHILFLHQFLHVRI(QWHUJ\\¶V
analysis and the need for a thorough review of the environmental impacts resulting from the leaks.112 Yet, despite the reasoned and entirely valid UHTXHVWVDUWLFXODWHGLQ5LYHUNHHSHU¶V6FRSLQJ
Comments, the NRC SWDIIHVVHQWLDOO\\JUDIWHG(QWHUJ\\¶VDVVHVVPHQWRIWKHOHDNVLQWRWKH'6(,6
as their own.113 This deficient analysis completely fails to comply with NEPA.
Firstly, the NRC Staff ignores the fact that Entergy has failed to definitively demonstrate that the leaking has even ceased. In fact, there is no discussion at all of whether the leaking is still active, DQGLQVWHDGWKH15&6WDIIDSSDUHQWO\\DFFHSWV(QWHUJ\\¶VFXUUHQWPRQLWRULQJDQGRWKHU³UHPHGLDO'
activities, such as the draining of the IP1 pool, as enough.114 Despite these actions, there is still no indication that Entergy will ever be able to definitively determine whether the IP2 pool continues to leak. Even though IP1 is no longer a possible source of leakage, IP2 still is. While Entergy identified and addressed some sources of the leakage from IP2, no one disputes that Entergy has been unable to inspect 40% of the IP2 pool liner due to the high density of the spent fuel storage racks and the minimal clearance between the bottom of the racks and the floor of the pool.115 Indeed, Entergy has explicitly acknowledged that active leaks cannot be ruled out.116 Moreover, as Riverkeeper has pointed out to the NRC Staff several times already, sample results 107 Id. § 2.2.7, at 2-107 to 2-108. The NRC Staff references its findings relating to the significance of the spent fuel pool leaking sporadically throughout the DSEIS, but these four sections seem to rHSUHVHQWWKH15&6WDII¶VSULPDU\\
analysis of this issue.
108 Riverkeeper Scoping Comments at 12-15.
109 Id.
110 Id.
111 Id.
112 Riverkeeper Petition for Hearing at 74-86.
113 DSEIS, Main report §§ 2.2.7, 4.3, 4.5, 4.7.
114 Id. § 2.2.7, at 2-107 to 2-108, § 4.3, § 4.5, § 4.7.
115 See Riverkeeper Scoping Comments at 13; Riverkeeper Petition for Hearing at 74, 80-81.
116 See Groundwater Investigation Executive Summary (Indian Point Energy Center, Buchanan, N.Y., Jan. 2008), at 3, available at http://jic.semo.state.ny.us/Resources/ExecutiveSummary%20GW%20final.pdf.
19 clearly demonstrate that the contamination is the resXOWRIUHFHQWOHDNLQJDQGQRW³KLVWRULFDO'
releases.117 Yet, Entergy has not provided any information on the feasibility of examining the remainder of the pool liner, or explained any other steps it will take to find any and all sources of leaks from IP2. In fact, Entergy has made no commitment whatsoever for augmented inspection of the spent fuel pool liners during the period of extended operation, and instead is relying on the one-time inspection of the accessible portion of the liner and groundwater testing.118 The NRC Staff has expressed concern in its recent Safety Evaluation Report about the lack of a system at IP2 to monitor, detect and quantify potential leakage through the spent fuel pool liner, and stated that it is uncertain that the leakage problems have been permanently corrected.119 Yet, despite these concerns, the DSEIS is devoid of discussion on the questionable status of the leaking.120 Riverkeeper does not understand how the NRC Staff can accurately assess the environmental impacts of ongoing leaking during the 20-year extended licensing term without addressing the root of the problem.
6HFRQGO\\WKH15&6WDII¶VDQDO\\VLVLVGHILFLHQWVLQFHLWUHOLHVVROHO\\RQWKHILQGLQJWKDW
radiological doses to humans from consumption of aquatic foods, the only current exposure pathway, is within regulatory limits.121 The NRC Staff maintains that the spent fuel pool leaks,
³ZKLOHQHZLQIRUPDWLRQDUHZLWKLQWKH15&¶VUDGLDWLRQVDIHW\\VWDQGDUGVDQGDUHQRW
considered to have a significant impact on plant workers, the public, or the environment.122 However, the NRC Staff is continuing to improperly hide behind section 4.6 of GEIS, which analyzes radiological impacts based only on dosage limits.123 However, the GEIS only addresses radiological impacts to man from routine operations and releases, and does not contemplate unplanned, unmonitored releases from leaking plant systems into the environment. As such, PHUHFDOFXODWLRQRIGRVHOLPLWVLVQRWVXIILFLHQWIRUDVVHVVLQJWKH³VLJQLILFDQFH'RIWKHLPSDFWVRI
the spent fuel pool leaks.124 Rather, NEPA requires a broader evaluation of environmental impacts beyond mere public health concerns.125 7KH&(4UHJXODWLRQGHILQLQJ³VLJQLILFDQWO\\'UHTXLUHVFRQVLGHUDWLRQRIWKH
context of the action and intensity or severity of the impacts.126 Accordingly, in order to DFFXUDWHO\\HYDOXDWHWKHVLJQLILFDQFHRIWKHVSHQWIXHOSRROOHDNLQJWKH15&6WDII¶VPXVWIXOO\\
assess the impacts to the natural environment of the Hudson River. However, by relying on 117 See Riverkeeper Scoping Comments at 13-14; Riverkeeper Petition for Hearing at 74, 81-82.
118 U.S. Nuclear Regulatory Commission, Safety Evaluation Report With Open Items Related to the License Renewal of Indian Point Nuclear Generating Unit Nos. 2 and 3, Docket Nos. 50-247 and 50-286 (January 2009), at 3-³6(5'
119 SER at 3-123.
120 DSEIS, Main Report § 2.2.7, at 2-107 to 2-108, § 4.3, § 4.5, § 4.7.
121 DSEIS, Main Report § 2.2.7, at 2-107 to 2-108; § 4.3, § 4.5, § 4.7. In addition to incorrectly relying on dose OLPLWVDVDVROHPHDVXUHPHQWRIWKHLPSDFWVIURPWKHOHDNVWKH15&6WDII¶VDVVHVVPHQWRIGRVHOLPLWVLWVHOILV
fundamentally flawed since it does not take into consideration a proposed desalination plant right that is likely to result in a direct drinking water pathway. See infra for in-depth discussion.
122 DSEIS, Main Report §§ 4.3, 4.5, 4.7.
123 Id. §§ 2.2.7, 4.3, 4.5, 4.7.
124 10 C.F.R. § 51.53(c)(3)(iv); See 40 C.F.R. § 1508.27.
125 See Marsh v. Oregon Natural Resources Counsel, 490 U.S. 360, 374 (1989).
126 See 40 C.F.R. § 1508.27 (requiring analysis of ten different factors).
20 human dose standards, the NRC Staff completely foregoes any analysis of the impacts of the contamination to the Hudson River ecosystem.127 In particular, the DSEIS fails to determine if toxic radionuclides such as strontium-90 or cesium-137 are bioaccumulating in the environment; there is no analysis of the contamination to Hudson River fish or shellfish despite sampling showing elevated levels of such radionuclides in fish;128 there is no assessment of the effects of the contamination to the nearby ecologically critical area of Haverstraw Bay;129 and there is no DVVHVVPHQWRIWKHSRWHQWLDOHIIHFWVRIWKHOHDNLQJRQWKH+XGVRQ5LYHU¶VIHGHUDOO\\OLVWHG
endangered species, such as the short-nosed sturgeon.130 There is also no evaluation of the cumulative long-term effects of the contaminated groundwater SOXPHV7KH15&6WDIIFLWHV(QWHUJ\\¶VUHPRYDORIVSHQWIXHOIURPWKH,31 pool as evidence that impacts from the contamination would be minimized.131 However, the extensive leaking from the Unit 1 pool, which contained strontium-90, one of the most toxic radionuclides, is still in the groundwater and will continue to slowly leach into the Hudson River.132 Simply because this source of the leaking has now stopped does not change the fact that there has been no assessment of the environmental impacts of this contamination. Moreover, current and future accidental radioactive releases from the plant will only add to the existing plumes. For example, a recent underground pipe leak at the facility resulted in over 100,000 gallons of tritiated water being UHOHDVHGGLUHFWO\\LQWRWKHSODQW¶VGLVFKDUJHFDQDODQGWKH+XGVRQ5LYHU133 The NRC Staff must sufficiently evaluate the cumulative environmental impacts of the contamination that has occurred. Likewise, any claims that the leaking has ceased from the pools altogether, which is dubious as explained above, similarly does not change the fact that there has been no analysis of the environmental impacts of the contamination to date.
Section 4.5 of the DSEIS ostensibly analyzes the environmental impacts of operation on
³*URXQGZDWHU8VHDQGQuality'134 It is ludicrous to think that the NRC Staff could come to a conclusion on the quality of groundwater by only looking at public health impacts. And yet, the end conclusion in the DSEIS explicitly states that leaks do not have a significant impact on
³SODQWZRUNHUVWKHSXEOLFor the environment'135 despite absolutely no inquiry into how the leaks are affecting the natural ecosystems surrounding Indian Point.
Furthermore, by only looking at whether public health doses were within regulatory standards, the NRC Staff has failed to accurately assess the degree of the contamination caused by the spent fuel pool leaks. There is no dispute that there are at least two extensive groundwater plumes 127 See Riverkeeper Scoping Comments at 12, 14-15; Riverkeeper Petition for Hearing at 75, 84-86.
128 See Riverkeeper Scoping Comments at 14; Riverkeeper Petition for Hearing at 75, 84-86.
129 See Riverkeeper Scoping Comments at 14-15; Riverkeeper Petition for Hearing at 75, 84-86.
130 See also discussion infra.
131 DSEIS, Main Report § 4.3, at 4-36.
132 In the months leading up to the completion of draining of the IP1 pool, Entergy reported it was leaking around 70 gallons per day, contributing thousands and thousands of additional gallons of polluted water into the groundwater DQGHYHQWXDOO\\WKH+XGVRQ5LYHU,WLVQRWFOHDUWKDWWKLVDGGLWLRQDOOHDNDJHZDVIDFWRUHGLQWR(QWHUJ\\¶VFRQFOXVLRQV
in its Environmental Report or subsequent Investigation Report, and accordingly, it is not clear that the NRC Staff considered this either. It is, thus, apparent, that the NRC Staff has utterly failed to analyze the leaks that have occurred from IP1.
133 See Annie Correal, Indian Pt. Broken Pipe Spurs Safety Worries, THE NEW YORK TIMES (Feb. 27, 2009).
134 DSEIS, Main Report § 4.5 (emphasis added).
135 Id. §§ 4.3, 4.5, 4.7 (emphasis added).
21 underlying the Indian Point site.136 GZA GeoEnvironmental, the hydrogeological engineering firm hired by Entergy to examine the Indian Point site, had identified radionuclide contaminated plumes at depths ranging from 80 feet (below Indian Point 2) to 160 feet (near the Hudson River bank) for tritium, and from 120 feet (below Indian Point 1) to 150 feet (near the Hudson River bank) for strontium-90.137 The geology under the Indian Point site is characterized by fractured bedrock, in particular Inwood Marble.138 Strontium is chemically similar to calcium and prone to substitution for calcium in carbonate minerals such as marble.
A review of recent sampling results shows that the level of contamination is well in excess of EPA drinking water levels.139 The DSEIS emphasizes the NRC 6WDII¶VLQYHVWLJDWLRQILQGLQJWKDW
there is currently no drinking water exposure pathway to humans.140 As discussed at length below, this is flawed since a proposed desalination plant right across the river from Indian Point is likely to result in drinking water pathway. In any event, EPA maximum contaminant levels are a recognized, highly-conservative benchmark for comparison purposes, to assess the degree of contamination.141 As Riverkeeper consistently points out, the NRC Staff routinely uses this method of measurement to analyze spent fuel pool leaks. Using drinking water standards is a SHUIHFWZD\\WRDVVHVVWKH³VLJQLILFDQFH'RIWKHOHDNLQJXQGHU1(3$DQGWKHIDFWWKDWWKHZDWHUDW
Indian Point is not used for drinking water right now is of no moment.142 Instead, by relying solely on radiation dose calculations, the NRC Staff has failed to acknowledge the severity of the contamination.
- LWKVXFKJODULQJJDSVLQWKH15&6WDII¶VDQDO\\VLVKRZFDQWKH15&6WDIISRVVLEO\\FRPHWRDQ
accurate conclusion as tRWKH³VLJQLILFDQFH'RIWKHVSHQWIXHOSRROOHDNLQJ",IWKH\\KDGWDNHQLQWR
account that which NEPA requires, the NRC Staff should have found that the leaking is indeed
³VLJQLILFDQW'7KH15& Staff¶VRSSRVLWHFRQFOXVLRQLVHQWLUHO\\XQZDUUDQWHGXQIRXQGHG, and wrong.143 /LNHZLVHWKH15&6WDII¶VFRQFOXVLRQWKDW³DGGLWLRQDOSODQW-specific mitigation PHDVXUHVDUHQRWOLNHO\\WREHVXIILFLHQWO\\EHQHILFLDOWREHZDUUDQWHG'LVEDVHGRQDZKROO\\
incomplete analysis.144 Thus, the NRC Staff should consider appropriate mitigation measures in light of the concerns raised herein, including, but not limited to, requiring Entergy to move more spent fuel to dry casks.145 136 See Riverkeeper Petition for Hearing at 82 (referencing E-mail from James Noggle, NRC, to Timothy Rice and Larry Rosenmann of the NYS DEC (Nov. 6, 2006); Groundwater Investigation Executive Summary (Indian Point Energy Center, Buchanan, N.Y., Jan. 2008), at 2-4, available at http://jic.semo.state.ny.us/Resources/ExecutiveSummary%20GW%20final.pdf.
137 See January 7, 2008 GZA GeoEnvironmental Inc., Hydrogeologic Site Investigation Report, Figure 9.1 - Unit 2 Tritium Plume, Cross Section A - $¶, available at NRC ADAMS Accession No. ML0800320055; id. at Figure 9.2 -
Unit 1 Strontium Plume, Cross Section B - %¶, available at NRC ADAMS Accession No. ML0800320056.
138January 7, 2008 GZA GeoEnvironmental Inc., Hydrogeologic Site Investigation Report at 50. The GZA report is available at NRC ADAMS Accession No. ML080320540.
139 See Riverkeeper Petition for Hearing at 82-84.
140 DSEIS, Main Report § 2.2.7, at 1-108.
141 See Riverkeeper Petition for Hearing at 82-84.
142 See 40 C.F.R. § 1508.27; 10 C.F.R. § 51.53(c)(3)(iv).
143 DSEIS, Main Report § 4.3, 4.5, 4.7.
144Id. § 4.3, at 4-35.
145 Riverkeeper Scoping Comments at 15.
22 The NRC Staff has the ultimate responsibility for performing the required NEPA evaluation in relicensing proceedings.146 6LQFH(QWHUJ\\¶V(5ZDVZKROO\\GHILFLHQWLQUHJDUGVWRDQDO\\]LQJWKH
impacts of the spent fuel pool leaking, it is incumbent upon the NRC Staff to pick up the slack.
As such, the NRC Staff must take into account the foregoing concerns, perform the necessary analyses and assessments as indicated, and incorporate their findings into the FSEIS.147
- 4. Failure to Consider the Rockland County Desalination Project 7KH15&6WDII¶VDVVHVVPHQWRIWKHVSHQWIXHOSRROOHDNVLQ6HFWLRQRIWKH'6(,6LVpremised XSRQWKHDVVXPSWLRQWKDW³QRGULQNLQJZDWHUH[SRVXUHSDWKZD\\H[LVWV'148 DQGWKDWWKH³RQO\\
noteworthy dose pathway resulting from contaminated ground water migration to the river is through the consumption of fish and invertebrates from the Hudson RLYHU'149 However, the IDFWVFRQFHUQLQJ8QLWHG:DWHU1HZ<RUN¶VSURSRVHGGHVDOLQDWLRQSODQWLQ5RFNODQG&RXQW\\
indicate a highly foreseeable outcome to the contrary, and, as such, must be considered and incorporated into the review process in all relevant contexts and document sections.
This desalination project, which will withdraw Hudson River water, to be sited across the river and slightly downstream from Indian Point,150 and deliver 7.5 million gallons per day of drinking water, is currently undergoing review by the NYSDEC,151 as well as other agencies, concerning various permit applications and SEQRA. United Water New York has stated that this project is LQGHYHORSPHQWSXUVXDQWWRWKH3XEOLF6HUYLFH&RPPLVVLRQ2UGHURI'HFHPEHU³36&
2UGHU'ZKLFK approved a merger and rate plan, and provided for an increase in the drinking water supply to Rockland County residents.152 According to United Water New York, as required by the PSC Order, the scheduled in-service, operational completion date for the project is 2015.153 Plans for a pilot plant, which has been designed to evaluate water treatment methodologies for the permanent plant, are now also in the application and permitting process 146 See Exelon Generation Co., LLC (Early Site Permit for Clinton ESP Site), ASLBP No. 04-821-01-ESP, 2005 N.R.C. LEXIS 61, *5-6 (2005); 42 U.S.C. § 4332.
147 The NRC Staff has consistently refuted the necessity of assessing the environmental impacts of the spent fuel pool leaks in the manner Riverkeeper describes, including the need to consider leaks from IP1, the effects on the Hudson River ecosystem, or the need to use any other standards aside from NRC dose limits. However, 5LYHUNHHSHU¶VFRQWHQWLRQUHODWLQJWRWKHOHDNVKDVEeen admitted for a hearing, and is currently being litigated. In light of the fact that these issues are in dispute, the NRC Staff should err on the side of caution in the preparation of its FSEIS and address the concerns presented herein.
148 See e.g., DSEIS, Main Report § 2.2.7 at 2-107.
149 Id.
150 The Intake Site consists of a one-acre portion of one tax parcel in the Town of Haverstraw, 21.09-2-1, located at 710 Beach Road. As shown in Figure 2-2, annexed hereto as Exhibit C, the Intake Site is on the south side of Beach Road on a point of land that extends into the Hudson River. The Intake Site is bounded to the north by the road and to the east by the Hudson River; see also Google Map showing rough proximity of Indian Point to proposed desalination plant, annexed hereto as Exhibit D.
151 See, e.g., Letter from William C. Janeway (DEC Regional Director) to Rebecca Troutman (Riverkeeper), March
DQQH[HGWR5LYHUNHHSHU¶VFRPPHQWVDV([KLELWE &RQILUPLQJ'(&¶VOHDGDJHQF\\VWDWXVIRUWKH
desalination plant project).
152 Commission Order in Case No. 06-W-0131, Issued and Effective December 14, 2006 by the New York State Department of Public Service.
153 Haverstraw Water Supply Project, Draft Environmental Impact Statement, September 26, 2008, at S-1. Please note that this document is currently in revision pursuant to direction from the DEC. Available at http://hudsondesal.com/home.cfm, and last viewed on March 11, 2009.
23 ZLWK'(&0RUHRYHUD'UDIW(QYLURQPHQWDO,PSDFW6WDWHPHQW³'HVDOLQDWLRQ'(,6'RQWKH
project has already been submitted by United Water New York.154 Pursuant to NEPA, the NRC Staff is required to assess the impacts associated with the desalination plant in the DSEIS: An environmental impact statement must include discussion of any indirect effects of the proposed project and their significance.155 ³,QGLUHFWHIIHFWV'DUH
defined as those which are caused by the action and are later in time or farther removed in distance, but are still reasonably foreseeable. Indirect effects may include growth inducing effects and other effects related to induced changes in the pattern of land use, population density or growth rate, and related effects on air and water and other natural systems, including ecosystems. Effects and impacts as used in these regulations are synonymous.156 7KXVDQ(,6PXVWFRQVLGHULPSDFWVZKLFKDUH³UHDVRQDEO\\IRUHVHHDEOH'157 There is no doubt WKDWHIIHFWVRQ5RFNODQG&RXQW\\¶VGULQNLQJZDWHUVXSSO\\GXHWRUDGLRDFWLYHFRQWDPLQDWLRQIURP
,QGLDQ3RLQWDUH³UHDVRQDEO\\IRUHVHHDEOH''XHWRWKHIDFWWKDWWKH+XGVRQ5LYHUIORZVVRXWK
from IP towards the planned, closely situated intake site of the desalination plant, it is more than
³UHDVRQDEO\\IRUHVHHDEOH'WKDWDQ\\FXUUHQWZDWHU-borne contamination, as well as potential additional contamination due to continued deterioration of plant systems, accident or terrorist event, will impact the water supply provided via the desalination plant, and in turn public health.
6LPLODUO\\(QWHUJ\\¶VRZQHQYLURQPHQWDOGRFXPHQWVDGPLWWKat the topography of Indian Point is VXFKWKDW³VXUIDFHGUDLQDJHLVWRZDUGWKH+XGVRQ5LYHU'158 Neither Entergy nor the NRC Staff dispute that the leaking spent fuel pools have resulted in the leaching into the Hudson River of two extensive plumes of radionuclide-laden contamination.159 Monitoring well samples at Indian Point show that the levels of contamination in the groundwater are well above EPA drinking water limits.160 In addition to the ongoing spent fuel pool leaking, other future accidental discharges from the plant will also contribute contamination 154 Available at http://hudsondesal.com/home.cfm, and last viewed on March 11, 2009.
155 40 C.F.R. § 1502.16.
156 40 C.F.R. § 1508.8(b) 157 See &(40HPRUDQGXP0RVW$VNHG4XHVWLRQV&RQFHUQLQJ&(4¶V1DWLRQDO(QYLURQPHQWDO3ROLF\\$FW
Regulations, 46 Fed5HJ0DUFK³7KH(,6PXVWLGHQWLI\\DOOWKHLQGLUHFWHIIHFWVWKDWDUH
NQRZQDQGPDNHDJRRGIDLWKHIIRUWWRH[SODLQWKHHIIHFWVWKDWDUHQRWNQRZQEXWDUHµUHDVRQDEO\\IRUHVHHDEOH¶
The agency has the responsibility to make an informed judgment, and to estimate future impacts on that basis, especially if trends are ascertainable....The agency cannot ignore these uncertain, but probable, effects of its GHFLVLRQV'See also, Swain v. Brinegar, 542 F.2d 364, 7th &LU³An EIS need not review all possible HQYLURQPHQWDOHIIHFWVRIDSURMHFW,WLVVXIILFLHQWLILWFRQVLGHUVRQO\\WKRVHZKLFKDUHµUHDVRQDEO\\IRUHVHHDEOH¶'
Carolina Environmental Study Group v. U.S.)G'&&LU³6HFWLRQ&LRI1EPA UHTXLUHVDµGHWDLOHGVWDWHPHQW¶RQµWKHHQYLURQPHQWDOLPSDFWRIWKHSURSRVHGDFWLRQ¶7KDWODQJXDJHUHTXLUHV
GHVFULSWLRQRIUHDVRQDEO\\IRUHVHHDEOHHIIHFWV$µUXOHRIUHDVRQ¶LVXVHGWRDVFHUWDLQWKRVHHIIHFWVDQWLFLSDWHG'
158 Entergy ER at 2-18.
159 See Groundwater Investigation Executive Summary (Indian Point Energy Center, Buchanan, N.Y., Jan. 2008), at 2, available at http://jic.semo.state.ny.us/Resources/ExecutiveSummary%20GW%20final.pdf.
160 See Riverkeeper Petition for Hearing at 82-83.
24 to the Hudson River. For example, a recent underground pipe leak at the facility resulted in over 100,000 gallons of tritiated water being released directly into the waterway.161 Moreover, and ominously, the Desalination DEIS specifically considers the presence of Indian Point and the impacts of its contaminants to the water quality:
Due to the presence of the Indian Point nuclear power plant on the eastern shore of the Hudson River in Buchanan, NY, some have expressed concern regarding the possible radiological contamination of groundwater as well as the Hudson River close to the plant. A VXPPDU\\RIWKHUDGLRORJLFDOUHVXOWVIURP8QLWHG:DWHU¶VVDPSOLQJ
program is provided below. Table 2-4 summarizes the analyses performed for radionuclides in water samples collected at several locations in the Hudson River in 2007 and 2008.162 The Desalination DEIS states that preliminary testing showed that the water withdrawn in the vicinity of the intended site contains detectable levels of the radionuclides radium, uranium, strontium-90, and tritium.163 The proposed desalination plant is not merely speculative at this point given the fact that it is in the planning, environmental review, and permitting stages. It isWKXV³UHDVRQDEO\\IRUHVHHDEOH'
as contemplated by the regulations implementing NEPA, that impacts to drinking water quality will result due to the radiological contamination from Indian Point. The presence of an environmental impact statement for the Rockland County Desalination Project renders the foreseeability of these impacts irrefutable. Indeed, the NRC Staff does not have to rely on prognostication to consider the impacts of IP on the proposed desalination plant because there is currently ample available information for the agency to rely on. Thus, NRC Staff is required to assess the effects of Indian Point on the Rockland County desalination project.
Yet, despite the foreseeable nature of this project, the DSEIS is completely devoid of assessment of the impacts of the license renewal on drinking water quality as it relates to the use of the Hudson River as a source of drinking water via the proposed desalination plant. The NRC 6WDII¶VFXUUHQWDQDO\\VLVRIUDGLRORJLFDOLPSDFWVLVSUHPLVHGXSRQDK\\SRWKHWLFDO³PD[LPDOO\\
H[SRVHGLQGLYLGXDO'ZKLFKGRHVQRWLQFOXGHFRQVXPSWLRQRIGULQNLQJZDWHUYLDWKHGHVDOLQDWLRQ
plant as an exposure pathway.164 While the NRC Staff cites to past radiological sampling data to demonstrate no detectable radiological effects on drinking water,165 there is no mention whatsoever of what kinds of radiological effects on drinking water supply will result from having a facility in close proximity and downstream from Indian Point, withdrawing water for human consumption. MoreoveUWKH15&6WDII¶VHYDOXDWLRQRIWKHJURXQGZDWHUFRQWDPLQDWLRQIURP
161 See Annie Correal, Indian Pt. Broken Pipe Spurs Safety Worries, THE NEW YORK TIMES (Feb. 27, 2009).
162 Haverstraw Water Supply Project, Draft Environmental Impact Statement, September 26, 2008, at 2 +/- 9. Please note that this document is currently in revision pursuant to direction from the DEC.
163 Id.
164 See DSEIS, Main Report §§ 2.2.7, 4.3.
165 See id. § 2.2.7 at 2-104, 2-105.
25 spent fuel pool leaks hinges on its finding that the only exposure pathway is through consumption of aquatic organisms.166 Thus, the DSEIS is substantially incomplete, and must be corrected prior to the conclusion of the environmental review process. The NRC Staff must comprehensively review and consider the impacts of radiological releases from the Indian Point facility, both through normal operations and from unplanned discharges, on drinking water quality in light of the Rockland County Desalination Project.
- 5. Failure to Properly Consider Impacts to the Communities Utilizing Hudson River Water as a Water Supply Source
$GGLWLRQDOO\\DOWKRXJKWKH'6(,6DFNQRZOHGJHVWKDW³WKH+XGVRQ5LYHUwas and is used as a VRXUFHRISRWDEOHZDWHU'167 the NRC Staff fails to properly identify and evaluate potential adverse impacts to the communities which draw Hudson River water for their water needs. The
'6(,6DVVHUWVWKDWLWLQFOXGHV³GULQNLQJZDWHU'LQLWVHYDOXDWLRQRI³DLUERUQHSDWKZD\\'EXWRPLWV
WKLVFULWLFDOLVVXHLQWKHUHIHUHQFHWR³ZDWHUERUQHSDWKZD\\'168 Further, in the subsequent GLVFXVVLRQRIGDWDIURPWKH³5(035HVXOWV'WKH'6(,6VLPSO\\UHIHUVWRUHVXOWVRIWKH
³PRQWKO\\GULQNLQJZDWHUVDPSOHV'ZLWKRXWLGHQWLI\\LQJZKLFKVRXUFHVSUHVXPDEO\\WKRVHZLWK
potential airborne exposure only) were examined.169 Communities which use the Hudson River for their water supply needs, and are therefore vulnerable to waterborne exposure to contaminants, include, but are not limited to, the City of Poughkeepsie, the Town and Village of Rhinebeck, and New York City, which operates the emergency Chelsea pump station at New Hamburg. Due to the fact that the Hudson River is a tidal estuary (the water flows up and downstream), and dispersion and diffusion of contaminants occurs with their release into the waterway,170 radionuclides can be transported upriver as well as downriver. Accordingly, the potential adverse impacts caused by the operation of Indian Point, under normal operation, with leaks, other accident or disaster, pertaining to the current use of the Hudson river as a source of water, must be fully assessed.
- 6. Improper Conclusions Regarding Cumulative Environmental Impacts of Operation
- a. Cumulative Impacts on Aquatic Resources In assessing the current and likely future stressors that contribute to cumulative impacts of aquatic resources of the Hudson River, the NRC Staff concedes that the continued operation of IP2 and IP3 has the potential to adversely affect a variety of RIS species due to the once-through 166 See id. § 2.2.7 at 1-108.
167 Id. § 2.2.5.2, at 2-40.
168 Id. §2.2.7 at 2-104.
169 Id. §2.2.7 at 2-105.
170 See e.g., Ho, D.T., P. Schlosser, & T. Caplow, Determination of longitudinal dispersion coefficient and net advection in the tidal Hudson River with a large-scale, high resolution SF6 tracer release experiment, Environ. Sci.
Technol., 36, 3234-3241, 2002.; Ferdi L. Hellweger, Alan F. Blumberg, Peter Schlosser, David T. Ho, Theodore Caplow, Upmanu Lall, & Honghai Li, Transport in the Hudson Estuary: A Modeling Study of Estuarine Circulation and Tidal Trapping, Estuaries Vol. 27, No.3 pp.527-538 (June 2004).
26 cooling system.171 (InterestinglyWKHVWDII¶VH[DPLQDWLRQRIcumulative impacts to water and sediment quality of the Hudson River does not even mention the radioactive contamination caused by spent fuel pool leaks at Indian Point172). When all the various factors, including the operation of Indian Point, were considered, the NRC Staff found that the overall effects on DTXDWLFUHVRXUFHVZDV³ODUJH'173,Q3LVFHV¶H[SHUWRSLQLRQ³WKH,QGLDQ3RLQWSRZHUSOant must take its share of the responsibility and undertake to do as little damage a possible to an already VWUHVVHGV\\VWHP'174
- b. Cumulative Radiological Impacts The NRC Staff concludes in Section 4.8.2 of the DSEIS that the cumulative radiological impacts DUH³60$//'175 +RZHYHULQOLJKWRIWKHLVVXHVUDLVHGDERYHUHJDUGLQJWKH15&6WDII¶VIODZHG
assessment of spent fuel pool leaks, and the failure to consider the Rockland County Desalination Project or other drinking water supplies, this conclusion is dubious. A more thorough analysis that fully addresses the above-referenced concerns must be completed before the NRC Staff can come to an accurate conclusion as to cumulative radiological impacts of continued operation of IP2 and IP3.
DSEIS Section 5.0 Improper Analysis of Severe Accident Mitigation Alternatives 7KHDVVHVVPHQWRI6HYHUH$FFLGHQW0LWLJDWLRQ$OWHUQDWLYHV³6$0$V'LQ6HFWLRQRIWKH
DSEIS is wholly deficient because the NRC Staff incorrectly relied upon the assessment of 6$0$VLQ(QWHUJ\\¶s ER.176 6SHFLILFDOO\\WKH15&6WDIIIRXQGWKDW(QWHUJ\\¶VPHWKRGRORJ\\DQG
analyses were completely sound.177 Unfortunately, the NRC Staff has ignored several fundamental flaws in the methods employed by Entergy, which, if considered, would greatly change the outcome of the SAMA analysis.
- 1. Failure to Consider the Risk of Intentional Acts of Sabotage 7KH15&6WDII¶V6$0$DVVHVVPHQWLVXWWHUO\\IODZHGEHFDXVHLWIDLOVWRFRQVLGHUWKHULVNVSRVHG
by terrorist attacks on Indian Point. Riverkeeper recognizes that the NRC refuses to consider the environmental impacts of intentional attacks in a licensing proceeding. In the instant proceeding, WKH15&6WDIIKDVH[SOLFLWO\\VDLGWKDWWKH³LVVXHRIVHFXULW\\DQGULVNIURPPDOHYROHQWDFWVDW
nuclear power plants is beyonGWKHVFRSHRIOLFHQVHUHQHZDOWKH&RPPLVVLRQ¶VORQJ-standing position is that NEPA does not require inquiry into the consequences of a hypothetical terrorist DWWDFN'178,WLV5LYHUNHHSHU¶VXQZDYHULQJSRVLWLRQWKDWWKLVUHIXVDOLVVLPSO\\XQUHDVRQDEOe.
171 DSEIS, Main Report § 4.8.1, at 4-56.
172 Id. § 4.8.1, at 4-57.
173 Id. § 4.8.1, at 4-58; Pisces Report at 10.
174 Pisces Report at 10.
175 DSEIS, Main Report § 4.8.3, at 4-60.
176 Id. § 5.2.
177 Id. § 5.2, at 5-6 to 5-10.
178 NRC Staff Scoping Summary Report at 279-80.
27 Numerous reports indicate that nuclear power plants remain likely targets of terrorist attacks.
The 9/11 Commission Report revealed that the mastermind of the 9/11 attacks had originally planned to hijack additional aircrafts to crash into targets, including nuclear power plants, but wrongly believed the plants were heavily defended.179 This report indicates that the terrorists were considering attacking a specific nuclear facility in New York which one of the pilots had seen during a familiarization flight near New York.180 This was likely Indian Point, especially given the fact that more than 17 million people live within 50 miles of the facility.181 In the years since the 9/11 attacks, the federal government, including the NRC, has repeatedly recognized that there is a credible threat of intentional attacks on nuclear power plants.182 Notably, existing nuclear power plants in the United States were built between the 1950s and the 1980s and were not intended to be able to withstand the impact of aircraft crashes or explosive forces.183 Thus, given the current landscape, it is, essential that the risks of intentional attacks be considered during the relicensing process.
7KH86&RXUWRI$SSHDOVIRUWKH1LQWK&LUFXLWKDVVSHFLILFDOO\\IRXQGWKDWWKH15&¶VFRQsistent refusal to consider the risks of terrorism is unreasonable,184 although, misguidedly, the NRC has explicitly chosen to limit the applicability of that judicial opinion.185 The U.S. Environmental Protection Agency also specifically requested the NRC Staff to address the impacts of intentional attacks in the Indian Point license renewal EIS, to no avail.186 7KH&RPPLVVLRQ¶VUDWLRQDOHIRUSUHFOXGLQJWKLVLPSRUWDQWLVVXHIURPUHYLHZGXULQJWKH
relicensing process is very weak. For example, the Commission has concluded that the benefits of considering the environmental impacts of attacks during a license renewal term would be marginal because those impacts are addressed in the current license term.187 This reasoning is not supportable since the level of defenVHUHTXLUHGXQGHU15&¶V$WRPLF(QHUJ\\$FW-based 179 1DW¶O&RPP¶QRQ7HUURULVW$WWDFNV8SRQWKH86The 9/11 Commission Report DW³
&RPPLVVLRQ5HSRUW'
180 Id. at 245.
181 See Edwin Lyman, Chernobyl on the Hudson? The Health & Economic Impacts of a Terrorist Attack at the Indian Point Nuclear Power Plant, at 23 (2004), available at, http://www.riverkeeper.org/document.php/651/11302007_EL_Lym.pdf.
182 See, e.g.,; Wide-Ranging New Terror Alerts, CBS News.com (May 26, 2002), available at, http://cbsnews.com/stories/2002/05/24/attack/main510054.shtml GLVFXVVLQJKHLJKWHQHGDOHUWRIWKH86¶VQXFOHDU
power plants as a result of information gained by the intelligence community); FBI Warns of Nuke Plant Danger, CBS News.com (May 1, 2003), available at, http://www.cbsnews.com/stories/2003/09/04/attack/main571556.shtml (discussing FBI warning to nuclear plant operators to remain vigilant about suspicious activity that could signal a potential terrorist attack); General Accounting Office, Nuclear Regulatory Commission: Oversight of Security at Commercial Nuclear Power Plants Needs to be Strengthened, GAO-03-752 (2003) (noting that U.S. nuclear power SODQWVDUHSRVVLEOHWHUURULVWWDUJHWDQGFULWLFL]LQJWKH15&¶VRYHUVLJKWRISODQWVHFXULW\\)%,¶Vth Warning, CBS News.com (July 2, 2004) (discussing FBI warning of recent intelligence showing Al-Qaeda interest in attacking nuclear plants).
183 In re All Nuclear Power Reactor Licensees, DD-02-04 (Nov. 1, 2002), available at http://www.nrc.gov/reading-rm/doc-collections/petitions-2-206/directors-decision/2002/ml022890031.pdf; NRC: Nuclear Power Plants Not Protected Against Air Crashes, Associated Press (Mar. 28, 2002).
184 San Luis Obispo Mothers for Peace v. NRC, 449 F.3d 1016 (9th Cir 2006).
185 Amergen Energy Co., L.L.C. (Oyster Creek Nuclear Generating Station), CLI-07-08, 65 N.R.C. 124 (2007).
186 Letter from Grace Musumeci, U.S. EPA, to Chief, NRC Rules and Directives Branch (Oct. 10, 2007) (ADAMS Accession No. ML07290360).
187 See Duke Energy Corp. (McGuire Nuclear Station, Units 1 and 2; Catawba Nuclear Station, Units 1 and 2), CLI-02-26, 56 N.R.C. 358, 365 (2002).
28 security regulations is lighter than the fundamental design changes that may warrant consideration under NEPA if they are cost-effective.188 Moreover, this reasoning is inconsistent with NEPA, which imposes mandatory obligations on the NRC in considering proposals for re-licensing of nuclear plants.189 The Commission also rationalizes its decision to preclude risk assessment of terrorist attacks by arguing that it had already assessed the impacts of intentional attacks in the 1996 GEIS.190 The GEIS contains the conclusion that:
Although the threat of sabotage events cannot be accurately quantified, the commission believes that acts of sabotage are not reasonably expected. Nonetheless, if such events were to occur, the commission would expect that resultant core damage and radiological releases would be no worse than those expected from internally initiated events.191 In the DSEIS, the NRC Staff relies upon the conclusions in the GEIS to rationalize its exclusion of risks associated with terrorism.192 Unfortunately, the conclusions in the GEIS been outdated E\\WKHVLJQLILFDQWFKDQJHLQWKH&RPPLVVLRQ¶VDQDO\\VLVRIWKHSRWHQWLDOIRULQWHQWLRQDODWWDFNV
188 Gordon Thompson, Risk-Related Impacts from Continued Operation of the Indian Point Nuclear Power Plants (Nov. 28, 2007), at §§ 7, 9, available at, http://www.riverkeeper.org/document.php/652/11302007_GT_Tho.pdf
³7KRPSVRQ5HSRUW'
189 The NRC recognized as much in a 2001 decision denying a petition for rulemaking by the Nuclear Energy
,QVWLWXWH³1(,'WKDWZRXOGKDYHHOLPLQDWHGWKHUHTXLUHPHQWWRFRQVLGHU6$0$VNuclear Energy Institute; Denial of Petition for Rulemaking, 66 Fed. Reg. 10,8)HEUXDU\\,QUHVSRQVHWRDFRPPHQWWKDW³WKHFRVWVRI
performing the SAMA reviews required by Part 51 are not justified when compared to the small potential safety EHQHILWVWKDWUHVXOWIURPWKHUHYLHZV'WKH&RPPLVVLRQVWDWHG³7KH15&EHOLHYes that it should continue to consider SAMAs for individual license renewal applications to continue to meet its responsibilities under NEPA. That statute requires NRC to analyze the environmental impacts of its actions and consider those impacts in its decisionmaking. In doing so, Section 102(2)(C) of NEPA implicitly requires agencies to consider measures to mitigate those impacts when preparing an impact statement. See Robertson v. Methow Valley Citizens Council, 490 U.S. 332 (1989). NRC's obligation to consider mitigation exists whether mitigation is ultimately found to be cost-beneficial and whether or not mitigation ultimately will be implemented by the licensee.'66 Fed. Reg. at 10,836 (emphasis added). The Commission also provided a detailed rebuttal WR1(,¶VDUJXPHQWWKDWOLFHQVHUHQHZDOZDVD
PHUH³FRQWLQXDWLRQ'RIWKHFXUUHQWRSHUDWLQJWHUPDQGWKHUHIRUHVKRXOGQRWWULJJHU1(3$REOLJDWLRQV³>7@RWKH
extent that license renewal involves a continuation of impacts already experienced at the site under the current operating license, the arguments made by the petitioner would appear to call for the elimination of almost the entire environmental review of impacts from operation during the license renewal term, a position clearly at odds with the Commission's approach to the matter and also, as discussed below, inconsistent with the case law related to UHOLFHQVLQJ')HG5HJDW-37. The Commission found that that none of the cases under NEPA excusing agencies from considering certain enviURQPHQWDOLPSDFWVVXSSRUWHGSHWLWLRQHU¶VDUJXPHQWWKDWWKH15&FDQLJQRUH
the impacts of its actions in the context of a license renewal. Id. The Commission cited to a case which squarely addressed the issue and concluded that there is a need to consider environmental impacts in the context of a relicensing. Id. (citing Confederated Tribes and Bands of the Yakima Indian Nation v. Federal Energy Regulatory Commission, 746 F.2d 466 (9th Cir. 1984). Thus, the Commission's position in Duke Energy is inconsistent with both NEPA and the Commission's previous interpretation of NEPA.
190 See Duke Energy Corp. (McGuire Nuclear Station, Units 1 and 2; Catawba Nuclear Station, Units 1 and 2), CLI-02-26, 56 N.R.C. 358, 365 n.24 (2002).
191 GEIS at 5-18.
192 DSEIS, Main Report § 5.1.2, at 5-3.
29 that has occurred since September 11, 2001.193 It also totally overlooks the fact that mitigation measures to avoid conventional accidents may be different than those designed to avoid effects of intentional attack. The findings in the GEIS also do not take into account the fact that radiological consequences of a spent fuel pool fire are significantly different from the consequences of a core damage accident,194 and that mitigation measures for a spent fuel pool fire would be quite different from mitigation measures for a severe core-damage accident.195 Moreover, in a recent denial of a petition for rulemaking, which sought reconsideration and revocation of the Category 1 designation of spent fuel pool fires, the Commission explained that it considered the probability of a successful terrorist attack to be low because licensees have implemented mitigative measures believed to lower the likelihood that fuel will ignite if the pool is attacked:
As previously described, the NRC has required, and nuclear power plant licensees have implemented, various security and mitigation measures that, along with the robust nature of SFPs, make the probability of a successful terrorist attack (i.e., one that causes an SFP zirconium fire, which results in the release of a large amount of radioactive material into the environment) very low. As such, a successful terrorist attack is within the category of remote and VSHFXODWLYHPDWWHUVIRU1(3$FRQVLGHUDWLRQVLWLVQRWµUHDVRQDEO\\
IRUHVHHDEOH¶7KXVRQWKLVEDVLVWKH15&ILQGVWKDWWKH
environmental impacts of renewing a nuclear power plant license, in regard to a terrorist attack on a SFP, are not significant.196
,QIDFWLQ-XO\\WKH15&DPHQGHG,3¶VRSHUDWLQJOLFHQVHWRUHTXLUHWKHOLFHQVHHWRDGGUHVV
large fires and explosions including those caused by planes.197 However, such mitigation measures contemplated by the NRC to acceptably reduce the likelihood of a successful attack on a spent fuel pool were never considered in the GEIS or in any other subsequent NEPA document.198 This starkly demonstrates that the GEIS does not validly deal with impacts related to terrorism, and the need to assess such impacts comprehensively under NEPA as part of the license renewal process is apparent.
Despite the foregoing, the NRC Staff refused to consider the risk of intentional attacks in its SAMA DVVHVVPHQWLQWKH'6(,6$FFRUGLQJO\\WKH15&6WDII¶V6$0$DQDO\\VLVLVSDWHQWO\\
deficient. The Indian Point reactors and spent fuel pools are vulnerable to a range of attack VFHQDULRVIRUZKLFKFRQYHQWLRQDOSUREDELOLVWLFULVNDVVHVVPHQW³35$'WHFKQLTXHs can be 193 See San Luis Obispo Mothers for Peace v. NRC, 449 F.3d 1016 (9th &LU³:HILQGLWGLIILFXOWWRUHFRQFLOH
WKH&RPPLVVLRQ¶VFRQFOXVLRQWKDWDVDPDWWHURIODZWKHSRVVLELOLW\\RIDWHUURULVWDWWDFNLVµUHPRWHDQGVSHFXODWLYH¶
ZLWKLWVVWDWHGHIIRUWVWRXQGHUWDNHDµWRSWRERWWRP¶VHFXULW\\UHYLHZDJDLQVWWKLVVDPHWKUHDW'
194 Thompson Report at 9 n.9 195 Id. at 52.
196 Denial of Petition for Rulemaking, 73 Fed. Reg. at 46,211 (2008).
197 Indian Point Unit 3 Operating License, DPR-64, Condition AC, Mitigation Strategy License Condition (July 11, 2007), ML052720273, at 8.
198 Denial of Petition for Rulemaking, 73 Fed. Reg. at 46,211 (2008).
30 adapted by postulating an initiating event (malicious act) and then examining the outcomes of that event.199 This has not been done.
0RUHRYHULQWKHILUVWVWHSRI(QWHUJ\\¶VDQDO\\VLVZKLFKWKH15&DFFHSWVDVVRXQGLH
establishing the baseline of severe accidents, Entergy, and the NRC Staff in turn, did not consider the contribution to severe accident costs made by such intentional attacks at Indian Point.200 The present value of cost risks for an attack at an Indian Point Reactor and its pool exceeds half a billion dollars, warranting significant expenditures on SAMAs.201 The present value of cost risks for an attack on a reactor alone are also significant -- $62 million to $73 million.202 Relevant SAMAs with a value of this magnitude have not been considered.
$GGLWLRQDOO\\(QWHUJ\\¶VRULJLQDODVVHVVPHQWZKLFKWKH15&6WDIIFODLPVLVVRXQGIDLOVWR
address National Infrastructure Protection Plan principles for increasing the inherent robustness of infrastructure facilities against attack, which could significantly reduce the radiological and regulatory risk-related impacts of continued operation of the IP2 and IP3 plants.203 Based on the foregoing it is clear safety risks due to intentional attacks and accident mitigation alternatives have not been adequately addressed in the DSEIS.204 The NRC Staff must factor such risks into its SAMA analysis prior to the end of the environmental review process.
- 2. Failure to Consider the Risk of Spent Fuel Pool Fires The SAMA analysis in the DSEIS does not adequately take into account the risk of spent fuel pool fires. Riverkeeper is aware that the NRC classifies the environmental impacts of pool DFFLGHQWVDQGUHODWHG6$0$VDV³&DWHJRU\\'LVVXHVWKDWDUHQRWVXEMHFWWRFRQVLGHUDWLRQLQ
individual license renewal proceedings absent a waiver or change in the regulations.205 However
³QHZDQGVLJQLILFDQW'LQIRUPDWLRQDERXWWKHULVNRIVSHQWIXHOSRROILUHVZDUUDQWVFRPSUHKHQVLYH
review in the instant relicensing proceeding.
While initially, it was assumed that stored spent fuel generally did not pose significant risks, with the introduction of high-density, closed-form storage racks into spent fuel pools beginning in the 1970s, this understanding is no longer valid.206 The closed-form configuration of the high density racks can create a major problem if water is lost from a spent fuel pool, including disastrous pool fires.207 In fact, studies conducted after the issuance of the 1996 License Renewal GEIS contradict previous studies that had asserted that complete drainage of spent fuel pools was the most severe case and that aged fuel would not burn.208 These later studies establish that if the water level in a fuel storage pool dropped to the point where the tops of the 199 Thompson Report at 42-45.
200 '6(,60DLQ5HSRUW(QWHUJ\\¶V(5DW
201 See Thompson Report at 45-46, Table 7-7, Section 9.
202 Id. at 49.
203 See id. at 58-59.
204 See generally id. §§ 7, 9.
205 Florida Power and Light, 54 N.R.C. at 12.
206 Thompson Report at 18-27.
207 Id.
208 See Waste Confidence Rule, 55 Fed. Reg. 38,474, 38,481 (Sept. 18, 1990).
31 fuel assemblies are uncovered, the fuel would burn regardless of its age, and resulting fires can be catastrophic.209
,QOLJKWRIWKLV³QHZLQIRUPDWLRQ'WKH6WDWHVRI0DVVDFKXVHWWVDQG&DOLIRUQLDUHFHQWO\\SHWLWLRQHG
the NRC for a rulemaking seeking reconsideration and revocation of the Category 1 designation of spent fuel pool fires.210 The Commission issued a decision in early 2008, finding that the SHWLWLRQLQJVWDWHVKDGQRWSUHVHQWHG³QHZDQGVLJQLILFDQW'LQIRUPDWLRQVRDVWRZDUUDQW
supplementation of the GEIS.211 However, in its decision, the Commission made no attempt to defend the continuing technical validity of the studies cited in the GEIS, and in fact confirmed the conclusions of NUREG-1738 that partial drainage of a spent fuel pool is a more serious condition than complete drainage, that aged fuel can burn, and that spent fuel fires will propagate.212 Further the Commission discussed various mitigation measures that have been implemented by nuclear power plant licensees, asserting that such measures rendered the environmental impacts of high-density pool storage of spent fuel insignificant.213 For example, in response to the evidence that partial draindown is a more severe situation than total draindown, the Commission discussed the fact that all nuclear plant SFPs have been assessed to identify additional existing cooling capability and to provide new supplemental cooling capability which could be used during such rare events.
This supplemental cooling capability specifically addresses the cooling needs during partial draindown events, and would reduce the probability of a zirconium fire during those extreme events.214 The Commission also described other mitigation measures that have been imposed on all nuclear SRZHUSODQWOLFHQVHHVLQFOXGLQJDQ³LQWHUQDOVWUDWHJ\\'ZKLFKLPSOHPHQWVDVSHQWIXHOSRRO
³makeup system that can supply the required amount of makeup water and SFP spray to remove GHFD\\KHDW'DQGDQ³H[WHUQDOVWUDWHJ\\'LQZKLFKDQLQGHSHQGHQWO\\SRZHUHGSRUWDEOH6)3
coolant makeup would be used to mitigate a range of scenarios that could reduce pool water levels.215 7KH&RPPLVVLRQIXUWKHUGHVFULEHG³OHDNDJHFRQWUROVWUDWHJLHV'WKDWZRXOGEH
considered in cases where SFP water levels can not be maintained, as well as development of timelines for dispersed and non-dispersed spent fuel storage.216 The Commission cited to license amendments incorporating such strategies into plant licensing bases of all operating nuclear power plants in the United States.217,QGHHG,QGLDQ3RLQW¶VRSHUDWLQJOLFHQVHKDVVSHFLILFDOO\\
209 NUREG-1738, Final Technical Study of Spent Fuel Pool Accident Risk at Decommissioning Nuclear Power Plants (January 2001); 2006 NAS Study at 53-54.
210 See Massachusetts Attorney General; Receipt of Petition for Rulemaking, 71 Fed. Reg. 64,169 (Nov. 1, 2006);
State of California; Receipt of Petition for Rulemaking, 72 Fed. Reg. 27,068 (May 14, 2007).
211 Denial of Petition for Rulemaking, 73 Fed. Reg 46,204 (2008).
212 Id. at 46,208-10.
213 Id. at 46,209-10.
214 Id.
215 Id. at 46,209.
216 Id.
217 Id.
32 been amended to incorporate such mitigation measures.218 As discussed above, the Commission further emphasized that mitigative measures have reduced the risk of spent fuel pool fire from intentional attacks.
7KH&RPPLVVLRQ¶VGLVFXVVLRQRIVSHQWIXHOSRROILUHVDQGPLWLJDWLYHPHDVXUHVLVZKROOy contrary WRWKHLUHQGFRQFOXVLRQWKDWVXFKILUHVDUHVWLOOD&DWHJRU\\LVVXH7KH15&¶VWKUHHFULWHULDIRU
inclusion of an environmental impact in Category 1 are (a) the environmental impacts associated with the issue apply to all plants/plants having a specific site characteristic; (b) a single significance level has been assigned to the impacts, and (c) mitigation of adverse impacts associated with the issue has been considered in the analysis and it has been determined that additional plant-specific mitigation measures are not likely to be sufficiently beneficial to warrant implementation.219 With the Denial of Petition for Rulemaking, the Commission rendered it impossible for the issue of spent fuel storage to fit into the last criterion of Table B-1. As is clear from the above discussion, the Commission relied heavily on mitigative measures, which notably have been imposed at Indian Point, for its conclusion that the environmental impacts of spent fuel storage are insignificant.220 Contrary to the criterion (c) above, not a single one of those mitigation measures was considered in the GEIS. In fact, the Denial of Petition for Rulemaking is apparently the first NEPA document in which they have been identified.221 There are no previous NEPA documents evaluating the effectiveness of any license amendments imposed to reduce the risk of pool fires, nor any NEPA documents assessing cooling capability that were allegedly assessed for all operating spent fuel pools.222 Accordingly, the NRC has effectively removed spent fuel pool impacts from the realm of Category 1, and, accordingly, such impacts must be considered in the instant proceeding.
Moreover, any reliance upon 10 C.F.R. §§ 51.95(c) and 10 C.F.R. § 51.23 is misplaced based on the foregoing. Section 51.95(c) provides that at the license renewal stage, the supplemental EIS IRUDQLQGLYLGXDOSODQW³QHHGQRWGLVFXVVDQ\\DVSHFWRIWKHVWRUDJHRIVSHQWIXHOIRUWKH
facility within the scope of the generic determination in § 51.23(a) and in accordance with § 51.23(b).223 6HFWLRQDH[SODLQVWKDWWKH&RPPLVVLRQ¶VJHQHULFGHWHUPLQDWLRQWKDWVSHQW
fuel can be safely stored for at least 30 years beyond the licensed life for operation,224 and section 51.23(b) explains that because of this generic finding of no significant impact, then
³ZLWKLQWKHVFRSHRIWKHJHQHULFGHWHUPLQDWLRQLQSDUDJUDSKDRIWKLVVHFWLRQQRGLVFXVVLRQRI
218 Letter from John P. Boska, NRC, to Michael A. Balduzzi, Entergy (July 11, 2007), ML071920023; see also Indian Point Unit 3 Operating License, DPR-64, Condition AC, Mitigation Strategy License Condition (July 11, 2007), ML052720273.
219 10 C.F.R. Part 51, Subpart A, Appendix B, Table B-1, note 2; see also Denial of Petition for Rulemaking, 73 Fed. Reg. at 46,206.
220 See Denial of Petition for Rulemaking, 73 Fed. Reg. 46,204.
221 Id. at 46,209-10.
222 Id. at 46,209-10.
223 10 C.F.R. § 51.95(c).
224 See further discussion below about why this generic determination is no longer supportable, necessitating comprehensive review of spent fuel storage impacts generally during the instant relicensing proceeding.
33 DQ\\HQYLURQPHQWDOLPSDFWRIVSHQWIXHOVWRUDJH'LVUHTXLUHGLQDOLFHQVHUHQHZDOSURFHHGLQJ225 However, the mitigative measures the Commission now relies upon to determine that spent fuel VWRUDJHSRVHVQRVLJQLILFDQWLPSDFWVDUHFOHDUO\\QRW³within the scope of the generic determination in paragraph (a)'RIVHFWLRQDQGWKHUHIRUHQHLWKHU&)5FRU
10 C.F.R. § 51.23(a) applies.
Accordingly, the NRC Staff has no lawful basis to refuse to consider the environmental impacts of high-density pool storage of spent fuel in the Indian Point relicensing proceeding. However, despite all of the foregoing, the NRC Staff did not consider the risk of spent fuel pool fire in its 6$0$DVVHVVPHQWLQWKH'6(,6$VVXFKWKH15&6WDII¶V6$0$LVSDWHQWO\\GHILFLHQW
6SHFLILFDOO\\LQWKHILUVWVWHSRI(QWHUJ\\¶VDQDO\\VLVZKLFKWKH15&DFFHSWVDVVRXQGLH
establishing the baseline of severe accidents, Entergy, and the NRC Staff in turn, did not consider the contribution to severe accident costs by a fire in either of the spent fuel pools at IP2 or IP3.226 No SAMAs that would avoid or mitigate such costs have been identified.227 If the costs of pool fires were considered, the value of SAMAs would be significant. Even using unrealistically low probability estimates in NUREG-1353, Regulatory Analysis for the Resolution of Generic Issue 82, Beyond Design Basis Accidents in Spent Fuel Pools (1982), the offsite cost risk of a pool fire is substantially higher than the offsite cost risk of an Early High release from a core-damage accident.228 The present value of cost risk for a conventional pool accident at Indian Point (i.e., an accident not caused by intentional attack), using the unrealistically low probability assumptions in NUREG-1353, is $27.7 million, a significant sum.229 If more realistic assumptions about the likelihood of a pool fire were used, the cost would be considerably higher.230 0RUHRYHUWKHSUHVHQWYDOXHRIFRVWVULVNV³39&5'IRUD
spent fuel pool fire would increase substantially (i.e., from $27.7 million to $38.7 million) if the discount rate were changed from 7% to 3%, a more appropriate rate for an analysis of the benefits of measures to prevent or mitigate radiological accidents that Entergy used to test the sensitivity of its SAMA analysis.231 If the discount rate were dropped to zero, a rate that is justified in light of the catastrophic nature of the consequences involved, the PVCR for a spent fuel pool fire would be even higher -- $51.5 million.232 Based on the foregoing it is clear safety risks due to spent fuel fires and accident mitigation alternatives have not been adequately addressed in the DSEIS. The NRC Staff must factor such risks into its SAMA analysis prior to the end of the environmental review process.
225 See 10 C.F.R. § 51.23.
226 '6(,60DLQ5HSRUW(QWHUJ\\¶V(5DW
227 DSEIS, Main Report § 5.2 228 Thompson Report at 28 229 Id. at 49 and Table 7-7.
230 Id. at 51.
231 Id. at 51-52.
232 Id. at 52.
34
- 3. Failure to Consider the Risk of Reactor Containment Bypass The SAMA analysis in the DSEIS does not adequately take into account the risk of reactor containment bypass.233 The SAMA analysis in the DSEIS seriously underestimates the potential for containment bypass during a core-damage accident. In light of current knowledge about severe reactor accidents, it is prudent to assume that (1) any high/dry accident sequence, (i.e.,
those in which the secondary side dries out due to unavailability of feedwater and the reactor FRRODQWV\\VWHP³5&6'SUHVVXUHUHPDLQVKLJKZKLOHSULPDU\\FRRODQWLHZDWHULVORVWDQGWKH
core is uncovered), would involve induced failure of steam generator tubes, and (2) that one or more of the secondary side safety valves downstream of the affected steam generator(s) would remain open after tube failure.234 Taking these prudent assumptions into account, the conditional probabilities of atmospheric release categories in the event of core damage increase significantly:
the conditional probability of an Early High release rises from 3.6% to 51.8% for the IP2 reactor, and from 8.2% to 54.1% for IP3.235 Correspondingly, the present value of cost risk associated with atmospheric releases increases by a factor of 5.42 for IP2 and a factor of 3.18 for IP3.236
+RZHYHULQWKHILUVWVWHSRI(QWHUJ\\¶VDQDO\\VLVZKLFKWKH15&DFFHSWVDVVRXQGLH
establishing the baseline of severe accidents, Entergy, and the NRC Staff in turn, did not properly consider the contribution to severe accident costs made by severe accidents involving such reactor containment bypass via induced failure of steam generator tubes.237 Because it does not account for the above-PHQWLRQHGDVVXPSWLRQV(QWHUJ\\¶VHVWLPDWHVRIFRQGLWLRQDO
probabilities of atmospheric release categories are incorrectly low.238 Correspondingly, the value Entergy assigned to the cost risk associated with atmospheric releases is mistakenly low.239 As a result, Entergy underestimated the potential value of relevant SAMAs by approximately $47.3 million for IP2 and $23.4 million for IP3.240 If the economic benefit of averted containment bypass accidents were appropriately considered, a number of SAMAs rejected by Entergy as too costly would be cost-effective.241 Since induced accidents involving reactor containment bypass via induced failure of steam generator tubes have not been accounted for, the SAMA analysis in the DSEIS is flawed. The NRC Staff must factor the foregoing into its SAMA analysis prior to the end of the environmental review process.
234 See Thompson Report at 14-18, 50.
235 See id.
236 See id.
237 '6(,60DLQ5HSRUW(QWHUJ\\¶V(5DWSee Thompson Report at 14-18, 50.
238 See Thompson Report at 14-18, 50.
239 See id.
240 See id.
241 See id.
35
- 4. Inadequate Consequence Analysis
/DVWO\\WKH6$0$DQDO\\VLVLVIODZHGEHFDXVHWKH15&6WDIIDFFHSWV(QWHUJ\\¶VLQDGHTXDWH
consequences analysis.242 Entergy grossly miscalculated radiological consequences of severe accidents in performing its SAMA analyses for three reasons,243 none of which the NRC Staff has taken into consideration in the DSEIS.
First, Entergy significantly underestimated off-site costs resulting from a severe accident at Indian Point by using a source term that resulted in unusually low mean off-site accident consequences in comparison to results obtained with source terms vetted by independent experts and recommended for use by the NRC.244 The source term Entergy used to estimate consequences of the most severe accidents with early containment failure was based on radionuclide release fractions generated by the MAAP code, which are smaller for key radionuclides than the release fractions specified in NRC guidance such as NUREG-1465, Accident Source Terms for Light-Water Nuclear Power Plants DQGWKH15&¶VUHFHQW
reevaluation for high-burnup fuel, ERI/NRC 02-202, Accident Source Terms for Light-Water Nuclear Power Plants: High Burnup and MOX Fuels (2002).245 The source term used by Entergy results in lower consequences than would be obtained from NUREG-1465 release fractions and release durations.246 It has been previously observed that MAAP generates lower release fractions than those derived and used by NRC studies, such as NUREG-1150.247 Since (QWHUJ\\¶VXVHRIWKH0$$3FRGH\\LHOGHGORZHUFRQVHTXHQFHVWKDQXVHRIWKH15&¶VVRXUFH
term, Entergy should be required to repeat its SAMA analysis using source terms that are based on publicly available aQDO\\VLV+RZHYHUDUHYLHZRIWKH15&6WDII¶VDVVHVVPHQWRI(QWHUJ\\¶V
6$0$DQDO\\VLVUHYHDOVWKDWWKH\\KDYHQRTXDOPVZLWK(QWHUJ\\¶VVRXUFHWHUPEDVHGRQWKH
MAAP code.248 Second, Entergy significantly underestimated off-site costs resulting from a severe accident at Indian Point because it failed to adequately consider the uncertainties in its consequence calculations resulting from meteorological variations by only using mean values for population dose and offsite economic cost estimates.249 (QWHUJ\\¶VXQFHUtainty analysis for its estimate of the LQWHUQDOHYHQWVFRUHGDPDJHIUHTXHQF\\³&')'XVHVDQLQFRQVLVWHQWDSSURDFKDQGRPLWV
242 5LYHUNHHSHU¶V&RQWHQWLRQ(&-2, filed in the relicensing proceeding, but rejected by the Atomic Safety and Licensing Board raised this issue, which was supported by two expert reports: Edwin S. Lyman Expert Report, A Critique of the Radiological Consequence Assessment Conducted in Support of the Indian Point Severe Accident Mitigation Alternative Analysis 1RY³/\\PDQ,36$0$$QDO\\VLV5HSRUW'(GZLQ6/\\PDQ(xpert Report, Chernobyl on the Hudson? The Health and Economic Consequences of a Terrorist Attack at the Indian Point Nuclear Plant (Sept. 2004), available at http://www.riverkeeper.org/document.php/651/11302007_EL_Lym.pdf ³/\\PDQ&KHUQRE\\ORQWKH+XGVRQ'See Riverkeeper Petition for Hearing at 68-74.
243 See (QWHUJ\\¶V(5
244See Riverkeeper Petition for Hearing at 68-70.
245 See Riverkeeper Petition for Hearing at 68-70; Lyman, IP SAMA Analysis Report.
246 See Riverkeeper Petition for Hearing at 68-70; Lyman, IP SAMA Analysis Report.
247 See Riverkeeper Petition for Hearing at 69; J. Lehner et al., Benefit Cost Analysis of Enhancing Combustible Gas Control Availability at Ice Condenser and Mark III Containment Plants, at 17 (Final Letter Report, Brookhaven National Laboratory, Dec. 23, 2002) (ADAMS Accession Number ML031700011).
248 See DSEIS, Exhibit G.
249 See Riverkeeper Petition for Hearing at 70-71; Lyman, IP SAMA Analysis Report.
36 consideration of the uncertainties associated with other aspects of its risk calculation, including uncertainties associated with meteorological variations, which are found to be greater than the CDF uncertainties.250 It is unreasonable to ignore such variations in the SAMA analysis.251
+RZHYHUWKH15&6WDIIRQFHDJDLQGLGQRWLGHQWLI\\WKLVDVDGHILFLHQF\\ZLWK(QWHUJ\\¶V6$0$
analysiV,QIDFWWKH15&6WDIIVSHFLILFDOO\\IRXQGWKDWWKH³DSSURDFKWDNHQIRUFROOHFWLQJDQG
DSSO\\LQJPHWHRURORJLFDOGDWDLQWKH6$0$DQDO\\VLVLVUHDVRQDEOH'252 Moreover, the NRC Staff VWDWHGWKDWLW³EDVHGLWVDVVHVVPHQWRIRIIVLWHULVNRQWKH&')¶VDQGRIIVite doses reported by (QWHUJ\\'253 Accordingly, the NRC Staff has not addressed this defect in the SAMA analysis.
Third, Entergy significantly underestimated off-site costs resulting from a severe accident at Indian Point by inappropriately using $2,000/person-rem dose conversion factor.254 The
$2,000/person-rem conversion factor is intended to represent the cost associated with the harm FDXVHGE\\UDGLDWLRQH[SRVXUHZLWKUHVSHFWWRWKHFDXVDWLRQRI³VWRFKDVWLFKHDOWKHIIHFWVLHIDWDO
cancers, nonfatal cancers, and hereditary effects.255 The use of this conversion factor in (QWHUJ\\¶V6$0$DQDO\\VLVOHDGVWRDVHULRXVXQGHUHVWLPDWLRQRIWKHSRSXODWLRQ-dose/health related costs of a severe accident at Indian Point.256 This is because it (i) does not take into account the significant loss of life associated with early fatalities from acute radiation exposure WKDWFRXOGUHVXOWIURPVRPHRIWKHVHYHUHDFFLGHQWVFHQDULRVLQFOXGHGLQ(QWHUJ\\¶VULVNDQDO\\VLV
i.e. deterministic effects and (ii) it underestimates the total cost of latent cancer fatalities that would result from a given population dose because it fails to take into account the fact that some members of the public exposed to radiation after a severe accident will receive doses above the threshold level for application of a dose-and dose-rate reduction effectiveness factor
³5()'257 Thus, the single cost conversion factor used is not appropriate when some members of an exposed population receive doses for which a DDREF would not be applied.258 Yet, the N5&6WDIIKDGQRSUREOHPZLWK(QWHUJ\\¶VGRVHFRQYHUVLRQIDFWRU7KH15&6WDII
H[SOLFLWO\\DFFHSWV(QWHUJ\\¶VXVHRIWKHSHUVRQ-rem factor.259 As such, the NRC Staff has failed to address this defect in the SAMA analysis.
The above-discussed deficiencies in the SAMA consequence analysis significantly undervalues the off-site costs of severe accidents.260 (QWHUJ\\¶VHUURQHRXVO\\ORZFRVWHVWLPDWHKDVWKHUHIRUH
led it to underestimate the benefits of SAMAs that would mitigate or avoid the environmental impacts of severe accidents.261 7KH15&6WDII¶VDGRSWLRQRI(QWHUJ\\¶VPHWKRGRORJ\\DQG
250 See Riverkeeper Petition for Hearing at 70-71; Lyman, IP SAMA Analysis Report at 4.
251See Riverkeeper Petition for Hearing at 70-71; Lyman, IP SAMA Analysis Report.
252 DSEIS, Exhibit G, at G-18.
253 DSEIS, Main Report § 5.2.2. at 5-6.
254 See Riverkeeper Petition for Hearing at 68-74; Lyman, IP SAMA Analysis Report.
255 See Riverkeeper Petition for Hearing at 71-74; Lyman, IP SAMA Analysis Report at 5; NUREG-1530, 5HDVVHVVPHQWRI15&¶V'ROODU3HU3HUVRQ-Rem Conversion Factor Policy (1995).
256 See Riverkeeper Petition for Hearing at 73; Lyman, IP SAMA Analysis Report at 6, 10.
257 See Riverkeeper Petition for Hearing at 71-74; Lyman, IP SAMA Analysis Report at 5. The DDREF is a factor that reflects the reduced potency of radiation to cause cancer at low doses or low dose rates. See Riverkeeper Petition for Hearing at 72, n.110.
258 See Riverkeeper Petition for Hearing at 71-74; Lyman, IP SAMA Analysis Report at 5.
259 DSEIS, Exhibit G, at G-28, G-29.
260 See Riverkeeper Petition for Hearing at 68-74; Lyman, IP SAMA Analysis; Lyman, Chernobyl on the Hudson.
261 See Riverkeeper Petition for Hearing at 68-74; Lyman, IP SAMA Analysis; Lyman, Chernobyl on the Hudson.
37 analysis fails to address these concerns. Based on the foregoing concerns, the NRC Staff must address these flaws in the SAMA analysis prior to the conclusion of the NEPA review process.
DSEIS Section 6.0 Inadequate Analysis of Impacts of On-Site Storage of Spent Fuel 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVH[SODLQHGWKHQHHGIRUWKH15&6WDIIWRFRQVLGHU³QHZDQG
VLJQLILFDQW'LQIRUPDWLRQUHJDUGLQJWKHHQYLURQPHQWDOLPSDFWVRIVSHnt fuel storage, rather than relying on the outdated GEIS. Riverkeeper cited to increased security concerns due to terrorism and the failure of a long-term disposal solution as material changes affecting the baseline environment since the GEIS was written.262 Riverkeeper, thus, urged the NRC Staff to assess the future environmental impacts of spent fuel storage in light of these material changes in the Indian Point License Renewal NEPA review process.
However, despite the serious environmental concerns associated with long-term onsite storage of spent nuclear fuel at Indian Point, the NRC Staff has chosen to avoid its responsibilities under NEPA and hide behind the wholly inadequate assessment in the GEIS which has not been updated since 1996, over 13 years ago. Specifically, the NRC Staff states in the DSEIS that it has not identified any new and significant information relating to the finding in the GEIS that
³WKHLQFUHDVHLQWKHYROXPHRIVSHQWIXHOIURPDQDGGLWLRQDO\\HDUVRIRSHUDWLRQFDQEHVDIHOy DFFRPPRGDWHGRQVLWHZLWKVPDOOHQYLURQPHQWDOHIIHFWVWKURXJKGU\\RUSRROVWRUDJHDWDOOSODQWV'
if a permanent disposal solution is not available.263 This finding is completely unjustified.
The finding of small environmental effects from spent fuel storage in the GEIS, upon which the 15&6WDIIUHOLHVVWHPVIURPWKH15&¶VJHQHULF³ZDVWHFRQILGHQFH'GHWHUPLQDWLRQWKDWVSHQW
IXHOFDQEHVDIHO\\VWRUHGRQVLWHIRUDWOHDVW\\HDUVEH\\RQGDSODQW¶VRSHUDWLQJOLIHLQFOXGLQJ
license renewal.264 The NRC Staff explicitly cites to this rule, which was codified at 10 C.F.R. § 51.23(a), to evade any meaningful site-specific environmental analysis of decades of spent fuel storage at Indian Point in the DSEIS.265
+RZHYHUJLYHQ³QHZDQGVLJQLILFDQW'FLUFXPVWDQFHVGHVFULEHGKHUHLQWKH15&¶VJHQHULF
ILQGLQJRIQRVLJQLILFDQWLPSDFWFDQQRWEHUHOLHGXSRQ7KH15&¶VUHDVRQDEOHDVVXUDQFHRIVDIH
interim storage, first instituted over a quarter of a century ago and never supported by an environmental assessment or environmental impact statement under NEPA,266 simply does not hold up given current knowledge and circumstances. Moreover, the NRC recently published a SURSRVHGXSGDWHWRLWV³:DVWH&RQILGHQFH'HFLVLRQ'ZKLFKLIILQDOL]HGZRXOGH[WHQGWKHILQGLQJ
262 See Riverkeeper Scoping Comments at 1, 7-12.
263 DSEIS, Main Report § 6.1 at 6-6 to 6-7.
264 Id. § 6.1 at 6-2, 6-6 to 6-7; GEIS § 6.4.6.3; NRC Staff Scoping Summary Report at 222.
265 NRC Staff Scoping Summary Report at 222; see 10 C.F.R. § 51.23(b) (precluding review of spent fuel storage environmental impacts in any NRC proceeding due to the generic finding of no significant impact).
266 )LQDO:DVWH&RQILGHQFH'HFLVLRQ)HG5HJ³>7@KH&RPPLVVLRQILQGVWKDW1(3$GRHVQRWUHTXLUHDQ
(,6WRVXSSRUWWKH>WHPSRUDU\\VWRUDJH@ILQGLQJ'see also 40 C.F.R. § 1508.9 (explaining that environmental assessments under NEPA should provide sufficient evidence and analysis for determining whether to prepare an EIS or a FONSI).
38 of no significant impact an additional 30 years.267 A concomitant proposed rule change would RPLWDQ\\UHIHUHQFHWRKRZORQJVSHQWIXHOFDQVDIHO\\EHVWRUHGLQ³WHPSRUDU\\'RQ-or off-site facilities, and simply state that such waste can be so temporarily stored without significant LPSDFW³XQWLODGLVSRVDOIDFLOLW\\FDQUHDVRQDEO\\EHH[SHFWHGWREHDYDLODEOH'268 If these changes DUHLPSOHPHQWHGWKH15&¶VJHQHULFILQGLQJRIQRVLJQLILFDQWLPSDFWZLOOHVVHQWLDOO\\EHH[WHQGHG
to some indefinable point in the future. In any event, foregoing any analysis of impacts of GHFDGHVRIVSHQWQXFOHDUZDVWHVWRUDJHEHFDXVHRIWKH15&¶V³ZDVWHFRQILGHQFH' is improper.
7KH15&¶V³FRQILGHQFH'LQH[WHQGHGVDIHWHPSRUDU\\VWRUDJHDWUHDFWRUVLWHVLVODUJHO\\WKHUHVXOW
RIWKH15&¶VH[SHFWDWLRQWKDt a long-term repository will become available eventually.269 However, the viability of Yucca Mountain as a long-term disposal site is becoming more tenuous by the day270 and there is no other foreseeable long-term repository on the horizon. The NRC essentially admits this in rationalizing its proposed update to the Waste Confidence Decision.271 Moreover, if Yucca ever does become available, it will take decades to transfer the spent fuel from Indian Point, and it will not accommodate any of the waste generated by Indian Point during the extended licensing term.272 As such, spent fuel will continue to be stored on-site at Indian Point for the foreseeable distant future.
<HWWKH15&6WDIIUHIXVHVWRFRQVLGHUWKHLPSDFWVRIWKLV³WHPSRUDU\\'VWRUDJHDW,QGLDQ3RLnt, pointing to the generic finding of no significant impact, despite the fact that it is completely GDWHGDQGIDLOVWRFRQVLGHUFXUUHQWFLUFXPVWDQFHV0RVWEODWDQWO\\WKH15&¶VJHQHULFDVVXUDQFH
of benign spent fuel pool storage is completely undermined by the evidence of leaks at Indian Point.273 The IP1 pool began leaking as early as the 1990s, and the leaks from IP2 were discovered in 2005.274 With spent fuel pool degradation already an issue at Indian Point, it is patently absurd to rely on the generic no impact finding to project the long-term integrity of the pools for decades into the future. Given the site-specific situation at Indian Point, a comprehensive environmental impact review of the storage in the pools is necessary during the 267 Waste Confidence Decision Update, 73 Fed. Reg. 59,551, 59551, 59563-2FW³:&'8SGDWH'
268 Proposed Rule on the Consideration of Environmental Impacts of Temporary Storage of Spent Fuel After
&HVVDWLRQRI5HDFWRU2SHUDWLRQ)HG5HJ2FW³3URSRVHG5XOH&KDQJH'
269 Proposed Rule Change, 73 Fed. Reg. at 59549 (referring the WCD Update rationale) (explaining that the original
\\HDUWLPHIUDPHIRUVDIHLQWHULPVSHQWIXHOVWRUDJHZDVUHODWHGWRWKH15&¶VH[SHFWDWLRQRIZKHQVXIILFLHQW
repository capacity would be available).
270 See Riverkeeper Scoping Comments at 7-9; see, e.g., Remarks of Chairman Klein, Feb. 25, 2008, Waste 0DQDJHPHQW6\\PSRVLXPH[SOLFLWO\\VWDWLQJWKDW15&DQG'2(KDYH³LQDGHTXDWHIXQGVWRPHHWWKHLUVWDWXWRU\\
REOLJDWLRQV'UHODWLQJWR<XFFD/LVD0DVFDURYucca Funding: Another $100 Million Cut, Las Vegas Sun (Feb. 27, 2009), available at, http://www.lasvegassun.com/news/2009/feb/23/yucca-funding-another-100-million-cut/
(Obama vowing that Yucca will never open as a nuclear waste repository).
271 Proposed Rule Change, 73 Fed. Reg. at 59549 (explaining how the Commission no longer finds the 30-year timeframe useful since an unknown amount of time will be needed to bring about the necessary societal and political acceptance for a repository site).
272 Riverkeeper Scoping Comments at 7-9.
273 See Liquid Radioactive Release Lessons Learned Task Force Final Report, U.S. Nuclear Regulatory Commission, at 5-6 (September 1, 2006), available at http://www.riverkeeper.org/document.php/539/NRC_Lessons_Lea.pdf KHUHLQDIWHU³5DGLRDFWLYH5HOHDVH7DVN)RUFH
5HSRUW'
274 See (QWHUJ\\¶V(QYLURQPHQWDO5HSRUWDW-4; Groundwater Investigation Executive Summary (Indian Point Energy Center, Buchanan, N.Y., Jan. 2008), available at http://jic.semo.state.ny.us/Resources/ExecutiveSummary%20GW%20final.pdf.
39 relicensing process. Addressing the leaks as the NRC Staff did in the DSEIS is clearly inadequate.275 7KH15&¶VXQEULGOHGconfidence in the safety of dry cask storage is also questionable. As 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVGLVFXVVHGLWLVQRWFOHDUZKDWHQYLURQPHQWDO impacts will result if dry casks remain loaded with spent fuel beyond their design life.276 In light of the fact that these casks will remain on the banks of the Hudson River indefinitely into the future, the NRC Staff must perform a site specific assessment of impacts of such long-term storage.
7KH15&¶VJHQHULFILQGLQJRIQRVLJQLILFDQWLPSDFWDOVRIOLHVLQWKHIDFHRIQHZLQIRUPDWLRQ
about the risks of accidents from natural forces at Indian Point. Numerous reports and studies show that fuel storage pools are potentially susceptible to fire and radiological release from natural phenomena.277 As mentioned above, the environmental impacts of a fire in a spent fuel SRROPD\\EHVHYHUHH[WHQGLQJRYHUDJHRJUDSKLFDUHDODUJHUWKDQDVWDWH¶VOHJDOERXQGDULHVDnd continuing for decades.278 Despite such ominous potential consequences, the NRC Staff completely ignores the vulnerability of stored spent fuel at Indian Point to natural phenomenon, such as earthquakes. This is unwise given recent new information about the likelihood of earthquakes near Indian Point.
6HLVPRORJLVWVDW&ROXPELD8QLYHUVLW\\¶V/DPRQW-Doherty Earth Observatory published a study in August 2008 on earthquakes in the greater New York City Area.279 The study indicated that the Indian Point nuclear power plant sits on a previously unidentified intersection of two active seismic zones.280 Indeed, several recent earthquakes in New Jersey right near the Ramapo fault, which runs directly underneath Indian Point, starkly demonstrate the active nature of the seismic areas around the facility.281 The Columbia study further found that historic activity of earthquakes of a magnitude more than 5 has been higher in southeastern New York than in many other areas of the central and eastern United States, and that the fault lengths and stresses suggest 275 See discussion above regarding inadequate discussion of leaks.
276 See Riverkeeper Scoping Comments at 9-10.
277 See, e.g., NUREG-1738, Final Technical Study of 1 Spent Fuel Pool Accident Risk and Decommissioning Nuclear Power Plants (NRC: January 2001); National Academy of Sciences Committee on the Safety and Security of Commercial Spent Nuclear Fuel Storage, Safety and Security of Commercial Spent Nuclear Fuel Storage (The National Academies Press: 2006); Gordon Thompson, Risks and Risk-Reducing Options Associated with Pool Storage of Spent Nuclear Fuel at the Pilgrim and Vermont Yankee Nuclear Power Plants (May 25, 2006); Jan Beyea, Report to the Massachusetts Attorney General on the Potential Consequences of a Spent-fuel Pool Fire at the Pilgrim or Vermont Yankee Nuclear Plant (May 25, 2006).
278 See generally, Gordon Thompson, Risk-Related Impacts from Continued Operation of the Indian Point Nuclear Power Plants (Nov. 28, 2007), at 18-27, available at, http://www.riverkeeper.org/document.php/652/11302007_GT_Tho.pdf ³7KRPSVRQ5HSRUW'
279 See Lynn R. Sykes, John G. Armbruster, Won-Young Kim, & Leonardo Seeber, Observations and Tectonic Setting of Historic and Instrumentally Located Earthquakes in the Greater New York City-Philadelphia Area, Bulletin of the Seismological Society of America, Vol. 98, No. 4, pp. 1696-$XJXVW³&ROXPELD
(DUWKTXDNH6WXG\\'
280 Id.
281 See, e.g., Lawrence Ragonese, Morris County Shows Signs of Stress: Four Quakes, The Star-Ledger (Feb. 18, 2009), available at, http://www.nj.com/news/index.ssf/2009/02/morris_county_shows_sign_of_st.html.
40 magnitude 6 or 7 quakes (which would be 10 and 100 times bigger than magnitude 5, UHVSHFWLYHO\\DUH³TXLWHSRVVLEOH282 However, despite the availability of such new seismological information, the NRC has never allowHGROGLQIRUPDWLRQXSRQZKLFKQXFOHDUSODQWV¶RULJLQDOOLFHQVHVZHUHEDVHGWREH
contested in considering extensions of licenses.283 There is no certainty whatsoever that the dry casks or spent fuel pools at Indian Point are designed so as to be able to withstand such natural occurrences in light of the new seismic information. Given the recent revelation about the specific seismology surrounding the Indian Point facility, reliance by the NRC Staff on a generic determination of environmental safety for potentially long-term on-site storage of spent fuel is totally inappropriate. The NRC Staff must assess the reasonably foreseeable impacts of continued storage of spent fuel at Indian Point in light of new information about potential accidents from natural forces.
7KH15&6WDIIDOVRUHOLHVXSRQWKH&RPPLVVLRQ¶VJHQHULFVDIHW\\GHWHUPLQDWLRQWRIXUWKHUMXVWLI\\
its refusal to consider the risks to spent fuel storage from intentional acts of sabotage.284 However, the likelihood and seriousness of such risks necessitates a thorough review of the impacts of long-term storage of spent fuel at Indian Point. As discussed at length above, future terrorist attacks at Indian Point remain reasonably foreseeable, and such risks must be fully assessed in the relicensing proceeding.
Spent fuel pools are particularly at risk for intentional attacks and would pose significant environmental consequences should such attacks occur. A 2006 study by the National Academy of Sciences on security risks posed by the storage of spent IXHODWQXFOHDUSODQWVLWHV³1$6
6WXG\\'FRQILUPHGWKDWDWWDFNVE\\FLYLOLDQDLUFUDIWVUHPDLQDSODXVLEOHWKUHDW285 The study found that attacks on spent fuel pools are attractive targets since they are less protected structurally than reactor cores and typically contain much greater inventories of medium and long-lived radionuclides than reactor cores.286 The NAS study concluded that storage pools are susceptible to fire and radiological release from intentional attacks.287 The environmental impacts of a fire LQDVSHQWIXHOSRROPD\\EHVHYHUHH[WHQGLQJRYHUDJHRJUDSKLFDUHDODUJHUWKDQDVWDWH¶VOHJDO
boundaries and continuing for decades.288 Moreover, as discussed above, new studies demonstrate the severe risks of spent fuel pool fires which were not known at the time the NRC LVVXHGLWV³ZDVWHFRQILGHQFH'ILQGLQJV
282 2008 Columbia Study; see also Robert Roy Britt, Large Earthquakes Could Strike New York City (Aug. 21, 2008), available at http://www.livescience.com/environment/080821-new-york-earthquakes.html.
283 2008 Columbia Earthquake Study at 1717.
284 See DSEIS, 0DLQ5HSRUW:&'8SGDWH)HG5HJ7KH15&¶VRYHUDOOJHQHUDOH[FOXVLRQRI
issues relating to terrorism in license renewal proceedings is unwarranted, as discussed above.
285 1DW¶O$FDGRI6FLHQFHVSafety and Security of Commercial Spent Nuclear Fuel Storage: Public Report, at 30
³1$66WXG\\'
286 2006 NAS Study at 36.
287 Id. at 49, 57; see also German Reactor Safety Org., Protection of German Nuclear Power Plants Against the Background of the Terrorist Attacks in the U.S. on Sept. 11, 2001 (Nov. 27, 2002) (finding that large jetliners crashing into nuclear facilities under different scenarios could cause uncontrollable situations and the release of radiation). Although the NRC considers impacts of spent fuel pool fires outside the scope of license renewal review, as discussed at length above, this conclusion is no longer valid.
288 See generally, Thompson Report, supra.
41 0RUHRYHUWKH1$66WXG\\DOVRFRQFOXGHGWKDWWKH³SRWHQWLDOYXOQHUDELOLWLHVRIVSHQWIXHO
pools to terrorist attacks are plant-design specific. Therefore, specific vulnerabilities can be XQGHUVWRRGRQO\\E\\H[DPLQLQJWKHFKDUDFWHULVWLFVRIVSHQWIXHOVWRUDJHDWHDFKSODQW'289 At Indian Point, numerous factors demonstrate the susceptibility of the spent fuel pools to attack, including the fact that the pools are not within containment, but are housed in non-reinforced cinderblock industrial buildings. The fact that the pools are densely packed adds to the risk of catastrophic fire in the event of an attack.290 Given the foregoing, it is essential that the NRC Staff perform a site-specific assessment of long-term spent fuel pool storage.
The dry casks storing spent fuel at Indian Point also present security concerns. Importantly, the dry casks were designed to ensure safe storage of spent fuel, and not to resist terrorist attacks.291 The regulations for such storage systems are designed to ensure passive heat removal and radiation shielding during normal operations, off-normal events, and accidents.292 The 2006 NAS Study found breach of a dry cask from a terrorist attack could potentially result in releases of radioactive material from the spent fuel environment, with offsite radiological consequences.293 Moreover, while the regulations require that dry storage facilities be located within a protected area of the plant site, the protection requirements for such installations are lower than for reactors or spent fuel pools.294 In addition to the foregoing, at Indian Point in SDUWLFXODUWKHGU\\FDVNVLQWKH,QGHSHQGHQW6SHQW)XHO6WRUDJH,QVWDOODWLRQ³,6)6,'DUHVWRUHG
on an outdoor concrete pad, lined up in rows that are easily visible from the air and the Hudson River.
Thus, as currently configured, this ISFSI is potentially vulnerable to sabotage. Given that Entergy intends to continue constructing dry casks in this manner and the fact that the spent fuel generated at Indian Point will remain stored that way for the foreseeable distant future, the NRC 6WDIIPXVWDVVHVVWKHULVNVDVVRFLDWHGZLWKLQWHQWLRQDODWWDFNVRQWKH,6)6,$V5LYHUNHHSHU¶V
Scoping Comments called for, the NRC Staff should consider the mitigation measures recommended by the 2006 NAS Study to reduce the risk of impacts from intentional attacks, including: additional surveillance to detect and/or thwart attacks, creating earthen berms to protect casks from aircraft strikes, placing visual barriers around storage pads to prevent targeting of individual casks, re-spacing the casks to reduce likelihood of cask-to-cask interactions in the event of aircraft attack, and implementing design changes to newly manufactured casks to improve cask resistance to attack.295 Based on the foregoing, a comprehensive site-specific analysis of indefinite on-site spent fuel VWRUDJHDW,QGLDQ3RLQWLVQHFHVVDU\\SULRUWRWKHHQGRIWKH15&6WDII¶VHQYLURQPHQWDOUHYLHZ
process. In light of extensLYH³QHZDQGVLJQLILFDQW'LQIRUPDWLRQWKH15&6WDIIFDQQRWrely upon an outdated, baseless generic finding of no significant impact to avoid its obligations under NEPA.
289 2006 NAS Study.
290 See Thompson Report, supra, at 18-27.
291 See 2006 NAS Study; 10 C.F.R. Pt. 71.
292 See 2006 NAS Study; 10 C.F.R. Pt. 72.
293 See 2006 NAS Study.
294 Id.
295 Riverkeeper Scoping Comments at 11-12; 2006 NAS Study.
42 DSEIS Section 8.0
- 1.,UUHOHYDQFHRIWKH15&6WDII¶VAssessment of Alternatives to the Existing IP2 and IP3 Cooling-Water System As indicated above, the NRC Staff must defer to NYSDEC¶VGHWHUPLQDWLRQVLQWKH63'(6
SURFHHGLQJ7KLVLQFOXGHV1<6'(&¶V assessment of alternatives to once-through cooling at
,QGLDQ3RLQW$VVXFKWKH15&6WDII¶s assessment in the DSEIS of alternatives to the existing IP2 and IP3 cooling-water system is totally meaningless. TKH1<6'(&¶V5XOLQJUHTXLUHV
that a supplemental EIS be prepared to examine the environmental impacts that were not already addressed in the SPDES FEIS for closed cycle cooling, the proposed interim measures, and any alternative technologies that Entergy may propose in order to minimize adverse environmental impact at Indian Point.296 The NRC Staff must defer to the future determinations of NYSDEC relating to cooling-water system alternatives. Problematically, there is no indication whatsoever in the DSEIS WKDW15&6WDIIZLOOGHIHUWRDQGRUFRRUGLQDWHZLWKWKH1<6'(&¶VVXSSOHPHQWDO
EIS, as required by NRC regulations and precedent.297 Moreover the DSEIS also includes a Restoration Alternative in Section 8.1.2 that is unlawful, as the Second Circuit ruled, in its Riverkeeper I and Riverkeeper II decisions. Pursuant to Riverkeeper I and Riverkeeper II ³UHVWRUDWLRQ'DOWHUQDWLYHVERWKDWH[Lsting and new facilities are contrary to the CWA. Therefore, Section 8.1.2 should be stricken in its entirety.
- 2. Deficiencies in Assessment of Alternate Energy Sources
$V5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVGLVFXVVHGWKH15&6WDIILVREOLJDWHGIXOO\\FRQVLGHU the use of alternative energy sources in its analysis of alternatives for Indian Point. NEPA,298 CEQ regulations,299 NRC regulations,300 and Appendix to Part 51 mandate that the full and complete environmental impacts of license renewal of IP2 and/or license renewal of IP3, be compared to the projected impacts of all reasonable alternatives. As delineated in CEQ regulations, the obligations include rigorously exploring and objectively evaluating all reasonable alternatives, devoting substantial treatment to each alternative, and including alternatives not within the jurisdiction of the lead agency.301 0RUHRYHUWKHVFRSHRIWKH15&6WDII¶VUHYLHZHQFRPSDVVHV
the requirements to which the license renewal applicant is held in its Environmental Report, which includHVWKHUHTXLUHPHQWWRFRQVLGHU³QHZDQGVLJQLILFDQWLQIRUPDWLRQ'302 A review of Sections 8.2 and 8.3 of the DSEIS reveals that the NRC Staff has utterly failed to meet this requirement.
296 NYSDEC, 2008 Ruling at 39.
297 10 C.F.R. § 51.70 (c); 40 C.F.R. § 1506.2 (b) and (c); Seabrook, CLI-78-1, 7 NRC at 26 (1978); Entergy Nuclear Vt. Yankee, CLI-07-16, 65 NRC 371, 389 (2007).
298 NEPA, 42 U.S.C. § 4321 et seq.
299 40 C.F.R. § 1502.1.
300 10 C.F.R. §§ 51.45, 51.71, 51.95.
301 40 C.F.R. 1502.14(a) +/- (f).
302 10 C.F.R. § 51.71(a); 10 C.F.R. § 51.53(c)(3)(iv); 10 C.F.R. Part 51, Subpart A, Appendix B; see also 40 C.F.R.
F,UHTXLULQJDVXSSOHPHQWDO(,6LIWKHUHDUH³VLJQLILFDQWQHZFLUFXPVWDQFHVRULQIRUPDWLRQUHOHYDQW
WRHQYLURQPHQWDOFRQFHUQVDQGEHDULQJRQWKHSURSRVHGDFWLRQVRULWVLPSDFWV'
43
- a. Reliance on Outdated Energy Information Administration Reports The DSEIS fails to address significant new information in reliance on outdated energy production and consumption forecasts. The Energy Information Administration of the
'HSDUWPHQWRI(QHUJ\\³(,$'LVVXHVDQQXDOUHSRUWVDQGIUHTXHQWXSGDWHVRQHQHUJ\\SURGXFWLRn, consumption, and prices, the Annual Energy Outlook and associated supplements and updates.
7KH'6(,6VWDWHVWKDW³WKH15&VWDIIXVHVWKH(,$¶VDQDO\\VLVWRKHOSVHOHFWUHDVRQDEOH
DOWHUQDWLYHVWROLFHQVHUHQHZDO'303 The DSEIS, released and dated December 2008, cites and UHIHUHQFHV³$QQXDO(QHUJ\\2XWORRNZLWK3URMHFWLRQVWR'304 ³$VVXPSWLRQVWRWKH
$QQXDO(QHUJ\\2XWORRNZLWK3URMHFWLRQVWR'305 DQG³$VVXPSWLRQVWRWKH$QQXDO
(QHUJ\\2XWORRN(OHFWULFLW\\0DUNHW0RGXOH'306 However, the data and information FRQWDLQHGLQWKHVHDQQXDOUHSRUWVKDYHEHHQVXSHUVHGHGE\\WKH³$QQXDO(QHUJ\\2XWORRN
(DUO\\5HOHDVH2YHUYLHZ'³(,$5HSRUW'307 The 2009 EIA Report provides substantially changed data and information from that considered and referenced in the DSEIS concerning all of the alternative energy sources. For instance, the DSEIS relied on data from 2007 projecting coal-fired electric generation to rise to 32% of all generated capacity.308 By contrast, the 2009 EIA Report adjusts the coal-fired electric generation projection to 24%, no significant increase from 2007, and projects reduced outlook and investment in new coal-fired generating capacity.309 In line with this projection, the 2009 EIA Report projects much lower coal consumption by 2030 than projected even one year ago.
Specifically, the 2009 EIA Report projects: (1) an even greater use of renewable energy than even one year ago, growing at 3.3% annually through 2030; (2) the largest source of growth in the electric power sector to be biomass and wind energy sources; and (3) renewable energy generation growth to 14.1% by 2030, even without a renewal of federal subsidies. Most significantly, the 2009 EIA Report projects that non-hydropower renewable power meets 33% of the total generation growth between 2007 and 2030.310 The DSEIS contains many assumptions about alternative energy sources derived directly from outdated data from EIA reports dating from 2006 and 2007. At a minimum, the DSEIS must select and evaluate any alternative energy source or combination of sources in light of the new and substantially different data and projections from the 2009 EIA Report. The failure of the NRC to amend the data relied upon for the analysis of alternative energy sources would violate the requirements of NEPA. Because NEPA requires an EIS in order to inform the agency of the environmental consequences of its actions, it is critical that the NRC Staff revisit their conclusions in light of the most recent data.
303 DSEIS, Main Report § 8.3, at 8-33.
304 DOE/EIA-0383(2007).
305 DOE-EIA-0554(2006).
306 DOE-EIA-0554(2007).
307 DOE/EIA-0383(2009) (released December 2008, full report available March 13, 2009).
308 DSEIS, Main Report § 8.3, at 8-32.
309 2009 EIA Report, Table 1.
310 AEO2009 Early Release Summary Presentation.
44
- b. Coal-Fired Generation Alternative The DSEIS devotes a majority of consideration of alternative energy sources to a single alternative that presents the arguably least feasible and least environmentally sound alternative to UHOLFHQVLQJ7KLVDQDO\\VLVVHWVXSD³VWUDZPDQ'VFHQDULRWKat skews objective comparisons to the proposed relicensing.
The DSEIS devotes the bulk of analysis of alternative energy sources to an off-site supercritical coal-fired generation source311 despite the fact that no New York-based utility has pending application for new coal generation in Zones H, I, J, and K.312 In contrast, the DSEIS gives short shrift to analysis of other alternatives, in particular, renewable energy sources and conservation.
This analysis and seeming preference to prove the unsuitability of a single coal-fired source comes at the expense of considering a more effective portfolio of alternative energy sources.
Moreover, the analysis of the supercritical coal-fired generation source in the DSEIS fails to satisfy the requirements of NEPA.
The NRC Staff opened its analysis of this alternative by assuming that a new source would have to generate 2200 MW(e) to replace the power produced by Indian Point Units 2 and 3.313 At the outset, this analysis ignores the fact that energy alternatives must also be considered separately.314 The NRC Staff failed to consider the effects of this alternative in place of only one of the units at the Indian point facility. It also failed to include evidence of other, non-coal sources of power generation and conservation when completing its analysis.315 In order to remedy these flaws, the NRC Staff must consider all of the energy alternatives in light of the fact that the license renewal is for two power generating units and with respect to other existing sources and conservation efforts. An analysis of the alternatives must occur for both units together and for each unit separately in order to comply with NEPA.316
- c. Natural Gas-Fired Generation Alternative In its analysis of natural gas-fired combined-cycle generation as an alternative to the license renewal for Indian Point Units 2 and 3, the DSEIS notes that this alternative source operates at
³PDUNHGO\\KLJKHUWKHUPDOHIILFLHQFLHV'DQGUHTXLUHVOHVVZDWHUIRUFRQGHQVLQJFRROLQJWKXV
requiring smaller cooling towers than the existing facility.317 However, in its conclusion about the effects of alternative sources, the NRC Staff concludes that the license renewal would have similar impacts to alternatives.318 Even though the analysis of the natural gas-fired alternative 311 DSEIS, Main Report § 8.3.1, at 8-33 to 8-46.
312 See 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW
Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 31.
313 DSEIS, Main Report § 8.3.1, at 8-34.
314 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVGLVFXVVHGDWOHQJWKWKHQHHGWRDVVHVVUHDVRQDEOHDOWHUQDWLYHVWR,3DQG,3
separately. Riverkeeper Scoping Comments at 15-17 (citing NUREG-1437 vol. 1 §§ 1.2, 1.4, 1.8 (requiring a plant, not plants, specific review and a full analysis of alternatives at individual license renewal reviews.)).
315 See 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW
Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 31.
316 See Riverkeeper Scoping Comments at 15-17.
317 DSEIS, Main Report § 8.3.2, at 8-46.
318 Id. § 8.4, at 8-78.
45 acknowledged significant environmental benefits, the NRC Staff ignored these factors when making a conclusion based on all of the energy alternatives. The NRC Staff cannot ignore their analysis of a natural gas-fired generation alternative when making a general conclusion on the impacts of alternatives subject to the decision not to renew the licenses for Indian Point Units 2 and 3.
Although the DSEIS addresses the fact that Indian Point Units 2 and 3 could be replaced by natural gas-fired combined-cycle generation at the Indian Point site or other locations, the analysis does not go far enough to show the development of natural gas generation in New York.
The DSEIS ignores current construction of natural gas-fired facilities and other new sources that have been planned or permitted.319 Because of this lack of consideration of the existence of and increased reliance on natural gas-fired power generation, the DSEIS is inadequate. In order to fulfill the requirements of NEPA, the NRC Staff should readdress the natural gas-fired generation alternative in order to reflect current information and trends. Currently, without this analysis, the DSEIS is incomplete.
- d. Combination of Alternatives The DSEIS suggests two options in which combinations of energy sources are used.320 Unfortunately, these two combination alternatives are artificially narrow and arbitrary and fail to WDNHLQWRDFFRXQWDGGLWLRQDOFRPELQDWLRQVRIDOWHUQDWLYHVLQYLRODWLRQRI1(3$7KH15&6WDII¶V
shoddy combination assessment in the DSEIS stems from the assumption in the GEIS that the only way to replace a large generating unit like a nuclear power plant is with another similarly large generating unit.321 This assumption is not valid today, as utilities are meeting demand requirements with a broad combination of conservation, innovative modifications to existing plants, and renewable energy, without considering the construction of new fossil-fuel burning facilities.322 $V5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVH[SODLQHGDUHFHQWVWXG\\FOHDUO\\GHPRQstrates that the approximately 2000 MWe generated by Indian Point is replaceable and that if Indian Point were to close, a replacement strategy focusing on conservation, energy efficiency, renewable energy sources, and improving transmission infrastructure, would be technically feasible and achievable with no major disruptions.323 Another study by the Nuclear Research Institute and the Institute for Energy and Environmental Research found that a reliable U.S.
electricity sector is achievable without nuclear power through a combination of conservation and 319 See 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW
Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 32.
320 DSEIS, Main Report § 8.3.5.
321 *(,6³15&KDVGHWHUPLQHGWKDWDUHDVRQDEOHVHWRIDOWHUQDWLYHVVKRXOGEHOLPLWHGWRDQDO\\VLVRIVLQJOH
GLVFUHWHHOHFWULFJHQHUDWLRQVRXUFHV''6(,60DLQ5HSRUWUHO\\LQJRQ15&¶VUHFRPPHQGDWLRQLQWKH*(,6
WKDWFRQVLGHUDWLRQRIDOWHUQDWLYHVVKRXOG³EHOLPLWHGWRVLQJOHGLVFUHWHJHQHUDWLQJRSWLRQV'5LYHUNHHSHU¶V6FRSLQJ
&RPPHQWVIXUWKHUH[SODLQHGWKDWWKLVVWDWHPHQWLQWKH*(,6GRHVQRWFRPSO\\ZLWK1(3$¶VPDQGDWH to assess all reasonable alternatives to the proposed action, nor with NRC regulations mandating that all reasonable alternatives be identified and considered. See 5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVDW-20.
322 See Michael Grunwald, $PHULFD¶V8QWDSSHG(QHUJy Resource: Boosting Efficiency, Time (Dec. 31, 2008),
available at http://www.time.com/time/magazine/article/0,9171,1869224,00.html; EPRI, Assessment of Achievable Potential from Energy Efficiency and Demand Response Programs in the U.S. (2010 +/- 2030) (published Jan. 14, 2009); see also Riverkeeper Scoping Comments at 15-21.
323 See Riverkeeper Scoping Comments at 18-19 (citing NAS, Alternatives to the Indian Point Energy Center for 0HHWLQJ1HZ<RUN¶V(OHFWULFDO3RZHU1HHGV, June 2006, Chapters 1-5).
46 alternative sustainable energy sources.324 Thus, given the feasibility of developing and implementing energy portfolios that include renewable energy sources, conservation, and energy efficiency measures, the NRC Staff should have considered a broader range of alternatives in the
'6(,67KH15&6WDII¶VFRQWLQXHGUHOLDQFHRQWKH*(,6LJQRUHVWKHVLJQLILFDQWSURJUHVVPDGH
RQHQHUJ\\LVVXHVDQGLQWXUQLJQRUHV1(3$¶VPDQGDWHWRIXOO\\FRQVLGHU³QHZDQGVLJQLILFDQW'
information in the supplemental EIS.
In particular, the combination assessment completely ignores the known potential of renewable HQHUJ\\VRXUFHV7KH15&6WDII¶VFRPELQDWLRQDOWHUQDWLYHVUHIOHFWWKH15&¶VDUELWUDU\\EHOLHIWKDW
there are too many obstacles to implementing sufficient wind power or other renewable energy sources such that these sources could not provide anything more than 200 to 400 MW to replace either or both IP units.325 Such beliefs are utterly misguided.326 The NRC Staff also discounts and eliminates any contribution from hydropower or geothermal energy.327 By limiting the FRQVLGHUDWLRQRIHQHUJ\\VRXUFHVLQWKLVPDQQHUWKH15&6WDII¶VFRPELQDWLRQDVVHVVPHQWLW
deficient.
7KH15&6WDII¶VFRPELQDWLRQDOWHUQDWLYHVDOVRODUJHO\\LJQRUHVWKe benefits of energy FRQVHUYDWLRQDQGHIILFLHQF\\7KH15&6WDIIKDVIDLOHGWRFRQVLGHU1HZ<RUN6WDWH¶VORIW\\SODQV
DQGVWHSVWDNHQIRUUHGXFLQJWKHVWDWH¶VHOHFWULFLW\\XVDJHDQGLQFUHDVLQJHQHUJ\\HIILFLHQF\\328 Recent information demonstrates the increasing financial, technical, and political viability of energy conservation.329 However, by incorrectly assuming that energy conservation would only result in a savings of 800 MW, the NRC Staff arbitrarily fails to consider energy conservation as a full replacement for one or both of the units.330
%DVHGRQWKHIRUHJRLQJWKH15&6WDII¶VFRQVLGHUDWLRQRIUHQHZDEOHHQHUJ\\VRXUFHVDQGHQHUJ\\
conservation and efficiency is severely wanting. Since the DSEIS does not adequately analyze the availability and environmentDOLPSDFWVRIDOWHUQDWLYHVWKH15&6WDII¶VDVVHVVPHQWRIWKHQR-action alternative in section 8.2 of the DSEIS is flawed.331 Indeed, the no-action alternative assessment does not consider and analyze much new information about various measures that would be taken if the no-action alternative were chosen, compared to the detriments that would 324 See 5LYHUNHHSHU6FRSLQJ&RPPHQWVDWFLWLQJ,(55³&DUERQ)UHHDQG1XFOHDU)UHH+/- A Roadmap for U.S.
(QHUJ\\3ROLF\\'2FW
325 DSEIS, Main Report § 8.3.5 at 8-65 to 8-66.
326 See generally See 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO
Impact Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 27-28 (citing Report by Synapse Energy Economics, Inc. demonstrating the viability of wind energy and other renewable resources).
327 See DSEIS, Main Report § 8.3.4 at 8-61, 8-62, § 8.3.5, at 8-65, 8-66.
328 See New York State, Public Service Commission, Energy Efficiency Portfolio Standard, http://www.dps.state.ny.us/Phase2_Case_07-M-0548.htm (last visited March 16, 2009); Energy Efficiency Fact Sheet, http://www.ny.gov/governor/press/factsheet_0107092.html; see generally State of New York Contentions
&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW6WDWHPHQW'RFNHW1RV-247-LR and 50-286-LR (filed February 27, 2008) at 23-29; Riverkeeper Scoping Comments at 20.
329 See generally 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO
Impact Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 24-25.
330 DSEIS, Main Report § 8.2, 8.3.5.
331 10 C.F.R. § 51.71; 10 C.F.R. Part 51, Subpart A, Appendix A, Section 4; 40 C.F.R. § 1502.14(a).
47 be caused by relicensing of IP2 and IP3.332 In contrast, the State of New York, with expert support, has laid out examples of combination alternatives using more realistic estimations, which demonstrate that the no-action alternative, i.e., not relicensing IP2 or IP3, is preferable.333 Such combinations would use mostly renewable energy sources coupled with energy efficiency measures and are readily achievable under existing and identified New York State programs.334
/DVWO\\5LYHUNHHSHU¶V6FRSLQJ&RPPHQWVH[SODLQHGWKHQHFHVVLW\\XQGHU1(3$WRFRPSDUH
,QGLDQ3RLQW¶VFXPXODWLYHGHWULPHQWDOFRQWULEXWLRQWRFOLPDWHFKDQJHDQGHQYLURQPHQWDO
degradation to safe and clean renewable energy sources.335 The NRC Staff has not performed such an analysis in the DSEIS.
Overall, tKH15&6WDII¶VDVVHVVPHQWRIHQHUJ\\DOWHUQDWLYHVWR,QGLDQ3RLQWLQWKH'6(,6LV
deficient, and must be fixed prior to the conclusion of the environmental review process under NEPA.
DSEIS Section 9.0 Based on the foregoing, the NRC Staff has demonstrably not performed sufficient analysis to support its preliminary recommendation ³WKDWWKHDGYHUVHHQYLURQPHQWDOLPSDFWVRIOLFHQVH
renewal for IP2 and IP3 are not so great that preserving the option of license renewal for energy planning decisionmakers ZRXOGEHXQUHDVRQDEOH'336 In order to comply with the mandates of NEPA, the NRC Staff must consider and address the foregoing comments before issuing the FSEIS.
Thank you for your consideration.
332 See generally 6WDWHRI1HZ<RUN&RQWHQWLRQV&RQFHUQLQJ15&6WDII¶V'UDIW6XSSOHPHQWDO(QYLURQPHQWDO
Impact Statement, Docket Nos. 50-247-LR and 50-286-LR (filed February 27, 2008) at 22-29.
333 See id. at 33-34.
334 See id.
335 See Riverkeeper Scoping Comments at 20-21.
336 DSEIS, Main Report § 9.3, at 9-8.
48 Sincerely, s/
Phillip Musegaas, Esq.
Hudson River Program Director Riverkeeper, Inc.
828 South Broadway Tarrytown, NY 10591 914-478-4501 (ext. 224) phillip@riverkeeper.org s/
Victor M. Tafur Senior Attorney Riverkeeper, Inc.
828 South Broadway Tarrytown, NY 10591 914-478-4501 (ext. 222) vtafur@riverkeeper.org s/
Deborah Brancato Staff Attorney Riverkeeper, Inc.
828 South Broadway Tarrytown, NY 10591 914-478-4501 (ext. 230) dbrancato@riverkeeper.org
March2009
PiscesConservationLtd
IRCHouse
TheSquare
Pennington
Lymington
Hampshire
SO418GN
UK
pisces@piscesconservation.com
www.irchouse.demon.co.uk
www.piscesconservation.com
Phone: 44(0)1590674000
Fax
44(0)1590675599
CommentsrelatingtotheIndian
PointNRCdraftEISontheCooling
System
P.A.Henderson&R.M.H.Seaby
i 1
Summary.........................................................................................iii 2
Introduction.....................................................................................1 3
ImpingementandEntrainment:Thescoringsystem......................1 3.1 WhiteCatfish...................................................................................2 3.2 Weakfish..........................................................................................4 3.3 Problems with the assessment of the strength of connection
lineofevidence................................................................................5 3.4 Rainbowsmelt.................................................................................7 3.5 Otherspecies...................................................................................8 4
Theageofthedata..........................................................................9 5
ThreatenedandEndangeredSpecies............................................10 6
PotentialMitigationOptionsandCumulativeImpacts.................10 7
Thermalimpacts............................................................................10 8
Conclusion.....................................................................................11 9
References.....................................................................................12
Indexoffigures
Figure1:AcopyofTable44fromNUREG1437.................................................2 Figure 2: The standardised juvenile index for white catfish in the Hudson,
showingadecreasingtrendthoughtime.....................................................3 Figure3:ThestandardisedjuvenileindexforweakfishintheHudsonshowinga
decreasingtrendthoughtime......................................................................4 Figure4:AcopyofTableI32fromNUREG1437...............................................7 Figure5:ThestandardisedjuvenileindexforrainbowsmeltintheHudson......7 Figure6:ThestandardisedjuvenileindexfortomcodintheHudsonshowinga
decreasingtrendthoughtime......................................................................9
ii
iii 1
Summary
This report comments on the US NRC Generic Environmental Impact
Statement for License Renewal of Nuclear Plants Supplement 38: Regarding
IndianPointNuclearGeneratingUnitNos.2and3:DraftReportforComment
issued December 2008 (NUREG - 1437), Environmental Impacts of Cooling
System.Weareonlyconcernedherewithaquaticissues,andtheimpactofthe
plantscoolingsystemonfishandcrustaceansinparticular.Themainimpacts
welookatinthisdocumentareentrainment,impingementandtheeffectof
thethermalplume.
Theassessmentofimpactundertakenontherepresentativeimportantspecies
(RIS) of (17 common fish species and the blue crab) is based on a scoring
systemthatappearscompletelyobjectiveandquantitative.However,detailed
examination of the method shows that it makes assumptions about the
statisticalpropertiesofpopulations,theimpactofcoolingwatersystemson
invertebrates prey species, and the relative importance of local and larger scalechangesinpopulationnumber,thathavenotbeenjustifiedandmaybe
arbitrary.
Aparticularproblemconcernsthescoringmethodusedtoassessthestrength
ofconnection;thisisapoormeasureoftheimpactofthepowerplantonthe
species.Thestrengthofconnectionisaflawedmeasurebecauseitisbasedon
rank abundance, furthermore, the lack of importance given to impacts on
invertebratesmakeslowtomoderatelevelsofimpactformanyspeciesalmost
inevitable.
AnotherconcernisthatthedistinctionbetweenLargeandSmallpopulation
impactsishardtosupportfromanexaminationoftheoverallpopulationtrend
data.
The use of both riverwide and river segment 4 data (where Indian Point is
located),andtheuseofpopulationdeclinecriteriathatincludeameasureof
thedeviationfromthemeanofanormaldistributionproduceresultsthatdo
notnecessarilyreflecttheactualpopulationtrends,andhavethepotentialto
understatetheimportanceofrecentchangesinabundance.
Thecomparisonofspecies'proportionalrankabundanceinthepowerstation
killwiththatlivingintheriverresultsinpotentiallymisleadingconclusions.For
example, the fish that contributes the highest proportion of the number of
individualskilledbythepowerplant,andwhichisalsothecommonestinthe
river, only has a medium strength of connection. In our opinion, such a
situationwhereafishiskilledinhighnumbersandislocallycommonwould
suggestahighdegreeoflinkage.
iv
A number of the RIS species have a prey score for impingement and
entrainment of 1, and thus are unlikely to score highly for the strength of
connection. This feature of the scoring protocol is thus central to the final
outcome.
A key underlying point to note about the analysis of impingement and
entrainmentistherelianceondatacollectedbetween1981and1990.These
dataareoldandmaynotreflectcurrentconditions.
NRC staff concludes that thermal impacts associated with the discharge are
smalltomoderate,principallyonthegroundsthatthereisnoevidenceforthe
scaleoftheimpact.Theassertionthat,becausenoappropriateevidencehas
been collected, there is therefore only a small to moderate impact, is not
logical.
NRC staff state that they cannot determine the effects of climate change,
particularlyinrelationtothermalissues.Webelievetheyshouldhave,atthe
very least,concluded that they needed moredata on thermal issues before
reachingaconclusion.
AlthoughtheNRCdoesnotcometoadefiniteconclusionabouttheeffectof
Indian Point on the sturgeon, they are concerned that they continuing
operationwillhaveadverseeffects.
ThecumulativeeffectsofalltheimpactsontheRiverHudsonareassessedas
large.Thepowerplant,alongwithotherusers,musttaketheirshareofthe
responsibility and undertake to do as little damage a possible to analready
stressedsystem.
v
1 2
Introduction
This report comments upon the US NRC Generic Environmental Impact
Statement for License Renewal of Nuclear Plants Supplement 38: Regarding
IndianPointNuclearGeneratingUnitNos.2and3:DraftReportforComment
issuedDecember2008.WewillrefertothisdocumentbelowasNUREG1437.
Weareonlyconcernedherewithaquaticissues,andtheimpactoftheplants
coolingsystemonfishandcrustaceansinparticular.1
Fishandotherspeciescanbeimpactedinseveralwaysbytheoperationofthe
powerplant.Theycanbeimpinged(caughtonthepowerstationscreens)as
the power station withdraws water from the Hudson, entrained (smaller
organismspassthoughtthepowerstationundergoingseveralstressors),orcan
beeffectedbythethermalplumeproducedbythecoolingwater.
TheNRCmethodofassessingtheaboveimpacthadseveralsteps.
x Identifyingthespeciestobeexamined,
x Examiningwhatevidencetherewasofchangesinpopulationsandhow
usefulitwas.
x Assigning species to Small, Moderate or Large depending on their
potentialtobeeffected.
x AssigningaconnectionofLow,MediumorHigh,dependingonwhether
thespecieswasimpingedorentrainedindifferentnumbersthanthey
werepresentintheriver.
x Combined the potential to be effected with the connection score to
assesstheimpactofIndianPoint.
3 Impingement and Entrainment: The scoring
system
Impingement and entrainment effects are considered together by the NRC.
Thisisanapproachthathasmeritbecausethegoalisthewellbeingofthe
populationsasawhole,andnotparticularageclasses.
Thepossibleimpactofthepowerplantisassessedusingascoringsystemthat
takesintoaccountchangesinspeciesabundance(thetrend)andstrengthof
connection (connection), and which attempts to measure the relationship
betweenabundanceintheenvironmentandinthepowerstationcatch.The
analysisisrestrictedtothe18RISspecies(commonfishspeciesandtheblue
crab).Thechoiceofthesespeciesishistoricandwasdesignedtorepresentthe
overallaquaticresource.Theyhaveallbeenstudiedovermanyyears.TheNRC
staffnote,ashavemanyothersbefore,thattherehavebeennotabledeclining
1NUREG1437,Vol.1,sections2.2.5AquaticResources,4.1CoolingSystem,4.6Threatenedor
EndangeredSpecies,4.8CumulativeImpacts,4.9SummaryofImpactsofOperationsduringthe
RenewalTerm;8.1AlternativestotheExistingIP2andIP3CoolingWaterSystem.
2 trendsinmanyRISfish(seePopulationLineofEvidencecolumninTableshown
inFigure1).InthisrespectNRCstaffagreewithourpreviousanalyses.2
Figure1:AcopyofTable44fromNUREG1437,Vol.1.
Theseriousdeclineinabundanceofmanyspeciesisreflectedinthenumberof
Large classifications in column 2 of the table in Figure 1. We choose two
speciesfromTable44,whitecatfishandweakfish,toillustratethenatureof
these declines. These two species also serve to demonstrate that the
distinctionmadeinTable44betweenLargeandSmallimpactsishardto
supportfromanexaminationoftheoverallpopulationtrenddata.
3.1 WhiteCatfish
The Year Class Reports for the Hudson River Estuary Monitoring Program
showsthat,riverwide,juvenilewhitecatfishhavebeeninasteepdeclinein
abundancesince1990(Figure2).
2 See Status of Fish Populations and the Ecology of the Hudson River and Entrainment,
Impingement and Thermal Impacts at Indian Point Power Station. Copies of these reports
were are provided as Attachments 3 and 4, respectively, to the declaration of Dr. Peter
Henderson,insupportofRiverkeepersrequestforahearingandpetitiontointervenewith
respect to the license renewal proceeding for the Indian Point Nuclear Power Station
(November2007).
3 1970 1980 1990 2000 2010 Index 0.0 0.2 0.4 0.6 0.8 1.0 1.2 White Catfish
Figure2:ThestandardisedjuvenileindexforwhitecatfishintheHudson,showinga
decreasingtrendthoughtime.
Thetrendissignificant(a=0.0136,b=27.216,F=14.0414,p=0.0008)(Seabyand
Henderson,2007)
ItisthereforeunsurprisingthatinTable44(seeFigure1)thepopulationline
of evidence is for a Large potential adverse impact. The trend shown in
Figure2,whichisstatisticallysignificant,certainlyseemstocorrespondwith
thedefinitionofLargegivenonpageH33,NUREG1437,Vol2:
"A LARGE potential for an adverse impact to an RIS population
was determined if population trends had slopes that were
significantly different from zero (i.e., detectable slope) and had
greaterthan40percentofannualabundanceoutsidethedefined
level of noise (i.e., support for potential impact). This response
wasconsideredclearlynoticeable,andanadverseenvironmental
impactwaslikely."
The fact that 40% of the observations lie outside the standardised mean
abundancelevelobservedoverthefirst5yearsofthelongtermstudyisalso
significant.ToquotefrompageH36,NUREG1437,Vol.2:
"Thus, observations outside the boundaries of +/-1 standard
deviation from the mean of the first 5 years were considered
outsideofthenaturalvariability(noise).Ifgreaterthan40percent
ofthestandardisedobservationswereoutsidethisdefinedlevelof
noise, then a potential for adverse impact was considered
supported."
Therearetwoimportantpointstonoteaboutthisdefinition.First,itisbased
on the normal distribution. The abundance of natural populations is never
normally distributed. This brings into question the validity of the method.
4 Second,theapproachisbasedoneventsinthefirst5yearsofthetimeseries.
Ifduringthisperiodthepopulationshowedunusuallygreatvariability,itwould
makeitmuchharder,ifnotimpossible,toscoreforaLargepotentialimpact.
3.2 Weakfish
Like white catfish, weakfish have also shown riverwide a steep decline in
abundancesince1990(Figure3).However,unlikewhitecatfish,forthisspecies
Table44classifiesthepopulationlineofevidenceasSmall.
Year 1970 1980 1990 2000 2010 Index 0.0 0.2 0.4 0.6 0.8 1.0 1.2 Weakfish
Figure 3: The standardised juvenile index for weakfish in the Hudson showing a
decreasingtrendthoughtime.
Thetrendissignificant(a=0.0155,b=31.0218,F=7.0811,p=0.0134)(Seabyand
Henderson,2007)
ASmallpotentialforadverseimpactisdefinedonpageH32vol2as:
"A SMALL potential for an adverse impact to an RIS population
was determined if population trends had slopes that were not
significantlydifferentfromzero(i.e.,nodetectableslope)andhad
40percentannualabundancesfallingoutsideapredetermined
levelofnoise(definedhereas+/1standarddeviationfromthe
mean of the first 5 years of data). This suggested that the RIS
population had not changed detectably over time, and adverse
environmentalimpactswereunlikely."
TheclassificationoftheweakfishpopulationlineofevidenceasSmallinTable
44ifdifficulttounderstandasthereareclearsignsthatthepopulationhas
shownasignificantdecline.Ifthisisso,thepopulationlineofevidenceshould
notbesmall,irrespectiveofthenoiseinthedataset.Theclassificationassmall
seems to arise because the weight of evidence (WOE) score (Table H15,
NUREG1437,Vol.2)assessesriverwide,riversegment4andcoastalscores
5 forpotentialadverseimpact.Riverwidethereisamoderateadverseimpact
assessment;seepH42:
"Analysisofabundanceindexdatasuggestedalargepotentialfor
adversepopulationimpactsforthreeRIS(Americanshad,white
catfish, white perch) and a moderate potential for adverse
impactsforbayanchovy,bluebackherring,Atlantictomcod,and
weakfish)."
However,withinriversegment4theimpactisonlyassessedasSmall.The
finalresultisanoverallSmalllevelofimpact.
Weakfisharemobile,migratorypredatorsthatnevercompletetheirlifecycle
withinriversegment4.Wethereforecanseenojustificationforincludingthe
riversegment4analysesinanassessmentofadversepopulationtrends.
WeconcludethereforethattheWOEscoringsystem,whichusesbothriver wide and river segment 4 data, and uses population decline criteria that
includedeviationfromthemeanofanormaldistribution,producesresultsthat
donotnecessarilyreflecttheactualpopulationtrends,andhavethepotential
tounderstatetheimportanceofrecentchangesinabundance.Examinationof
the riverwide abundance trends for white fish and weakfish indicates that
bothspecieshave,since1990,appreciablydeclinedinabundance.Yetwhile
thedeclineinwhitecatfishisclassifiedasLarge,thatinweakfishisSmall.
Suchdifferencesaremoreareflectionofthearbitrarynatureofthestatistical
andquantitativeapproachtaken,thanarealdifferenceinthestateandhealth
ofthepopulations.
3.3 Problems with the assessment of the strength of
connectionlineofevidence
Incomparisonwiththeevidencefromthetrendsresultinginthepopulation
lineofevidenceshownincolumn2ofTable44(Figure1),thefinalimpact
assessmentintherighthandcolumnonlyshowsalargeeffectforonefish,the
hogchoker.Thereisalsoamoderatetolargeeffectforasinglespecies,white
perch.Thereasonwhysofewofthelargetrendsaretranslatedintoalarge
impactrelatestothestrengthofconnectionmeasureinthethirdcolumnof
thetable.Aconsiderationofthismeasureandhowitiscomputedistherefore
ofkeyimportance.
FromNUREG1437Vol.2(pageH29)wehavethisdescriptionofhowstrength
ofconnectionismeasured.
"Impingement and/or entrainment can also remove and
reintroduce RIS prey into the aquatic system in a manner that
altersfoodwebdynamicsandproducesindirecteffectsthatmay
result in decreased recruitment, changes in predatorprey
6 relationships, changes in population feeding strategies, or
movements of populations closer to or farther away from the
coolingsystemintakesordischarges.Staffbasedtheanalysisof
impingementontheconcordanceoftworankedproportions.The
firstproportionwastheratioofthenumberofYOYandyearling
fish of each species impinged in relation to the sum of all fish
impinged. The second proportion was the ratio of each species
abundance in the river near IP2 and IP3 relative to the total
abundanceofall18RIS.Alargerankforbothproportionswould
mean that the proportion impinged for the given RIS and the
proportionabundanceintheriverwerebothlarge.Theratioof
these two ranks would then be close to 1, suggesting that the
stationary sampler was sampling proportionately to the
abundanceintheriver(amediumstrengthofconnection)."
The first point to note is that the analysis is undertaken by comparing a
speciesproportionalrankabundanceinthepowerstationkillwiththatliving
intheriver.Ratheroddly,afishthatcontributesthehighestproportiontothe
number of individuals killed by the power plant, and which is also the
commonest in the river, only has a medium strength of connection. In our
opinion,suchasituationwhereafishiskilledinhighnumbersandislocally
commonwouldsuggestahighlinkage.Thisisapointthatneedsconsideration
and critical appraisal. The effect is to reduce the assessment of the power
plant'simpactonabundant,commonlycaughtfish.
Thesecondpointtonoteisthataspecieswhichisrankedlesscommoninthe
powerplantkillthanintheriverwillbescoredsmallto moderate.Thekey
point is that the power plant kill may actually reflect the abundance in the
river,howevertherankcoulddeclineifotherspeciesarekilledinunusually
high numbers. Thus, each species is not being fairly assessed on its own
merits.
Wewillnowexaminethegenerationoftheseassessmentsofthestrengthof
connection line of evidence in more detail. Figure 4 shows the Weight of
EvidencefortheStrengthofConnectiontable.
7
Figure4:AcopyofTableI32fromNUREG1437,Vol2,pageI47.
We will illustrate weaknesses with the approach taken using, as above, a
specificexamplefromthelistofRISspecies.
3.4 Rainbowsmelt
Juvenilerainbowsmelthavedisappearedfromthesurveysincethemid1990s
(Figure 5), and it is therefore unsurprising that Table 44 assesses the
populationlineofevidenceasLarge.However,theimpactofIndianPoint2
and3isassessedasmoderatebecausethestrengthofconnectionisassessed
asMedium.
1970 1980 1990 2000 2010 Index 0.0 0.2 0.4 0.6 0.8 1.0 1.2 Rainbow Smelt
Figure5:ThestandardisedjuvenileindexforrainbowsmeltintheHudson.
8
Examination of Table I32 (Figure 4) shows why the overall impact is only
Moderate.Thistableshowsthatboththeimpingementandentrainmentof
rainbow smelt has been appreciable, and entrainment has been given the
highest score possible of 4. However, the strength of connection is only
mediumbecauseboththeimpingementandentrainmentpreyscoresare1.
ThereasonforthisisstatedinNUREG1437,Vol.2pageI41.
"All remaining YOY RIS eat plankton, zooplankton, benthic
invertebrates, and amphipods. These prey were assumed to be
unaffected by the cooling systems, and a low strength of
connectionwasconcluded."
This example demonstrates that an unsubstantiated and unproven
assumption, that invertebrate prey species are not affected by the cooling
watersystem,leadsinturntotheconclusionthattherainbowsmelt,aspecies
whichhaseffectivelydisappearedfromthedatainrecentyearsandhasbeen
assessed as potentially highly impacted by entrainment, is only given a
moderateimpactinTable44.
Before a conclusion of this nature could be justified, the assertion that the
coolingwatersystemhasnoimpactoninvertebratepreyspeciesneedstobe
demonstrated. There is considerable evidence that large numbers of
invertebratesareentrainedandpotentiallykilledbythecoolingwatersystem.
Thereisthereforenoreasontobelievethatinvertebratepreyspeciessuchas
amphipods are not adversely affected. This impact may extend beyond
entrainmenteffectsastheheateddischargewatermayalsoadverselyaffect
them.
3.5 Otherspecies
ExaminationofTableI32(Figure4)showsthatanumberoftheRISspecies
haveapreyscoreforimpingementandentrainmentof1,andthusareunlikely
to score highly for the strength of connection. This feature of the scoring
protocol is thus central to the final outcome. The Atlantic tomcod makes a
telling further example. The tomcod population shows considerable yearto yearvariation,butappearstobeinlongtermdecline(Figure6).Theaverage
standardisedindexfrom1975until1995is0.158;incomparisontheindexfor
thelasttenyearsofsampling(19962005)isonly0.0617.Inthelast10years,
only2001producedagoodrecruitment,althoughtherearesignsofarecent
slightimprovementintomcodnumbers.
9 1970 1980 1990 2000 2010 Index 0.0 0.2 0.4 0.6 0.8 1.0 1.2 Tom Cod
Figure 6: The standardised juvenile index for tomcod in the Hudson showing a
decreasingtrendthoughtime.(SeabyandHenderson,2007)
Whilethepopulationlineofevidenceforadeclineislarge,theinvertebrate
preyofthisspeciesisprimarilyresponsibleforthelowtomediumstrengthof
connectionandthefinalconclusionthattheimpactissmalltomoderate.
4 Theageofthedata
A key underlying point to note about the analysis of impingement and
entrainmentistherelianceondatacollectedbetween1981and1990.These
dataareold,andmaynotreflectcurrentconditions.Further,therearehints
that the NRC staff did wonder if the data reflected present conditions. For
example they noted that the data showed a declining dominance of RIS
species:
Until 1984, the RIS fish made up greater than or equal to 95
percent of all impinged taxa. This percentage has significantly
decreasedatarateof0.8percentperyear(linearregression;n=
16;p=0.002)from1985to1990.
Ifimpingeddatawereavailablefor2008wouldwefindthattheimpingedfish
hadchangedevenmore?Therisksinherentwiththeuseofolddataarenot
addressed.
Itisworthnotingthat,althoughtheimpingementandentrainmentdataare
over17yearsold,thepopulationdatathatshowsthedeclineinsomanyof
thesespeciesiscurrent.Thedifferencesinthepopulationoffishbetweenthe
1990sandthepresentaregreat.
10
5 ThreatenedandEndangeredSpecies
TheNRCstaffreviewthenumberofshortnoseandAtlanticsturgeonthatare
impingedatIndianPoint.Thedatausedtoassesstheimpactareold,andthe
lack of monitoring of impingement means that they do not know if current
impingement rates are similar to those between the 1970s and 1990s. In
addition, they admit that they cannot assess the thermal impact on these
species(page451).GiventheselargeuncertaintiestheNRCstaffcometono
conclusionontheimpactofIndianPointonthesesspecies,givingarangeof
smalltolargeforthefutureimpacts.
6 Potential Mitigation Options and Cumulative
Impacts
In section 4.1.5 the NRC staff state that they believe that the continued
operationofIndianPointwillhaveanadverseeffectontheaquaticsystemof
thelowerHudsonRiver;weagreewiththisstatement.However,theythengo
ontoreviewsomeofthepotentialmitigationmethodsincludingmanythatare
notviablemethodforthisfacility;webelievethisreviewofmitigationoptions
ismeaningless..
Finally, the cumulative adverse impacts of the many factors that affect the
HudsonRiverareconsideredinsection4.8.1.TheNRCstaffconcludethatthe
continuedoperationofIndianPointwillhavealargeimpactonsomeofthe
speciesexamined,andcouldbedetrimentaltotheshortnosesturgeon.They
alsoconsiderthattheeffectsofclimatechangecouldbesubstantialandarean
importantcomponentofthelikelyadverseimpact.
When all the various factors, including the operation of Indian Point, were
considered (p458) the overall effects were considered large. Clearly, the
Indian Point power plant must take its share of the responsibility and
undertaketodoaslittledamageapossibletoanalreadystressedsystem.
7 Thermalimpacts
In NUREG1437, Vol. 1, page 427 NRC staff conclude that thermal impacts
associated with the discharge are small to moderate, principally on the
groundsthatthereisnoevidenceforthescaleoftheimpact:
"Intheabsenceofspecificstudies,andintheabsenceofeffects
sufficienttomakeadeterminationofaLARGEimpacts,theNRC
staffconcludesthatthermalimpactsfromIP2andIP#couldthus
range from SMALL to MODERATE depending on the extent and
magnitudeofthethermalplume,thesensitivityofvariousaquatic
speciesandlifestageslikelytoencounterthethermalplume,and
11 the probability of an encounter occurring that could result in
lethalorsublethaleffects."
The assertion that, because no appropriate evidence has been collected,
thereforethereisonlyasmalltomoderateimpactisnotlogical.
Linkedtothermalimpactsmustbeaconsiderationofclimatechangeimpacts.
ThefollowingconclusionisreachedinH60:
"Thus,theNRCstaffhasconcludedthatthecumulativeeffectsof
climatechangecannotbedetermined."
Wethereforehavetheoddsituationwheretheyarewillingtoconcludethat
thermaleffectsaresmalltomoderateandcanthereforebedismissed,yetthey
cannotdeterminetheeffectsofclimatechange.Webelievetheyshouldhave,
at the very least, concluded that they needed more data on thermal issues
beforereachingaconclusion.
8 Conclusion
TheassessmentofimpactontheRISspeciesisbasedonascoringsystemthat
initiallyappearsobjectiveandquantitative.However,detailedexaminationof
themethodshowsthatitmakesassumptionsaboutthestatisticalpropertiesof
populations, the impact of cooling water systems on invertebrates and the
relative importance of local and larger scale changes in population number,
thathavenotbeenjustified.
Aparticularproblemconcernsthescoringmethodusedtoassessthestrength
ofconnection;thisisapoormeasureoftheimpactofthepowerplantonthe
species.Thestrengthofconnectionisaflawedmeasurebecauseitisbasedon
rank abundance, furthermore the lack of importance given to impacts on
invertebratesmakeslowtomoderatelevelsofimpactformanyspeciesalmost
inevitable.
Thedatareliedontomeasureimpingementandentrainmentisold,andmany
populations have shown marked changes since that period. This brings into
questionthereliabilityoftheconclusionswhenappliedtothefuture.
AlthoughtheNRCdoesnotcometoadefiniteconclusionabouttheeffectof
Indian Point on the sturgeon, they are concerned that they continuing
operationwillhaveadverseeffects.
The cumulative effects of all the impacts on the River Hudson are assed as
large.Thepowerplant,alongwithotherusers,musttaketheirshareofthe
responsibility and undertake to do as little damage a possible to analready
stressedsystem.
12
9 References
Seaby,RMHandHenderson,PA,2007.Thestatusoffishpopulationsandthe
ecologyoftheHudson.PreparedforRiverkeeper,NewYork.