ML13309B013: Difference between revisions

From kanterella
Jump to navigation Jump to search
Created page by program invented by StriderTol
Created page by program invented by StriderTol
Line 15: Line 15:
| page count = 111
| page count = 111
}}
}}
=Text=
{{#Wiki_filter:156 pages follow ENCLOSURE 2 ATTACHMENT 19
SHINE MEDICAL TECHNOLOGIES, INC.
SHINE MEDICAL TECHNOLOGIES, INC. APPLICATION FOR CONSTRUCTION PERMIT RESPONSE TO ENVIRONMENTAL REQUESTS FOR ADDITIONAL INFORMATION DRAFT PHASE I ENVIRONMENTAL SITE ASSESSMENT STEVENS POINT, WISCONSIN FEBRUARY 10, 2012 Aworldcapabilitieslocally
REPORTPHASE I ENVIRONMENTAL SITE ASSESSMENTSHINE MEDICAL STEVENS POINT, WI T23N R8W, SECTION 1 STEVENS POINT, WI 54481SubmittedTo:SHINE Medical Technologies8123 Forsythia St. Suite 140 Middleton,WI 53562 Submitted By:
Golder Associates Inc.
4438 Haines Road
Duluth, MN 55811February 10, 2012Project No. 113-81093 DRAFT Golder Associates 4438 Haines Road Duluth, MN 55811 Ph. 218-724-0088 Fax 218-724-0089 February 10, 2012 Dr. Gregory Piefer/CEO SHINE Medical Technologies
8123 Forsythia St. Suite 140
Middleton, WI  53562 Our Ref: 113-81093 RE: Phase I Environmental Site Assessment P113-81093 SHINE Medical - Stevens Point, WI
Lands End Way
Stevens Point, WI
==Dear Dr. Piefer:==
Golder Associates (Golder) is pleased to present to SHINE Medical Technolgies this Phase IEnvironmental Site Assessment Report for the Subject Property. Information presented in this Report is subject to the general limitations presented in the Report and Golder's Proposal dated December 7,
2011.Golder appreciates this opportunity to assist you with your environmental needs. If you have any questions or comments regarding the information presented in this report, please call our office.
Sincerely, GOLDER ASSOCIATES INC.
Kathryn R Larson Kathryn R Larson Senior Project Geologist Golder Associates DRAFT 2/10/2012 Table of Contents Project No. 113-81093SUMMARY1...............................................................................................................................
.....................
==1.0INTRODUCTION==
2...............................................................................................................................
.....1.1Purpose 2...............................................................................................................................
........1.2Scope of Services 2........................................................................................................................1.3Limitations and Exceptions3
..........................................................................................................1.4Special Terms and Conditions4
.....................................................................................................1.5User Reliance 4..............................................................................................................................2.0PROPERTY DESCRIPTION5
..................................................................................................................2.1Location and Legal Description5
...................................................................................................2.2Site and Vicinity General Characteristics5
.....................................................................................2.3Current Use of the Subject Property5
............................................................................................2.4Description of Structures, Roads, and Other Improvements on the Subject Property5
.................2.5Current Use of Adjoining Properties6
............................................................................................3.0USER PROVIDED INFORMATION7
........................................................................................................3.1Environmental Cleanup Liens7
......................................................................................................3.2Activity and Use Limitations7
.........................................................................................................3.3Relationship of the Purchase Price to the Fair Market Value7
.......................................................3.4Commonly Known or Reasonably Ascertainable Information7
......................................................3.5The Degree of Obviousness or the Presence of Contamination8
.................................................3.6Reason for Conducting ESA8
........................................................................................................4.0RECORDS REVIEW 9..............................................................................................................................4.1Standard Environmental Records Sources, Federal and State9
...................................................4.1.1Subject Property Database Listing9
....................................................................................4.1.2Off-Site Properties Database Listings10
.............................................................................4.1.3Orphans Summary10
..........................................................................................................4.1.4Other Agency Records10
....................................................................................................4.2Additional Environmental Record Sources10
................................................................................4.3Physical Setting Sources10
...........................................................................................................4.3.1Sources Reviewed10
..........................................................................................................4.3.2General Topographic Setting of the Area10
........................................................................4.3.3Geologic and Hydrogeologic Setting10
...............................................................................4.3.4Surface Water and Hydrologic Setting11
............................................................................4.4Historical Use Information on the Subject Property11
...................................................................4.4.1Subject Property Historical Use Summary11
......................................................................4.4.2Standard Historical Records11
...........................................................................................4.5Historical Use Information on Adjoining Properties13
...................................................................5.0SITE RECONNAISSANCE14
...................................................................................................................5.1Methodology and Limiting Conditions14
........................................................................................5.2General Site Setting14
...................................................................................................................5.2.1Current Use of the Subject Property14
...............................................................................5.2.2Past Use of the Subject Property14
....................................................................................5.2.3General Description of Structures14
...................................................................................5.2.4Roads 14..............................................................................................................................5.2.5Potable Water Supply14
......................................................................................................5.2.6Sewage Disposal System14
...............................................................................................
DRAFT 2/10/2012 Table of Contents Project No. 113-810935.3Interior and Exterior Observations15
.............................................................................................5.3.1Storage Tanks15
.................................................................................................................5.3.2Odors 15..............................................................................................................................5.3.3Pools of Liquid15
.................................................................................................................5.3.4Drums 15.............................................................................................................................5.3.5Hazardous Substance and Petroleum Product Containers15
.............................................5.3.6Unidentied Substance Containers15
.................................................................................5.3.7Evidence of Polychlorinated Biphenyls15
...........................................................................5.3.8Heating/Conditioning15
.......................................................................................................5.3.9Stains or Corrosion15
.........................................................................................................5.3.10Drains and Sumps15
...........................................................................................................5.3.11Pits, Ponds, or Lagoons16
..................................................................................................5.3.12Stained Soil or Pavements16
..............................................................................................5.3.13Stressed Vegetation16
........................................................................................................5.3.14Solid Waste Disposal16
......................................................................................................5.3.15Waste Water 16....................................................................................................................5.3.16Wells 16...............................................................................................................................5.3.17Septic Systems16
...............................................................................................................5.3.18Other Interior and Exterior Observations16
........................................................................5.4Off-Site Conditions 16.....................................................................................................................5.4.1Adjoining Properties16
........................................................................................................5.4.2Other Surrounding Properties16
.........................................................................................6.0INTERVIEWS 17...............................................................................................................................
........6.1Overview 17...............................................................................................................................
.....6.2Interview with Owners, Past Owners, Past Operators and Past Occupants17
..............................6.3Interview with Site Manager17
.......................................................................................................6.4Interview with Occupants17
...........................................................................................................6.5Interview with Local Government Ofcials18.................................................................................6.6Interviews with Others18
...............................................................................................................7.0DISCUSSION 19...............................................................................................................................
........7.1Findings and Opinions19
...............................................................................................................7.1.1Recognized Environmental Conditions19
...........................................................................7.1.2Historical Recognized Environmental Conditions19
...........................................................7.1.3De Minimis Conditions19
....................................................................................................7.2Additional Investigation19
..............................................................................................................7.3Data Gaps 19...............................................................................................................................
...
==8.0CONCLUSION==
S 20...............................................................................................................................
....9.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS21
...........................
==10.0REFERENCES==
22...............................................................................................................................
......LIST OF FIGURESFIGURE 1 VICINITY MAP FIGURE 2 SITE MAP LIST OF APPENDICESAppendix A Legal Description of the Subject Property/Chain of Title Report Appendix B Federal and State Regulatory Database Search DRAFT 2/10/2012 Table of Contents Project No. 113-81093Appendix C Historical DocumentationAppendix D Photographs Recorded During the Subject Property Inspection
Appendix E User Questionnaire Appendix F Resumes of Environmental Professionals DRAFT 2/10/20121Project No. 113-81093 SUMMARYSHINE Medical retained Golder Associates Inc. (Golder) to perform a Phase I Environmental SiteAssessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose ofthis Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December
15th, 2011 (the Proposal), and Golder's professional judgment.
This Summary is to be used only in conjunction with the attached Phase I ESA for SHINE Medical, Stevens Point, Wisconsin dated February 2, 2012 (the Report). All definitions used in this Summary have the same meanings as in the Report, and the use of this Summary is subject to the limitations and conditions contained in the Report. The Report shall govern in the event of any inconsistency between
this Summary and the Report.
This assessment has revealed no evidence of RECs in connection with the Subject Property except for the following:
Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and
herbicides is a de minimis condition.
De minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
DRAFT 2/10/20122Project No. 113-8109
==31.0INTRODUCTION==
1.1PurposeSHINE Medical (the User) retained Golder Associates Inc. (Golder) to perform a Phase I EnvironmentalSite Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposaldated December 7, 2011, and Golder's professional judgment. Golder representatives performed the Phase I ESA in conformance with these criteria.The AAI Rule states that the ASTM Standard may be used to comply with the requirements of the AAI Rule, so whenever reference is made in this Report to the ASTM Standard, it shall include the AAI Rule.
The ASTM Standard defines RECs as "the presence or likely presence of any hazardous substances orpetroleum products on a property under conditions that indicate an existing release, a past release, or amaterial threat of a release of any hazardous substances or petroleum products into structures on the property or into the ground, groundwater, or surface water of the property. The term includes hazardous
substances or petroleum products even under conditions in compliance with laws."1.2Scope of Services The scope of services for this ESA consisted of the following tasks:
Records Review
*Reviewing property information to confirm the legal description and location of the Subject Property.
This information is included in Appendix A;*Reviewing environmental record sources including federal and state regulatory databases to identifyfacilities with past or current regulatory enforcement actions within applicable distances of the Subject Property as defined in the ASTM Standard. The regulatory database search report is
presented in Appendix B;*Reviewing physical setting information sources to identify information about the geologic,hydrogeologic, hydrologic, and topographic conditions in the area of the Subject Property. The U.S.
Geological Survey (USGS) 7.5-minute topographic map of the area of the Subject Property is shown on Figure 1;*Reviewing historical record sources to identify past land use activities at the Subject Property andsurrounding properties. Selected historical information obtained during performance of the Phase I
ESA investigation is included in Appendix C.
Site Reconnaissance
*Performing a visual inspection of the Subject Property and surrounding properties to identify potentialsources of chemical and petroleum contamination such as aboveground storage tanks (ASTs),underground storage tanks (USTs), potential sources of polychlorinated biphenyls (PCBs),chemicals, and hazardous materials. Surficial evidence of potential RECs such as distressedvegetation, stained soils, and/or stained paving was also evaluated. Photographs recorded during the site reconnaissance are included in Appendix D.
DRAFT 2/10/20123Project No. 113-81093 Interviews*Interviewing available individuals with knowledge of current or historical use, storage, or disposal ofpotentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. User provided information is included in Appendix E.
Report Preparation
*Preparing a report that documents the findings, opinions, and conclusions of the Phase I ESAinvestigation conducted at the Subject Property, and provides the supporting documentation and references for those findings, opinions, and conclusions (the Report). Resumes for the environmentalprofessionals that performed the assessment and prepared this Phase I ESA Report are included in Appendix F. 1.3Limitations and ExceptionsGolder performed our services in accordance with the following principles, which are an integral part ofthe ASTM Standard: (i) No environmental site assessment can wholly eliminate uncertainty regardingthe potential for RECs in connection with a property. Performance of this ESA is intended to reduce, but not eliminate, uncertainty regarding the potential for RECs in connection with the Subject Property, andthe ASTM Standard recognizes reasonable limits of time and cost; (ii) "all appropriate inquiry" does not mean an exhaustive assessment of a property. Golder performed this ESA in conformance with the ASTM Standard's principle of identifying a balance between the competing goals of limiting the costs and time demands inherent in performing an ESA and the reduction of uncertainty about unknownconditions resulting from additional information; (iii) not every property warrants the same level ofassessment - the type of property subject to the assessment, the expertise and risk tolerance of the user, and the information developed in the course of the inquiry guided the appropriate level of assessment for this ESA; and (iv) ESAs must be evaluated based on the reasonableness of judgments made at the time and under the circumstances in which they were made. Subsequent ESAs should not be considered valid standards to judge the appropriateness of any prior assessment based on hindsight,
new information, use of developing technology or analytical techniques, or other factors.
Along with all of the limitations set forth in various sections of the ASTM E 1527-00 protocol, the accuracy and completeness of this report may be limited by the following:
Access Limitations - None
Physical Obstructions to Observations - Dormant winter vegetation, dense woodland
Outstanding Information Requests - None
Other - None The information and conclusions contained in this report are based upon work undertaken by trained professional and technical staff in accordance with generally accepted engineering and scientific practices current at the time the work was performed. The conclusions and recommendations presented represent the best judgment of Golder based on the data obtained from the work. Due to the nature of investigation and the limited data available, Golder cannot warrant against undiscovered environmental liabilities. Conclusions and recommendations presented in this report should not be construed as legal advice.
Should additional information become available which differs significantly from our understanding of conditions presented in this report, we request that this information be brought to our attention so that
we may reassess the conclusions provided herein. 
DRAFT 2/10/20124Project No. 113-810931.4Special Terms and Conditions No special terms and conditions are applicable to this ESA.1.5User RelianceGolder has prepared this Report at the request of the User for the purpose identified by the User inSection 3.6. Use of the information contained in this Report by anyone other than User is permissible only with the prior written authorization to do so from Golder, and only under the conditions allowed by the ASTM Standard. Golder is not responsible for independent conclusions, opinions, or recommendations made by others or otherwise based on the findings presented in this Report.
DRAFT 2/10/20125Project No. 113-810932.0PROPERTY DESCRIPTION2.1Location and Legal DescriptionTheSubject Property is located at T23N, R8W, Section 1, Stevens Point, WI. The parcel is located onequarter-mile north of County Road HH and  one half-mile west of Burbank Road and is accessed by a private road that extends west from Burbank Road. The square-shaped parcel is comprised of
88.08 acres of land. The Subject Property is located in Section 1, T23N, R8W on the United States Geological Survey(USGS) 7.5-minute, Polonia, WI topographic quadrangle map, as shown on Figure 1. The Assessor'sParcel Numbers for the Subject Property are 020-23-0801-01.04, 020-23-0801-02.02,020-23-0801-02.06, 020-23-0801-03.01, 020-23-0801-03.02, 020-23-0801-04.01, 030-23-0801-13, and 030-23-0801-14.The Subject Property is located at approximately 44 30' 27.45"N and89 29' 41.70"W.
The site layout is shown on Figure 2. According to The City of Stevens Point, the legal description for the Subject Property is a parcel of landlocated in the NE 1/4 of the NE 1/4 of the NE 1/4 of Section 1, T23N, R8W, Town of Hull and Town ofPlover, Marathon and Portage Counties, Wisconsin bounded and described in Appendix A. A copy of the description is included in Appendix A.2.2Site and Vicinity General CharacteristicsThe Subject Property is located on the eastern edge of Stevens Point, WI . The adjacent properties to the north, south, and east of the Subject Property are rural, consisting of agricultural and forest land and,according to aerial photographs, has been agricultural and forest land since at least 1938. The adjacent properties to the west of the Subject Property are developed as industrial and residential areas.
Development to the west of the Subject Property has occurred recently with the adjacent property being developed after 1998. A rail line exists within one quarter-mile to the north of the Subject Property. The
rail line has been north of the Subject Property since at least 1938. 
The topographic gradient is low and gently slopes to Portage River and McDill Pond located approximately 2 miles to the southwest. 2.3Current Use of the Subject Property The Subject Property is used for agriculture and forestry. No buildings exist on the property.
Pesticides and herbicides are applied to the agricultural areas of the Subject Property bi-annually. No hazardous substances or petroleum products are stored, generated, or disposed of on site.
Selective tree harvesting has occurred on the wooded portions of the parcel. 2.4Description of Structures, Roads, and Other Improvements on the Subject PropertyNo structures exist on the Subject Property. 
A private access road extends west from Burbank Road through the subject property. 
A private trap shooting range located near the center of the Subject Property is used approximately twice a year. 
Residences and businesses in the vicinity of the Subject Property are served by municipal water from the city of Stevens Point Wisconsin. Wastewater in the vicinity of the Subject Property is handled by the
City of Stevens Point Wastewater Treatment system.
DRAFT 2/10/20126Project No. 113-810932.5Current Use of Adjoining Properties The adjoining property uses are described below:
North - Agriculture and woodland. A rail line exists just north of these parcels.
East -  Agriculture and woodland.
South - Agriculture and woodland.
West - Industrial Park. A Land's End Inlet occupies the adjoining parcel.
DRAFT 2/10/20127Project No. 113-810933.0USER PROVIDED INFORMATIONThe ASTM Standard defines User as the party seeking to use Practice E 1527 to complete an ESA ofthe Subject Property. The ASTM Standard requires the User to provide certain information to theenvironmental professional. Golder has provided a User Questionnaire to SHINE Medial to facilitate the transfer of this information to Golder. Dawn Sovinec of SHINE Medical completed the User Questionnaire and provided it to Golder on December 21st, 2011. A copy of the completed User
Questionnaire is included in Appendix E. 3.1Environmental Cleanup LiensGolder representatives asked the User about their knowledge of environmental cleanup liens against the
Subject Property that are filed or recorded under federal, tribal, state or local law. The User replied:
User has no knowledge of environmental cleanup liens on the Subject Property.3.2Activity and Use LimitationsGolder representatives asked the User about their knowledge of activity and use limitations (AULs),such as engineering controls, land use restrictions or institutional controls that are in place on theSubject Property or have that been filed or recorded in a registry under federal, tribal, state or local law.
The User replied:
User has no information regarding activity or land use limitations at the Subject Property.3.3Relationship of the Purchase Price to the Fair Market ValueGolder representatives asked the User if the purchase price being paid for this property reasonably reflects the fair market value of the property. The User replied:
User believes the purchase price being paid for the Subject Property reasonably reflects the fair market value of the property. 3.4Commonly Known or Reasonably Ascertainable InformationGolder representatives asked the User if they were aware of commonly known or reasonably ascertainable information about the Subject Property that would assist the environmental professional inidentifying conditions indicative of releases or threatened releases. Golder representatives asked the following questions:
a) Do you know the past uses of the Subject Property?  The User replied: 
The User knows that the Subject Property has been used as an agricultural field and that selective tree harvesting/logging has occurred on the wooded portions of the parcel, and is being used for such purposes currently.b) Do you know of specific chemicals that are present or once were present at the Subject Property?
The User replied:
The User has no information regarding specific chemicals that are, or once were, present at the Subject
Property.c) Do you know of spills or other chemical releases that have taken place at the Subject Property?  The User replied:
The User knows of no spills or other chemical releases that have taken place at the Subject Property.
DRAFT 2/10/20128Project No. 113-81093d) Do you know of any environmental cleanups that have taken place at the Subject Property?  The User replied:
The User knows of no environmental cleanups that have taken place at the Subject Property. 3.5The Degree of Obviousness or the Presence of ContaminationGolder representatives asked the User if, based on User's knowledge and experience related to theSubject Property, there are any obvious indicators that point to the presence or likely presence of contamination at the Subject Property. The User replied:
The User has no information regarding contamination on the Subject Property. 3.6Reason for Conducting ESAThe User indicated the ESA is being conducted as part of a property transfer and financing, to satisfy one of the conditions required for landowner liability protection (LLP) under CERCLA.
DRAFT 2/10/20129Project No. 113-810934.0RECORDS REVIEW4.1Standard Environmental Records Sources, Federal and StateGolder retained Environmental Data Resources (EDR) to perform an environmental regulatory databasesearch of the general area of the Subject Property, which is presented in Appendix B. In accordance with the search requirements of ASTM E-1527-05 Standard, Golder representatives reviewed the federal and state regulatory agency records listed below to identify the use, generation, storage, treatment or disposal of hazardous substances or petroleum products, or release incidents of such materials that might impact the Subject Property. A summary of significant listings (Subject Property and adjacent properties with the potential to impact the Subject Property) presented in the environmentalregulatory database report is presented below. The following is a listing of databases reviewed during the Phase I ESA.
Federal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance Federal NPL (National Priorities List)1.0 mileFederal delisted NPL site list0.5 mile Federal Comprehensive Environmental Response,
Compensation and Liability Information System
(CERCLIS) site list 0.5 mileFederal CERCLIS-No Further Remedial Action Planned (NFRAP) site list 0.5 mileFederal Resource Conservation and Recovery Act (RCRA) CORRACTS (Corrective Action Report) facilities list 1.0 mileFederal RCRA non-CORRACTS Treatment Storage and Disposal (TSD) facilities list 0.5 mileFederal RCRA Generators listSubject Property and adjoining properties Federal Institutional Control/Engineering Control Registries Subject Property Federal Emergency Response Notification System (ERNS) list Subject Property State and Tribal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance State and tribal hazardous waste sites identified
for investigation or remediation: NPL - equivalent sites1.0 mileState and tribal hazardous waste sites identified for investigation or remediation: CERCLIS -
equivalent sites 0.5 mileState and tribal landfill and/or solid waste disposal site list 0.5 mileState and tribal leaking storage tank lists0.5 mileState and tribal registered storage tank listsSubject Property and adjoining properties State and tribal Institutional Control/Engineering Control Registries Subject PropertyState and tribal voluntary cleanup sites0.5 mileState and tribal Brownfield sites0.5 mile4.1.1Subject Property Database Listing The Subject Property is not listed on any of the databases listed in the EDR database report.
DRAFT 2/10/201210Project No. 113-810934.1.2Off-Site Properties Database ListingsNo off-site facilities were identified in the environmental database report that are considered potential environmental concerns to the Subject Property.4.1.3Orphans SummaryThirteen facilities listed in the EDR Report were shown as "orphan sites."  These are sites that are listedin environmental databases, but which EDR has been unable to locate with adequate precision to determine whether they are pertinent to the investigation at the Subject Property. Golder was able todetermine to a reasonable degree of certainty that these orphan sites were not listed on databases that indicated environmental impairment and/or were not within the specified database search distances. 4.1.4Other Agency Records No other agency records were reviewed for this Phase I ESA.4.2Additional Environmental Record SourcesGolder representatives did not review additional environmental record sources as part of this Phase I
ESA.4.3Physical Setting Sources4.3.1Sources ReviewedThe USGS 7.5-minute Polonia, WI topographic map was reviewed in order to obtain information regarding the topographic, geologic, hydrogeologic, and hydrologic characteristics of the area of the Subject Property. In the sections below (4.3.2 through 4.3.4), topographic conditions are noted to the extent that they can be determined from review of topographic maps, or were visually and/or physically observed during the Site visit.4.3.2General Topographic Setting of the AreaBased on the site reconnaissance, the EDR Radius Map with GeoCheck and information provided onthe USGS Polonia, Wisconsin, 7.5 Minute Series Topographic Maps, the Subject Property is
characterized by low topographic relief, lying approximately 1090 feet above mean sea level. 4.3.3Geologic and Hydrogeologic SettingGolder installed four groundwater monitoring wells at the Subject Property in December of 2011 (Figure 2). Based on Golder's 2012 Geotechnical and Hydrological Investigation of the site the soil conditions indicated by the boreholes is about one foot of topsoil and crop residue overlying a medium to coarsegrained, silty SAND nding to depths of 9 to 14 feet. Below this is a relatively clean, medium to coarsegrained, SAND with silt to the borehole termination depth of 31 feet. One borehole was advanced without sampling to a depth of 140 feet adjacent to SM-GW3A. This borehole was intended for a well installation into bedrock and bedrock was not encountered within 140 feet of the urface. Groundwater was encountered in all of the wells at elevations ranging from about 1096 to 1106 (about 8 to 11 feet below grade) as indicated in the table below. Groundwater levels should be expected to fluctuate
seasonally and annually with changes in precipitation patterns.
DRAFT 2/10/201211Project No. 113-810934.3.4Surface Water and Hydrologic SettingSurface water runoff in the vicinity of the Subject Property is to the southwest toward the Portage River and McDill Pond. The Portage River flows to the Mississippi River to the Southwest.4.4Historical Use Information on the Subject Property4.4.1Subject Property Historical Use SummaryLand adjacent in to the Subject Property has supported agriculture and forestry since at least 1938.
Sometime between 1998 and 2005, a business park has developed to the west of the Subject Property.4.4.2Standard Historical Records4.4.2.1Aerial Photographs ReviewGolder representatives obtained historical aerial photographs from Historical Information Gatherers, Inc.for the years 2010, 2005, 1998, 1992, 1986, 1978, 1968, 1960, 1953, and 1938. Selected historicalaerial photographs are provided in Appendix C. The following table summarizes observations from the
review of these aerial photographs.YearScaleDescription19381" = 500'The Subject Property and surrounding area is a mix of woodlands and argicultural land. A railroad appears to run east west approximately 700 feet north of the Subject Property.19531" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 photograph. 19601" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 and 1953 photographs. 19681" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953 and 1960 photographs. 19781" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960 and 1968
photographs.19861" = 800'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968 and 1978
photographs.19921" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978 and 1986 photographs.19981" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978, 1986
and 1992 photographs. 20051' = 500'The Subjecr Property and surrounding area appear unchanged from the previous photographs except that the edge of a business park is visible just west of the Subject Property.20101" = 500'The Subject Property and surrounding area appears relatively unchanged from the 2005 photograph.4.4.2.2Sanborn Fire Insurance Map ReviewGolder representatives requested historical Sanborn© Fire Insurance Maps from Environmental Data Resources, Inc. Golder was informed that Sanborn© maps were not developed for the area surrounding
the Subject Property. A copy of the "No Coverage" document is included in Appendix C.
DRAFT 2/10/201212Project No. 113-810934.4.2.3Property Tax Files Golder representatives obtained Subject Property Tax records for the County Parcel ID Nos:
Parcel ID Number 020-23-0801-02.06- Owner = Thomas Mocadlo and Margaret Jakusz
020-23-0801-03.01- Owner = Thomas Mocadlo and Margaret Jakusz
020-23-0801-02.02- Owner = Thomas J. and Sandra M. Mocadlo
020-23-0801-01.04- Owner = Bernard Mocadlo
020-23-0801-04.01- Owner = Bernard Mocadlo 020-23-0801-03.02- Owner = Blue Top Farms, Inc.
030-23-0801 Owner = Blue Top Farms, Inc.
030-23-0801 Owner = MS & S Enterprises Limited Partnership
Copies and parcel maps are  provided in Appendix A.
The property tax records did not indicate records of past ownership, appraisals, maps, sketches, photos, or other information pertaining to the property. 4.4.2.4Recorded Land Title Records Title documents were not obtained for this Phase I ESA. 4.4.2.5Historical Topographic Map ReviewGolder representatives obtained historical USGS topographic quadrangle maps from EnvironmentalData Resources, Inc. for the years 1955, 1957, 1969, 1970, 1976, 1978, 1980, 1986, and 1991. Copies of the historical topographic maps are provided in Appendix C. The following paragraphs summarize our
observations from the review of these historical topographic maps.YearScaleDescription19551:48000A portion of the Subject Property is visible in the southwest corner of the topographic map. An elecric tranmission line
runs near the southern boundary of the Subject Property.
The Minneapolis, St. Paul and Sault Ste Marie Rail Line is
visible north of the Subject Property.19691:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.19861:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.4.4.2.6Local Street DirectoriesLocal Street Directories from EDR were requested. The Subject Property address was not included in the city directory listing.4.4.2.7Building Department Records No building records pertaining to the Subject Property were available.4.4.2.8Zoning and Land Use RecordsGolder used the Portage County Geographic Information Systems (GIS) Map to review a property profile for the Subject Property. Information indicated that the Subject Property is zoned A1 for agricultural use.
DRAFT 2/10/201213Project No. 113-810934.4.2.9Other Historical Records No additional historical records were reviewed during this assessment. 4.5Historical Use Information on Adjoining PropertiesThe following is a summary of historical use information for adjacent properties based on informationobtained from the Subject Property visit, a review of historical topographic maps and previous ESA
reports for the Subject Property:
The adjacent properties were all agricultural and woodland since at least 1938. The rail line presentnorth of the Subject Property was operational since at least 1938 and has been operated by at least two railroads. An electrical transmission line has run near the southern boundary of the Subject Property since at least 1938. A business park was built west of the Subject Property some time between 1998 and 2005.
DRAFT 2/10/201214Project No. 113-810935.0SITE RECONNAISSANCEGolder representative Alexandra A. Prasch performed a visual assessment of the Subject Propertyon December 15th, 2011 to identify potential sources of chemical and petroleum contamination. The Golder representative assessed surficial evidence of potential impacts such as waste or refuse dumping, distressed vegetation, stained soils, and/or stained paving. Photographs recorded during the site
assessment are presented in Appendix D.5.1Methodology and Limiting ConditionsThe site reconnaissance was conducted during the period of December 15th - December 17th, 2011 by Alexandra Prasch, Environmental Technician with Golder Associates. Weather conditions at the time of the site reconnaissance were sunny, partly cloudy, and windy. The visual reconnaissance consisted of observing the boundaries of the property and systematically traversing the site to provide an overlapping field of view, wherever possible. Portions of the property and boundaries were inaccessible due to heavily wooded land and brush. Photographs of pertinent site features identified during the site
reconnaissance are included in Appendix D. 5.2General Site SettingThe Subject Property consists of approximately 88.08 acres of farmland and forest with no buildings, utilities, or other developments. The ground surface at the site is level and slopes gently to the southwest. The Subject Property is accessed from a private road extending west from Burbank Road.5.2.1Current Use of the Subject Property Information about the current use of the Subject Property is detailed in section 2.3 of this report. 5.2.2Past Use of the Subject PropertyThe Subject Property has been used for agricultural and forestry purposes since 1938 or before. The
use of the Subject Property prior to 1938 is unknown. 5.2.3General Description of Structures No structures were observed on the Subject Property.5.2.4RoadsThere are no public roads through or leading to the Subject Property. A private access road extends to
and through the Subject Property from Burbank Road.5.2.5Potable Water Supply Currently the Subject Property has no potable water supply. 5.2.6Sewage Disposal System There is no sewage disposal system within the Subject Property.
DRAFT 2/10/201215Project No. 113-810935.3Interior and Exterior ObservationsGolder identified current or past uses likely to involve the use, treatment, storage, disposal or generationof hazardous substances or petroleum products, to the extent they were visually and/or physicallyobserved during the Subject Property visit or identified from the interviews or the records review. The substances and approximate quantities, types of containers (if any) and storage conditions are
discussed in the following subsections.5.3.1Storage TanksGolder observed no evidence of underground or aboveground storage tanks at the Subject Property at
the time of the site visit.5.3.2Odors Golder observed no unusual odors at the Subject Property at the time of the site visit. 5.3.3Pools of Liquid Golder observed no pools of liquid at the Subject Property at the time of the site visit.5.3.4Drums Golder observed no drums at the Subject Property at the time of the site visit. 5.3.5Hazardous Substance and Petroleum Product Containers Golder observed no hazardous substance or petroleum product containers at the Subject Property at the
time of the site visit. 5.3.6Unidentified Substance Containers Golder observed no unidentified substance containers at the Subject Property at the time of the site visit. 5.3.7Evidence of Polychlorinated Biphenyls Golder observed no evidence of polychlorinated biphenyls.5.3.8Heating/Conditioning The Subject Property is undeveloped. No heating or air conditioning systems were present. 5.3.9Stains or Corrosion Golder observed no evidence of stains or corrosion at the Subject Property at the time of the site visit.5.3.10Drains and Sumps Golder observed no drains or sumps on the Subject Property at the time of the site visit.
DRAFT 2/10/201216Project No. 113-810935.3.11Pits, Ponds, or Lagoons Golder observed no pits, ponds, or lagoons on the Subject Property at the time of the site visit.5.3.12Stained Soil or Pavements Golder observed no stained soil or pavements at the Subject Property at the time of the site visit.5.3.13Stressed Vegetation Golder observed no stressed vegetation at the Subject Property at the time of the site visit.5.3.14Solid Waste DisposalNo readily apparent evidence of solid waste dumping, suspect fill material, or landfills was identified on the Subject Property during the site reconnaissance.5.3.15Waste WaterGolder observed no evidence that industrial waste water is generated or discharged from the Subject
Property at the time of the site visit. 5.3.16Wells Golder observed no evidence of wells at the Subject Property at the time of the site visit.5.3.17Septic Systems Golder observed no evidence of septic systems at the Subject Property at the time of the site visit.5.3.18Other Interior and Exterior Observations Golder made no other interior or exterior observations of the Subject Property during the site visit.5.4Off-Site ConditionsThe following two sections discuss the off-site observations, to the extent that the current uses of the adjoining properties were observable during the Subject Property reconnaissance, and were likely to
indicate an REC in connection with the adjoining properties or the Subject Property.5.4.1Adjoining PropertiesGolder did not observe any evidence of RECs on adjoining properties from the Subject Property during
the site visit.5.4.2Other Surrounding PropertiesTheadjacent properties were observed to be a business park, forested land and agricultural land duringthe site visit. There were no indications of RECs noted on other surrounding properties during the site visit. DRAFT 2/10/201217Project No. 113-810936.0INTERVIEWS6.1OverviewDuring the completion of this Phase I ESA, available individuals were interviewed with knowledge ofcurrent or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. Information provided is summarized throughout
the text of the report and in the following sections.6.2Interview with Owners, Past Owners, Past Operators and Past OccupantsGolder interviewed the owners identified in section 4.4.2.3 of the report. Interviews were conducted via telephone call. Phase I ESA Interview forms summarizing the interviews are available for review in the
Golder file. 
Thomas Mocadlo, owner of parcels 020-23-081-02.02, 020-23-081-02.06 and 020-23-801-03.01, indicated that he purchased the property around 1985 for the purpose of hunting and gatheringfirewood. His brother Bernard owns other parcels that are part of the Subject Property. He was notaware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject
Property, but they have not been stored on the Subject Property. 
Bernard Mocadlo, owner of parcels 020-23-0801-04.01 and 020-23-1.04, indicated that he has ownedthe property for 54 years and farmed the property for 30 years. The land has been used for potato,sweet corn, pea and vegetable crops. He was not aware of any solid or liquid wastes that have beenhandled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the
Subject Property. 
Curt Soik, owner of parcel 030-230-0801-1.13, indicated that he purchased his parcel in 1962 from a farmer. His parcel has been used for growing of corn and other vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicatedthat small amounts of pesticides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. 
Peter Zakrzewski, President of Blue Top Farms and owner of parcels 030-230-801.14 and 020-230-801-03.02, indicated that he is the son of the original owner (J. James Zakrzewski). His father purchased the property 30 years ago. Peter has been the Vice President of Blue Top Farms for the last 10 years. The property has been used for corn, green bean, soy bean and potato crops. He rented aportion of the parcels he owns to a potato farmer in the past. He believed liquid manure was handled in the southwest corner of the parcels he owns in the past, but has not been used in the last two years. He indicated that pesticides and herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. He does maintain a private shooting range on the
parcels that he owns. He uses the shooting range no more than a few times a year. 6.3Interview with Site Manager Golder did not interview a Site Manager for the Phase I ESA.6.4Interview with Occupants Golder did not interview Occupants for the Phase I ESA.
DRAFT 2/10/201218Project No. 113-810936.5Interview with Local Government Officials Golder did not interview Local Government Officials for the Phase I ESA.6.6Interviews with Others Golder did not interview Others for the Phase I ESA.
DRAFT 2/10/201219Project No. 113-810937.0DISCUSSIONThis section identifies the known or suspect RECs, historical RECs, and de minimis conditions identified during the assessment.7.1Findings and Opinions7.1.1Recognized Environmental Conditions No Recognized Environmental Conditions were identified during this assessment.7.1.2Historical Recognized Environmental ConditionsAn HREC is an environmental condition which, in the past, would have been considered a REC, butwhich may or may not be considered a REC currently. Golder's rationale for considering these environmental conditions as HRECs is based solely on the information stated herein. Designation as an
HREC however, does not preclude the potential for the condition to affect the Subject Property.
No Historical Recognized Environmental Conditions were identified during this assessment. 7.1.3De Minimis ConditionsDe minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored
on the Subject Property in the past. 
OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcementaction if brought to the attention of appropriate governmental agencies. The use of pesticides and
herbicides is a de minimis condition. 7.2Additional Investigation No additional investigation is indicated based on the information gathered during this assessment.7.3Data GapsA Data Failure occurs when all of the standard historical sources that are reasonably ascertainable and likely to be useful have been reviewed and yet the objectives have not been met. Some Data Failures may comprise Data Gaps. A Data Gap is defined as the lack of or inability to obtain information requiredby the ASTM Standard despite good faith efforts by the EP to gather such information. A significant data gap occurs when a data gap impacts the ability of the EP to identify RECs.
Golder representatives did not identify significant data gaps during this assessment.
DRAFT 2/10/201220Project No. 113-8109
==38.0CONCLUSION==
SGolder performed a Phase I ESA of the property located at T23N, R8W, Section 1, Stevens Point, WI inconformancewith the scope and limitations of the ASTM Standard. Any exceptions to, or deletions from,the ASTM Standard are described in the appropriate sections of this Report. This assessment has
revealed no evidence of RECs in connection with the Subject Property except:
Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and
herbicides is a de minimis condition.
De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an
enforcement action if brought to the attention of appropriate governmental agencies.
DRAFT 2/10/201221Project No. 113-810939.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALSAlexandra Prasch, Geologist in Training, Level 1 Environmental Technician with 2 years of professionalexperience, conducted the site visit. Kathryn Larson, Senior Project Geologist with 15 years of experience, prepared this Report, and Amy Thorson, Senior Engineer with 20 years of professional experience, served as the senior reviewer of the Report. Resumes for members of the project team are
included in Appendix F.
"We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental Professional as defined in Section 312.10 of 40 CFR Part 312.
We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject Property. We have developed and performed the all
appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312."
GOLDER ASSOCIATES INC.
DRAFT 2/10/201222Project No. 113-81093
==10.0REFERENCES==
The Report's author annotated the reference sources relied upon in preparing the Phase I ESA in the relevant sections of this Report.
DRAFT List of Figures DRAFT SCALE011MILESCHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.
TITLEAS SHOWNREV.J:\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\VICINITY_MAP_WI.dwg l 1/11/2012 10:58 AM l AGarrigus l STEVENS POINT 1--------APG1/11/12MTK1/11/12AT1/11/12 0----FIG.113-81051 VICINITY_MAP_WI.dwg SMT / STEVENS POINT / AK VICINITY MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN REFERENCE TOPOGRAPHIC MAP PROVIDED BY WISCONSIN DNR.
PROJECTLOCATIONPROJECTLOCATIONDRAFT 100'162'66'100'60'66'66'66'2308-01-2101-01 2308-01-2201-01 4.26 AC.13 AC.80 AC.2.4 AC.18.61 AC.
S88°58'06"E  1,868' 1,868'N01°01'45"W  1,868' 1,868'TRANSMISSION LINE 1,000'R1,000'R80' FUTURE STREET 100' FUTURE STREET S88°58'06"E TRANSIT FACILITY 21 AC.3 AC.21 AC.2.2 AC.5 AC.2.4 AC.5.1 AC.17.52 AC.
19.93 AC.
3.7 AC.25.23 AC.
10.33 AC.
23.34 AC.
1.5 AC.34.23 AC.
35.69 AC.
700'700'700'0.4 AC.10.43 AC.
5.1 AC.1.5 AC.316'-3"316'-3"SM-GW1ASM-GW2ASM-GW3ASM-GW4A1.) LOCATION OF POTENTIAL LOCATION FOR SHINE MEDICAL FACILITY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
2.) AERIAL IMAGERY PROVIDED BY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
REFERENCES\\anc1-s-fs2-vm\Jobs_In_Progress\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\Proposed_building_layout_SP.dwg l 1/11/2012 11:01 AM l AGarrigus l STEVENS POINT SCALE0FEET100O100O2--------APG1/11/12MTK1/11/12AT1/11/121----FIG.113-81051 Proposed_building_layout_SP.dwg SMT / STEVENS POINT / AK SITE MAPSHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN CHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.
TITLEAS SHOWNREV.PROPOSEDBUILDINGOUTLINEPROPOSED BUILDINGAREAINTERSTATE HIGHWAY 39 PROPOSEDPROPERTYBOUNDARY1.) NORTHINGS AND EASTINGS PROVIDED IN NAD_1983_HARN_WISCRS_PORTAGE_COUNTY_FEET NOTESDRAFT Appendix ALegal Description of the Subject Property/Chain of Title Report DRAFT DRAFTRFI RESPONSE FORM PM-001, Revision 2 RFI NO.: GOLDER-2011-RFI Revision:
0 0051 Due Date: 12/16/2011 Sheet 1 of 3 RFI RESPONSE:
The following table is the legal parcels description for the Stevens Point property:
Parcel Township Owner(s)
Approximate Identification Acreage Number 020-23-0801-02.06 Town of Hull 7.2 020-23-0801-03.01 Town of Hull 19.92 . 020-23-0801-02.02 Town of Hull 6.6 020-23-0801-01.04 Town of Hull 25.23 020-23-0801-04.01 020-23-0801-03.02 Town of Hull 19.93 030-23-0801-1 4 Town of Plover 5.5 030-23-0801-13 Town of Plover 3.7 Total Combined 88.08 Parcel Acreage Please also find Phase 1 ESA User Questionnaire responses on pages 2 and 3 of the RFI response.
Responder:
______________
_ Company:
SHINE Medical Independent Reviewer (for Design Input)---------------
Responder's Management:
SHINE Licensing:
Originator Acceptance:
12/28/2011 X
Date: 12.21.11 Phone No.: ----------1 Date:
Date: ------------------1 My Map020230801-01.04This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:26:25 PM.
DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map020230801-02.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:40:03 PM.
DRAFT My Map020230801-02.06This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:42:58 PM.
DRAFT My Map020230801-03.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:15:59 PM.
DRAFTJakuszMargaretAEtalMocadloThomas,J 5931OldHighway18 StevensPoint,WI My Map020-23-0801-03.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:30:47 PM.
DRAFTEmmerichHakrzewskiBluetopFarmsInc 5613CountyRoadHH StevensPoint,WI My Map020230801-04.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:28:50 PM.
DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map030-23-0801-13This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:34:11 PM.
DRAFTMS&SEnterprises6213CountyRoadHH StevensPoint,WI54482 My Map030-23-0801-14This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:32:31 PM.
DRAFTBlueTopFarmsInc.5613CountyRoadHH StevensPoint,WI54482 Appendix BFederal and State Regulatory Database SearchDRAFT FORM-BPK-SPM kcehCoeG htiw tropeR  ŽpaM suidaR RDE ehT440 Wheelers Farms Road Milford, CT 06461
Toll Free: 800.352.0050
www.edrnet.com SHINE Medical Stevens Point, WI Lands End Way,
Stevens Point, WI  54482 Inquiry Number: 3220399.2s December 07, 2011 DRAFT SECTIONPAGEExecutive Summary ES1Overview Map 2Detail Map 3Map Findings Summary4 Map Findings 7Orphan Summary 8Government Records Searched/Data Currency TrackingGR-1 GEOCHECK ADDENDUMPhysical Setting Source AddendumA-1Physical Setting Source SummaryA-2Physical Setting SSURGO Soil MapA-5Physical Setting Source MapA-9Physical Setting Source Map FindingsA-11Physical Setting Source Records SearchedA-30 TC3220399.2s  Page 1 Thank you for your business.
Please contact EDR at 1-800-352-0050 with any questions or comments.
Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmen tal DataResources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties doe s not exist from other sources.
NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION,
MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL
ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE,
ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL,
CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY
LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT.
Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intend ed to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any prope rty. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental ri sk for any property. Additionally, the information provided in this Report is not to be construed as legal advice.
Copyright 2011 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission.
EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. A ll othertrademarks used herein are the property of their respective owners.
TABLE OF CONTENTS DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 1A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).The report was designed to assist parties seeking to meet the search requirements of EPA's Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-05) or custom requirements developed for the evaluation of
environmental risk associated with a parcel of real estate.
TARGET PROPERTY INFORMATION ADDRESSLANDS END WAY,
STEVENS POINT, WI 54482 COORDINATES 44.507000 - 44 30' 25.2''
Latitude (North):
89.495900 - 89 29' 45.2''
Longitude (West):
Zone 16Universal Tranverse Mercator:
301598.3UTM X (Meters):
4931000.0 UTM Y (Meters):
1113 ft. above sea level Elevation:
USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 44089-E4 POLONIA, WI Target Property Map:
1986Most Recent Revision:
44089-D4 ARNOTT, WI South Map:
1969Most Recent Revision:
44089-D5 WHITING, WI Southwest Map:
1976Most Recent Revision:
44089-E5 STEVENS POINT, WI West Map:
1991Most Recent Revision:
AERIAL PHOTOGRAPHY IN THIS REPORT 2010Photo Year:
USDASource:TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR.
DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 2 DATABASES WITH NO MAPPED SITESNo mapped sites were found in EDR's search of available ("reasonably ascertainable ") governmentrecords either on the target property or within the search radius around the target property for the
following databases:
STANDARD ENVIRONMENTAL RECORDS Federal NPL site listNPLNational Priority ListProposed NPLProposed National Priority List SitesNPL LIENSFederal Superfund Liens Federal Delisted NPL site list Delisted NPLNational Priority List Deletions Federal CERCLIS list CERCLISComprehensive Environmental Response, Compensation, and Liability Information SystemFEDERAL FACILITYFederal Facility Site Information listing Federal CERCLIS NFRAP site List CERC-NFRAPCERCLIS No Further Remedial Action Planned Federal RCRA CORRACTS facilities list CORRACTSCorrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDFRCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-LQGRCRA - Large Quantity GeneratorsRCRA-SQGRCRA - Small Quantity GeneratorsRCRA-CESQGRCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries US ENG CONTROLSEngineering Controls Sites ListUS INST CONTROLSites with Institutional Controls Federal ERNS list ERNSEmergency Response Notification System State- and tribal - equivalent CERCLIS SHWSHazard Ranking List DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 3 State and tribal landfill and/or solid waste disposal site listsSWF/LFList of Licensed LandfillsWDSRegistry of Waste Disposal SitesSHWIMSSolid & Hazardous Waste Information Management System State and tribal leaking storage tank lists LUSTLeaking Underground Storage Tank DatabaseLASTLeaking Aboveground Storage Tank ListingINDIAN LUSTLeaking Underground Storage Tanks on Indian Land State and tribal registered storage tank lists USTRegistered Underground Storage TanksASTTanks DatabaseINDIAN USTUnderground Storage Tanks on Indian LandFEMA USTUnderground Storage Tank Listing State and tribal institutional control / engineering control registries CRSClosed Remediation SitesAULDeed Restriction at Closeout Sites State and tribal voluntary cleanup sites VCPVoluntary Party Liability Exemption SitesINDIAN VCPVoluntary Cleanup Priority Listing State and tribal Brownfields sites BEAPBrownfields Environmental Assessment ProgramBROWNFIELDSBrownfields Site Locations Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDSA Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites DEBRIS REGION 9Torres Martinez Reservation Illegal Dump Site LocationsODIOpen Dump InventorySWRCYRecycling Center ListingINDIAN ODIReport on the Status of Open Dumps on Indian Lands Local Lists of Hazardous waste / Contaminated Sites US CDLClandestine Drug LabsWI ERPEnvironmental Repair Program DatabaseCDLClandestine Drug Lab ListingUS HIST CDLNational Clandestine Laboratory Register DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 4 Local Land RecordsLIENS 2CERCLA Lien InformationLUCISLand Use Control Information System Records of Emergency Release Reports HMIRSHazardous Materials Information Reporting SystemSPILLSSpills DatabaseAGSPILLSAgricultural Spill Cases Other Ascertainable Records RCRA-NonGenRCRA - Non GeneratorsDOT OPSIncident and Accident DataDODDepartment of Defense SitesFUDSFormerly Used Defense SitesCONSENTSuperfund (CERCLA) Consent DecreesRODRecords Of DecisionUMTRAUranium Mill Tailings SitesMINESMines Master Index FileTRISToxic Chemical Release Inventory SystemTSCAToxic Substances Control ActFTTSFIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide                                                Act)/TSCA (Toxic Substances Control Act)HIST FTTSFIFRA/TSCA Tracking System Administrative Case ListingSSTSSection 7 Tracking SystemsICISIntegrated Compliance Information SystemPADSPCB Activity Database SystemMLTSMaterial Licensing Tracking SystemRADINFORadiation Information DatabaseFINDSFacility Index System/Facility Registry SystemRAATSRCRA Administrative Action Tracking SystemBRRTSBureau of Remediation & Redevelopment Tracking SystemNPDESNPDES Permit ListingMANIFESTHazardous Waste Manifest DataDRYCLEANERSFive Star Recognition Program SitesWI WRRSERWisconsin Remedial Response Site Evaluation ReportAIRSAir Permit Program ListingTIER 2Tier 2 Facility ListingLEADLead Inspection DataINDIAN RESERVIndian ReservationsSCRD DRYCLEANERSState Coalition for Remediation of Drycleaners ListingCOAL ASH EPACoal Combustion Residues Surface Impoundments ListFINANCIAL ASSURANCEFinancial Assurance Information ListingCOAL ASHCoal Ash Disposal Site ListingPCB TRANSFORMERPCB Transformer Registration DatabaseCOAL ASH DOESleam-Electric Plan Operation Data EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas PlantsEDR Proprietary Manufactured Gas Plants DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 5 SURROUNDING SITES: SEARCH RESULTS Surrounding sites were not identified.
Unmappable (orphan) sites are not considered in the foregoing analysis.
DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 6 Due to poor or inadequate address information, the following sites were not mapped. Count: 13 records.Site Name Database(s)____________ ____________STEVENS POINT MUNICIPAL AIRPORT NPDESSTEVENS POINT MUNI FINDS FROM STEVENS POINT CTY LIMITS TO C SPILLS JUNCTION CITY TO STEVENS POINT SPILLS WI RIVER & WISCONSIN ST SPILLS UW STEVENS POINT BALDWIN HALL SPILLS WISCONSIN RIVER BELOW POINT PAPER SPILLS STEVENS POINT AIRPORT #2 WI WRRSER KWIK TRIP - STEVENS POINT WI WRRSER STEVENS POINT BRRTS WI RIVER BOAT LANDING BRRTS STEVENS POINT BRRTS STEVENS POINT WATER DEPARTMENT - W TIER 2 DRAFT EDR Inc.EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.1120DRAFT N Target Property
... Sillls at eleva1ions higher than or equal to the target property
* Sbs at eleva11ons lower 1han 1he target property
.1 Manufactured Gas Plants &enslave AecepiDra E;:J Nallonal Priarlly Ust Silltl ITIJ Dept. Delenaa SIIBS SITE NAME: SHINE Mec:lcal Stevena Point, WI ADDRESS:
Lands End Way, Stevens Poln: WI 64482 LA TILONG: 44.5070 /89.4959 It , .. Indian Raaarvatlons BIA N Oil & Gas pipelines from USGS 100-year flood zone 600-yaar flood Z(lne ,,. .... ThiS report includes lntBratliYe Map display and/or hide map information.
11le legend includes only thOse icons for 1he dtlfault map view. D R i::l NT: Golder Associates CONTACT:
INQUIRY 1: 3220399.2&
DATE:
2011 11:47 am MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0  NR    0      0      0    0 1.000NPL    0  NR    0      0      0    0 1.000Proposed NPL 0  NR  NR    NR    NR  NR  TPNPL LIENS Federal Delisted NPL site list 0  NR    0      0      0    0 1.000Delisted NPL Federal CERCLIS list 0  NR  NR      0      0    0 0.500CERCLIS    0  NR    0      0      0    0 1.000FEDERAL FACILITY Federal CERCLIS NFRAP site List 0  NR  NR      0      0    0 0.500CERC-NFRAP Federal RCRA CORRACTS facilities list 0  NR    0      0      0    0 1.000CORRACTSFederal RCRA non-CORRACTS TSD facilities list 0  NR  NR      0      0    0 0.500RCRA-TSDF Federal RCRA generators list 0  NR  NR    NR      0    0 0.250RCRA-LQG    0  NR  NR    NR      0    0 0.250RCRA-SQG    0  NR  NR    NR      0    0 0.250RCRA-CESQG Federal institutional controls /
engineering controls registries 0  NR  NR      0      0    0 0.500US ENG CONTROLS 0  NR  NR      0      0    0 0.500US INST CONTROL Federal ERNS list 0  NR  NR    NR    NR  NR  TPERNSState- and tribal - equivalent CERCLIS 0  NR    0      0      0    0 1.000SHWSState and tribal landfill and/or solid waste disposal site lists 0  NR  NR      0      0    0 0.500SWF/LF    0  NR  NR      0      0    0 0.500WDS    0  NR  NR    NR    NR  NR  TPSHWIMSState and tribal leaking storage tank lists 0  NR  NR      0      0    0 0.500LUST    0  NR  NR      0      0    0 0.500LAST    0  NR  NR      0      0    0 0.500INDIAN LUST TC3220399.2s  Page 4 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted State and tribal registered storage tank lists 0  NR  NR    NR      0    0 0.250UST    0  NR  NR    NR      0    0 0.250AST    0  NR  NR    NR      0    0 0.250INDIAN UST 0  NR  NR    NR      0    0 0.250FEMA USTState and tribal institutional control / engineering control registries 0  NR  NR    NR    NR  NR  TPCRS    0  NR  NR      0      0    0 0.500AULState and tribal voluntary cleanup sites 0  NR  NR      0      0    0 0.500VCP    0  NR  NR      0      0    0 0.500INDIAN VCP State and tribal Brownfields sites 0  NR  NR      0      0    0 0.500BEAP    0  NR  NR      0      0    0 0.500BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0  NR  NR      0      0    0 0.500US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0  NR  NR      0      0    0 0.500DEBRIS REGION 9 0  NR  NR      0      0    0 0.500ODI    0  NR  NR      0      0    0 0.500SWRCY    0  NR  NR      0      0    0 0.500INDIAN ODI Local Lists of Hazardous waste /
Contaminated Sites 0  NR  NR    NR    NR  NR  TPUS CDL    0  NR  NR      0      0    0 0.500WI ERP    0  NR  NR    NR    NR  NR  TPCDL    0  NR  NR    NR    NR  NR  TPUS HIST CDL Local Land Records 0  NR  NR    NR    NR  NR  TPLIENS 2    0  NR  NR      0      0    0 0.500LUCISRecords of Emergency Release Reports 0  NR  NR    NR    NR  NR  TPHMIRS    0  NR  NR    NR    NR  NR  TPSPILLS    0  NR  NR    NR    NR  NR  TPAGSPILLSOther Ascertainable Records 0  NR  NR    NR      0    0 0.250RCRA-NonGen TC3220399.2s  Page 5 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted 0  NR  NR    NR    NR  NR  TPDOT OPS    0  NR    0      0      0    0 1.000DOD    0  NR    0      0      0    0 1.000FUDS    0  NR    0      0      0    0 1.000CONSENT    0  NR    0      0      0    0 1.000ROD    0  NR  NR      0      0    0 0.500UMTRA    0  NR  NR    NR      0    0 0.250MINES    0  NR  NR    NR    NR  NR  TPTRIS    0  NR  NR    NR    NR  NR  TPTSCA    0  NR  NR    NR    NR  NR  TPFTTS    0  NR  NR    NR    NR  NR  TPHIST FTTS 0  NR  NR    NR    NR  NR  TPSSTS    0  NR  NR    NR    NR  NR  TPICIS    0  NR  NR    NR    NR  NR  TPPADS    0  NR  NR    NR    NR  NR  TPMLTS    0  NR  NR    NR    NR  NR  TPRADINFO    0  NR  NR    NR    NR  NR  TPFINDS    0  NR  NR    NR    NR  NR  TPRAATS    0  NR  NR    NR    NR  NR  TPBRRTS    0  NR  NR    NR    NR  NR  TPNPDES    0  NR  NR    NR      0    0 0.250MANIFEST    0  NR  NR    NR      0    0 0.250DRYCLEANERS 0  NR  NR    NR    NR  NR  TPWI WRRSER 0  NR  NR    NR    NR  NR  TPAIRS    0  NR  NR    NR    NR  NR  TPTIER 2    0  NR  NR    NR    NR  NR  TPLEAD    0  NR    0      0      0    0 1.000INDIAN RESERV 0  NR  NR      0      0    0 0.500SCRD DRYCLEANERS 0  NR  NR      0      0    0 0.500COAL ASH EPA 0  NR  NR    NR    NR  NR  TPFINANCIAL ASSURANCE 0  NR  NR      0      0    0 0.500COAL ASH    0  NR  NR    NR    NR  NR  TPPCB TRANSFORMER 0  NR  NR    NR    NR  NR  TPCOAL ASH DOE EDR PROPRIETARY RECORDS EDR Proprietary Records 0  NR    0      0      0    0 1.000Manufactured Gas Plants NOTES:  TP = Target Property
NR = Not Requested at this Search Distance
Sites may be listed in more than one database TC3220399.2s  Page 6 DRAFT MAP FINDINGS Map IDDirection EDR ID Number DistanceEPA ID Number Database(s)
SiteElevation NO SITES FOUND TC3220399.2s  Page 7 DRAFT ORPHAN SUMMARYCityEDR IDSite NameSite AddressZipDatabase(s)
Count: 13 records.STEVENS POINTS109260948STEVENS POINT AIRPORT #2HWY 66 WI WRRSERSTEVENS POINTS110356483STEVENS POINT MUNICIPAL AIRPORTHWY 66 OF POINT ENPDES STEVENS POINTS106975782STEVENS POINT ADDRESS UNKNOWNBRRTSSTEVENS POINTS107426958FROM STEVENS POINT CTY LIMITS TO CFROM STEVENS PTSPILLSSTEVENS POINTS100670543KWIK TRIP - STEVENS POINT3533 E HWY 66 WI WRRSERSTEVENS POINTS107429234JUNCTION CITY TO STEVENS POINTJUNCTION CITY TO STEVENS PTSPILLS STEVENS POINTS109326408WI RIVER & WISCONSIN STWI RIV S SPILLSSTEVENS POINTS110674654WI RIVER BOAT LANDINGRIVER RD BRRTSSTEVENS POINTS107432651UW STEVENS POINT BALDWIN HALLUW STEVENS PTSPILLSSTEVENS POINTS110357602STEVENS POINTSTEVENS PT BRRTSSTEVENS POINT1011985398STEVENS POINT MUNIUNKNOWN FINDSSTEVENS POINTS107685149STEVENS POINT WATER DEPARTMENT - W100 WELL FIELD RDTIER 2 STEVENS POINTS107433219WISCONSIN RIVER BELOW POINT PAPERWISCONSIN RIVER BELOW PTSPILLS TC3220399.2s  Page 8 DRAFT To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required.
Number of Days to Update:
Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public.
STANDARD ENVIRONMENTAL RECORDS Federal NPL site list
NPL:  National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority
cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon
coverage for over 1,000 NPL site boundaries produced by EPA's Environmental Photographic Interpretation Center
(EPIC) and regional EPA offices.
Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 79 Source:  EPA Telephone:  N/A
Last EDR Contact: 10/12/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly NPL Site Boundaries Sources:
EPA's Environmental Photographic Interpretation Center (EPIC)
Telephone: 202-564-7333EPA Region 1EPA Region 6Telephone 617-918-1143Telephone: 214-655-6659EPA Region 3EPA Region 7Telephone 215-814-5418Telephone: 913-551-7247EPA Region 4EPA Region 8Telephone 404-562-8033Telephone: 303-312-6774EPA Region 5EPA Region 9Telephone 312-886-6686Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL:  Proposed National Priority List SitesA site that has been proposed for listing on the NationalPriorities List through the issuance of a proposed rule in the Federal Register.EPA then accepts public comments on the site, responds to the comments,and places on the NPL those sites that continue to meet therequirements for listing.
Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 79 Source:  EPA Telephone:  N/A
Last EDR Contact: 10/12/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly NPL LIENS:  Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority
to file liens against real property in order to recover remedial action expenditures or when the property owner
received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens.
Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994
Date Made Active in Reports: 03/30/1994
Number of Days to Update: 56 Source:  EPA Telephone:  202-564-4267
Last EDR Contact: 08/15/2011
Next Scheduled EDR Contact: 11/28/2011
Data Release Frequency: No Update Planned TC3220399.2s    Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal Delisted NPL site list DELISTED NPL:  National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the
EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the
NPL where no further response is appropriate.
Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 79 Source:  EPA Telephone:  N/A
Last EDR Contact: 10/12/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly Federal CERCLIS list
CERCLIS:  Comprehensive Environmental Response, Compensation, and Liability Information System CERCLIS contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities,
private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation,
and Liability Act (CERCLA). CERCLIS contains sites which are either proposed to or on the National Priorities
List (NPL) and sites which are in the screening and assessment phase for possible inclusion on the NPL.
Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011
Date Made Active in Reports: 05/02/2011
Number of Days to Update: 62 Source:  EPA Telephone:  703-412-9810
Last EDR Contact: 11/29/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Quarterly FEDERAL FACILITY:  Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive
Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities
Restoration and Reuse Office is involved in cleanup activities.
Date of Government Version: 12/10/2010 Date Data Arrived at EDR: 01/11/2011
Date Made Active in Reports: 02/16/2011
Number of Days to Update: 36 Source:  Environmental Protection Agency Telephone:  703-603-8704
Last EDR Contact: 10/14/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Varies Federal CERCLIS NFRAP site List
CERCLIS-NFRAP:  CERCLIS No Further Remedial Action Planned Archived sites are sites that have been removed and archived from the inventory of CERCLIS sites. Archived status
indicates that, to the best of EPA's knowledge, assessment at a site has been completed and that EPA has determined
no further steps will be taken to list this site on the National Priorities List (NPL), unless information indicates
this decision was not appropriate or other considerations require a recommendation for listing at a later time.
This decision does not necessarily mean that there is no hazard associated with a given site; it only means that,
based upon available information, the location is not judged to be a potential NPL site.
Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011
Date Made Active in Reports: 05/02/2011
Number of Days to Update: 62 Source:  EPA Telephone:  703-412-9810
Last EDR Contact: 11/29/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list
CORRACTS:  Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity.
TC3220399.2s    Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 03/09/2011 Date Data Arrived at EDR: 03/15/2011
Date Made Active in Reports: 06/14/2011
Number of Days to Update: 91 Source:  EPA Telephone:  800-424-9346
Last EDR Contact: 11/14/2011
Next Scheduled EDR Contact: 02/27/2012
Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list
RCRA-TSDF:  RCRA - Treatment, Storage and Disposal RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that
move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the
waste. TSDFs treat, store, or dispose of the waste.
Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
Date Made Active in Reports: 08/08/2011
Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
Last EDR Contact: 10/05/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Quarterly Federal RCRA generators list
RCRA-LQG:  RCRA - Large Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate
over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month.
Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
Date Made Active in Reports: 08/08/2011
Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
Last EDR Contact: 10/05/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Quarterly RCRA-SQG:  RCRA - Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate
between 100 kg and 1,000 kg of hazardous waste per month.
Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
Date Made Active in Reports: 08/08/2011
Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
Last EDR Contact: 10/05/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Quarterly RCRA-CESQG:  RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators
(CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month.
Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
Date Made Active in Reports: 08/08/2011
Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
Last EDR Contact: 10/05/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Varies TC3220399.2s    Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal institutional controls / engineering controls registries US ENG CONTROLS:  Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building
foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental
media or effect human health.
Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011
Date Made Active in Reports: 06/14/2011
Number of Days to Update: 81 Source:  Environmental Protection Agency Telephone:  703-603-0695
Last EDR Contact: 09/12/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Varies US INST CONTROL:  Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures,
such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation
care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally
required as part of the institutional controls.
Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011
Date Made Active in Reports: 06/14/2011
Number of Days to Update: 81 Source:  Environmental Protection Agency Telephone:  703-603-0695
Last EDR Contact: 09/12/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Varies Federal ERNS list
ERNS:  Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous
substances.
Date of Government Version: 10/03/2011 Date Data Arrived at EDR: 10/04/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 38 Source:  National Response Center, United States Coast Guard Telephone:  202-267-2180
Last EDR Contact: 10/04/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Annually State- and tribal - equivalent CERCLIS
SHWS:  Hazard Ranking List State Hazardous Waste Sites. State hazardous waste site records are the states' equivalent to CERCLIS. These sites
may or may not already be listed on the federal CERCLIS list. Priority sites planned for cleanup using state funds
(state equivalent of Superfund) are identified along with sites where cleanup will be paid for by potentially
responsible parties. Available information varies by state.
Date of Government Version: 11/30/1994 Date Data Arrived at EDR: 02/10/1995
Date Made Active in Reports: 03/01/1995
Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2632
Last EDR Contact: 10/03/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: No Update Planned State and tribal landfill and/or solid waste disposal site lists
SWF/LF:  List of Licensed Landfills Solid Waste Facilities/Landfill Sites. SWF/LF type records typically contain an inventory of solid waste disposal
facilities or landfills in a particular state. Depending on the state, these may be active or inactive facilities
or open dumps that failed to meet RCRA Subtitle D Section 4004 criteria for solid waste landfills or disposal
sites.TC3220399.2s    Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/12/2011 Date Data Arrived at EDR: 10/13/2011
Date Made Active in Reports: 11/22/2011
Number of Days to Update: 40 Source:  Department of Natural Resources Telephone:  608-267-7557
Last EDR Contact: 10/03/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Semi-Annually WDS:  Registry of Waste Disposal Sites The registry was created by the DNR to serve as a comprehensive listing of all sites where solid or hazardous
wastes have been or may have been deposited.
Date of Government Version: 07/19/2011 Date Data Arrived at EDR: 10/06/2011
Date Made Active in Reports: 10/25/2011
Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2632
Last EDR Contact: 10/06/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: No Update Planned SHWIMS:  Solid & Hazardous Waste Information Management System Information on sites, and facilities operating at sites, that are regulated by the Waste Management program Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/06/2011
Date Made Active in Reports: 10/25/2011
Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2414
Last EDR Contact: 10/06/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Quarterly State and tribal leaking storage tank lists
LUST:  Leaking Underground Storage Tank Database Leaking Underground Storage Tank Incident Reports. LUST records contain an inventory of reported leaking underground
storage tank incidents. Not all states maintain these records, and the information stored varies by state.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly LAST:  Leaking Aboveground Storage Tank Listing A listing of leaking aboveground storage tank sites.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Varies INDIAN LUST R9:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 01/31/2011 Date Data Arrived at EDR: 02/01/2011
Date Made Active in Reports: 03/21/2011
Number of Days to Update: 48 Source:  Environmental Protection Agency Telephone:  415-972-3372
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly INDIAN LUST R4:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina.
Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 32 Source:  EPA Region 4 Telephone:  404-562-8677
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Semi-Annually TC3220399.2s    Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN LUST R10:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington.
Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 7 Source:  EPA Region 10 Telephone:  206-553-2857
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly INDIAN LUST R1:  Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land.
Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 10 Source:  EPA Region 1 Telephone:  617-918-1313
Last EDR Contact: 11/01/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN LUST R6:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma.
Date of Government Version: 09/12/2011 Date Data Arrived at EDR: 09/13/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 59 Source:  EPA Region 6 Telephone:  214-665-6597
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN LUST R7:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 02/16/2011 Date Data Arrived at EDR: 06/02/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 103 Source:  EPA Region 7 Telephone:  913-551-7003
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN LUST R8:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming.
Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 25 Source:  EPA Region 8 Telephone:  303-312-6271
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly State and tribal registered storage tank lists
UST:  Registered Underground Storage Tanks Registered Underground Storage Tanks. UST's are regulated under Subtitle I of the Resource Conservation and Recovery
Act (RCRA) and must be registered with the state department responsible for administering the UST program. Available
information varies by state program.
Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011
Date Made Active in Reports: 10/13/2011
Number of Days to Update: 21 Source:  Department of Commerce Telephone:  608-266-7874
Last EDR Contact: 09/22/2011
Next Scheduled EDR Contact: 01/02/2012
Data Release Frequency: Quarterly AST:  Tanks Database Aboveground storage tank site locations.
TC3220399.2s    Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011
Date Made Active in Reports: 10/13/2011
Number of Days to Update: 21 Source:  Department of Commerce Telephone:  608-266-7874
Last EDR Contact: 09/22/2011
Next Scheduled EDR Contact: 01/02/2012
Data Release Frequency: Quarterly INDIAN UST R9:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations).
Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 08/05/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 39 Source:  EPA Region 9 Telephone:  415-972-3368
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly INDIAN UST R8:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations).
Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 25 Source:  EPA Region 8 Telephone:  303-312-6137
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly INDIAN UST R7:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations).
Date of Government Version: 04/01/2011 Date Data Arrived at EDR: 06/01/2011
Date Made Active in Reports: 06/14/2011
Number of Days to Update: 13 Source:  EPA Region 7 Telephone:  913-551-7003
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN UST R10:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations).
Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 7 Source:  EPA Region 10 Telephone:  206-553-2857
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Quarterly INDIAN UST R1:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal
Nations).
Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 10 Source:  EPA, Region 1 Telephone:  617-918-1313
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN UST R4:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee
and Tribal Nations)
TC3220399.2s    Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 32 Source:  EPA Region 4 Telephone:  404-562-9424
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Semi-Annually INDIAN UST R5:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations).
Date of Government Version: 07/01/2011 Date Data Arrived at EDR: 08/26/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 18 Source:  EPA Region 5 Telephone:  312-886-6136
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies INDIAN UST R6:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes).
Date of Government Version: 05/10/2011 Date Data Arrived at EDR: 05/11/2011
Date Made Active in Reports: 06/14/2011
Number of Days to Update: 34 Source:  EPA Region 6 Telephone:  214-665-7591
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Semi-Annually FEMA UST:  Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks.
Date of Government Version: 01/01/2010 Date Data Arrived at EDR: 02/16/2010
Date Made Active in Reports: 04/12/2010
Number of Days to Update: 55 Source:  FEMA Telephone:  202-646-5797
Last EDR Contact: 10/17/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Varies State and tribal institutional control / engineering control registries
CRS:  Closed Remediation Sites A Closed Remediation Site is parcel of land at which the groundwater has become contaminated and which is affected
by a particular type of legal restriction. Specifically, certain steps have been taken to stabilize/remediate
the contamination, and the state is satisfied that no further efforts are necessary provided that the property
is not used for certain purposes.
Date of Government Version: 08/23/2011 Date Data Arrived at EDR: 08/25/2011
Date Made Active in Reports: 09/14/2011
Number of Days to Update: 20 Source:  Department of Natural Resources Telephone:  608-267-0554
Last EDR Contact: 11/24/2011
Next Scheduled EDR Contact: 03/05/2012
Data Release Frequency: Semi-Annually AUL:  Deed Restriction at Closeout Sites Date a deed restriction is recorded at the Register of Deeds office for a property. Extent of soil contamination
is known but impracticable to remove now or an engineering control is required to be maintained or NR720 industrial
stds are applied. Restricts property use or requires future actions.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly State and tribal voluntary cleanup sites TC3220399.2s    Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN VCP R1:  Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1.
Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 10/04/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 38 Source:  EPA, Region 1 Telephone:  617-918-1102
Last EDR Contact: 10/04/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Varies VCP:  Voluntary Party Liability Exemption Sites The Voluntary Party Liability Exemption is an elective environmental cleanup program. Interested persons who meet
the definition of "voluntary party" are eligible to apply. A "voluntary party" is any person who submits an application
and pays all the necessary fees.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Varies INDIAN VCP R7:  Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7.
Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008
Date Made Active in Reports: 05/19/2008
Number of Days to Update: 27 Source:  EPA, Region 7 Telephone:  913-551-7365
Last EDR Contact: 04/20/2009
Next Scheduled EDR Contact: 07/20/2009
Data Release Frequency: Varies State and tribal Brownfields sites
BEAP:  Brownfields Environmental Assessment Program The Brownfields Environmental Assessment Program (BEAP) was a federal program that assisted municipalities with
Environmental Site Assessments (ESA's) for tax delinquent or bankrupt properties, or properties a local government
acquired for redevelopment. Using federal dollars, site assessments were conducted by Department of Natural Resources
(DNR) staff to determine if the properties were contaminated.
Date of Government Version: 12/31/2000 Date Data Arrived at EDR: 05/29/2001
Date Made Active in Reports: 06/29/2001
Number of Days to Update: 31 Source:  Department of Natural Resources Telephone:  608-266-1618
Last EDR Contact: 08/17/2009
Next Scheduled EDR Contact: 11/16/2009
Data Release Frequency: No Update Planned BROWNFIELDS:  Brownfields Site Locations Listing A listing of brownfields sites included in the BRRTS database. Brownfields are abandoned, idle or underused commercial
or industrial properties, where the expansion or redevelopment is hindered by real or perceived contamination.
Brownfields vary in size, location, age, and past use -- they can be anything from a five-hundred acre automobile
assembly plant to a small, abandoned corner gas station.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-266-3084
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS:  A Listing of Brownfields Sites TC3220399.2s    Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Included in the listing are brownfields properties addresses by Cooperative Agreement Recipients and brownfields properties addressed by Targeted Brownfields Assessments. Targeted Brownfields Assessments-EPA's Targeted Brownfields
Assessments (TBA) program is designed to help states, tribes, and municipalities--especially those without EPA
Brownfields Assessment Demonstration Pilots--minimize the uncertainties of contamination often associated with
brownfields. Under the TBA program, EPA provides funding and/or technical assistance for environmental assessments
at brownfields sites throughout the country. Targeted Brownfields Assessments supplement and work with other efforts
under EPA's Brownfields Initiative to promote cleanup and redevelopment of brownfields. Cooperative Agreement
Recipients-States, political subdivisions, territories, and Indian tribes become Brownfields Cleanup Revolving
Loan Fund (BCRLF) cooperative agreement recipients when they enter into BCRLF cooperative agreements with the
U.S. EPA. EPA selects BCRLF cooperative agreement recipients based on a proposal and application process. BCRLF
cooperative agreement recipients must use EPA funds provided through BCRLF cooperative agreement for specified
brownfields-related cleanup activities.
Date of Government Version: 06/27/2011 Date Data Arrived at EDR: 06/27/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 78 Source:  Environmental Protection Agency Telephone:  202-566-2777
Last EDR Contact: 09/28/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Semi-Annually Local Lists of Landfill / Solid Waste Disposal Sites
ODI:  Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258
Subtitle D Criteria.
Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004
Date Made Active in Reports: 09/17/2004
Number of Days to Update: 39 Source:  Environmental Protection Agency Telephone:  800-424-9346
Last EDR Contact: 06/09/2004
Next Scheduled EDR Contact: N/A
Data Release Frequency: No Update Planned DEBRIS REGION 9:  Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside
County and northern Imperial County, California.
Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009
Date Made Active in Reports: 09/21/2009
Number of Days to Update: 137 Source:  EPA, Region 9 Telephone:  415-947-4219
Last EDR Contact: 09/26/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: No Update Planned SWRCY:  Recycling Center Listing A listing of recycling center locations.
Date of Government Version: 09/14/2011 Date Data Arrived at EDR: 09/16/2011
Date Made Active in Reports: 10/14/2011
Number of Days to Update: 28 Source:  Solid & Hazardous Waste Education center Telephone:  608-262-0936
Last EDR Contact: 11/28/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Varies INDIAN ODI:  Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land.
Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007
Date Made Active in Reports: 01/24/2008
Number of Days to Update: 52 Source:  Environmental Protection Agency Telephone:  703-308-8245
Last EDR Contact: 11/07/2011
Next Scheduled EDR Contact: 02/20/2012
Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites TC3220399.2s    Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT US CDL:  Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this
web site as a public service. It contains addresses of some locations where law enforcement agencies reported
they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
In most cases, the source of the entries is not the Department, and the Department has not verified the entry
and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,
contacting local law enforcement and local health departments.
Date of Government Version: 06/08/2011 Date Data Arrived at EDR: 09/16/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 13 Source:  Drug Enforcement Administration Telephone:  202-307-1000
Last EDR Contact: 12/05/2011
Next Scheduled EDR Contact: 03/19/2012
Data Release Frequency: Quarterly ERP:  Environmental Repair Program Database Environmental Repair Program sites are sites other than LUST's that have contaminated soil and/or groundwater.
Often, these are old historic releases to the environment.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly CDL:  Clandestine Drug Lab Listing A listing of clandestine drug lab locations in the state.
Date of Government Version: 10/11/2011 Date Data Arrived at EDR: 10/21/2011
Date Made Active in Reports: 11/22/2011
Number of Days to Update: 32 Source:  Department of Justice Telephone:  920-832-2751
Last EDR Contact: 11/15/2011
Next Scheduled EDR Contact: 02/27/2012
Data Release Frequency: Varies US HIST CDL:  National Clandestine Laboratory Register A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this
web site as a public service. It contains addresses of some locations where law enforcement agencies reported
they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
In most cases, the source of the entries is not the Department, and the Department has not verified the entry
and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,
contacting local law enforcement and local health departments.
Date of Government Version: 09/01/2007 Date Data Arrived at EDR: 11/19/2008
Date Made Active in Reports: 03/30/2009
Number of Days to Update: 131 Source:  Drug Enforcement Administration Telephone:  202-307-1000
Last EDR Contact: 03/23/2009
Next Scheduled EDR Contact: 06/22/2009
Data Release Frequency: No Update Planned Local Land Records
LIENS 2:  CERCLA Lien Information A Federal CERCLA ('Superfund') lien can exist by operation of law at any site or property at which EPA has spent
Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination.
CERCLIS provides information as to the identity of these sites and properties.
Date of Government Version: 09/09/2011 Date Data Arrived at EDR: 09/16/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 13 Source:  Environmental Protection Agency Telephone:  202-564-6023
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies TC3220399.2s    Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT LUCIS:  Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure
properties.
Date of Government Version: 12/09/2005 Date Data Arrived at EDR: 12/11/2006
Date Made Active in Reports: 01/11/2007
Number of Days to Update: 31 Source:  Department of the Navy Telephone:  843-820-7326
Last EDR Contact: 11/22/2011
Next Scheduled EDR Contact: 03/05/2012
Data Release Frequency: Varies Records of Emergency Release Reports
HMIRS:  Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT.
Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/04/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 38 Source:  U.S. Department of Transportation Telephone:  202-366-4555
Last EDR Contact: 10/04/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Annually SPILLS:  Spills Database A discharge of a hazardous substance that may adversely impact, or threaten to adversely impact public health,
welfare or the environment. Spills are usually cleaned up quickly.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly AG SPILLS:  Agricultural Spill Cases Spills reported to the Department of Agriculture, Trade & Consumer Protection. There are two types of spills.
Long-term: These are mainly pesticide and fertilizer cases. Some might include other contaminants at the same
site. Some might involve wood-treaters - which use pesticides. All of them involve spills of products, but these
spills generally result from day to day use (chronic spills) rather than accidental spills (acute). Accidental:
These are the acute spills of pesticides and fertilizers and only involve pesticides and fertilizers. Most of
these are cleaned up and closed within 3 to 6 months.
Date of Government Version: 08/15/2011 Date Data Arrived at EDR: 08/19/2011
Date Made Active in Reports: 10/10/2011
Number of Days to Update: 52 Source:  Department of Agriculture, Trade & Consumer Protection Telephone:  608-224-5058
Last EDR Contact: 11/14/2011
Next Scheduled EDR Contact: 02/27/2012
Data Release Frequency: Varies Other Ascertainable Records
RCRA-NonGen:  RCRA - Non Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous
waste.Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
Date Made Active in Reports: 08/08/2011
Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
Last EDR Contact: 10/05/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Varies TC3220399.2s    Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT DOT OPS:  Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data.
Date of Government Version: 07/29/2011 Date Data Arrived at EDR: 08/09/2011
Date Made Active in Reports: 11/11/2011
Number of Days to Update: 94 Source:  Department of Transporation, Office of Pipeline Safety Telephone:  202-366-4595
Last EDR Contact: 11/08/2011
Next Scheduled EDR Contact: 02/20/2012
Data Release Frequency: Varies DOD:  Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that
have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands.
Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006
Date Made Active in Reports: 01/11/2007
Number of Days to Update: 62 Source:  USGS Telephone:  888-275-8747
Last EDR Contact: 10/20/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Semi-Annually FUDS:  Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers
is actively working or will take necessary cleanup actions.
Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/12/2010
Date Made Active in Reports: 12/02/2010
Number of Days to Update: 112 Source:  U.S. Army Corps of Engineers Telephone:  202-528-4285
Last EDR Contact: 09/12/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Varies CONSENT:  Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released
periodically by United States District Courts after settlement by parties to litigation matters.
Date of Government Version: 06/01/2011 Date Data Arrived at EDR: 08/19/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 41 Source:  Department of Justice, Consent Decree Library Telephone:  Varies
Last EDR Contact: 10/03/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Varies ROD:  Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical
and health information to aid in the cleanup.
Date of Government Version: 07/31/2011 Date Data Arrived at EDR: 09/14/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 15 Source:  EPA Telephone:  703-416-0223
Last EDR Contact: 09/14/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Annually UMTRA:  Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills
shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings
were used as construction materials before the potential health hazards of the tailings were recognized.
Date of Government Version: 09/14/2010 Date Data Arrived at EDR: 10/21/2010
Date Made Active in Reports: 01/28/2011
Number of Days to Update: 99 Source:  Department of Energy Telephone:  505-845-0011
Last EDR Contact: 11/29/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Varies TC3220399.2s    Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT MINES:  Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes
violation information.
Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 09/08/2011
Date Made Active in Reports: 09/29/2011
Number of Days to Update: 21 Source:  Department of Labor, Mine Safety and Health Administration Telephone:  303-231-5959
Last EDR Contact: 12/07/2011
Next Scheduled EDR Contact: 03/19/2012
Data Release Frequency: Semi-Annually TRIS:  Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and
land in reportable quantities under SARA Title III Section 313.
Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/17/2010
Date Made Active in Reports: 03/21/2011
Number of Days to Update: 94 Source:  EPA Telephone:  202-566-0250
Last EDR Contact: 12/02/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Annually TSCA:  Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the
TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant
site.Date of Government Version: 12/31/2006 Date Data Arrived at EDR: 09/29/2010
Date Made Active in Reports: 12/02/2010
Number of Days to Update: 64 Source:  EPA Telephone:  202-260-5521
Last EDR Contact: 09/27/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Every 4 Years FTTS:  FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control A ct)FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA,
TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the
Agency on a quarterly basis.
Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009
Date Made Active in Reports: 05/11/2009
Number of Days to Update: 25 Source:  EPA/Office of Prevention, Pesticides and Toxic Substances Telephone:  202-566-1667
Last EDR Contact: 11/28/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Quarterly FTTS INSP:  FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Cont rol Act)A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements.
Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009
Date Made Active in Reports: 05/11/2009
Number of Days to Update: 25 Source:  EPA Telephone:  202-566-1667
Last EDR Contact: 11/28/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Quarterly HIST FTTS:  FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The
information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA
(Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions
are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters
with updated records, it was decided to create a HIST FTTS database. It included records that may not be included
in the newer FTTS database updates. This database is no longer updated.
TC3220399.2s    Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007
Date Made Active in Reports: 04/10/2007
Number of Days to Update: 40 Source:  Environmental Protection Agency Telephone:  202-564-2501
Last EDR Contact: 12/17/2007
Next Scheduled EDR Contact: 03/17/2008
Data Release Frequency: No Update Planned HIST FTTS INSP:  FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA
regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation
of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some
EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing
EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that
may not be included in the newer FTTS database updates. This database is no longer updated.
Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007
Date Made Active in Reports: 04/10/2007
Number of Days to Update: 40 Source:  Environmental Protection Agency Telephone:  202-564-2501
Last EDR Contact: 12/17/2008
Next Scheduled EDR Contact: 03/17/2008
Data Release Frequency: No Update Planned SSTS:  Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all
registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March
1st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices
being produced, and those having been produced and sold or distributed in the past year.
Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010
Date Made Active in Reports: 02/25/2011
Number of Days to Update: 77 Source:  EPA Telephone:  202-564-4203
Last EDR Contact: 10/31/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Annually ICIS:  Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement
and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES)
program.Date of Government Version: 01/07/2011 Date Data Arrived at EDR: 01/21/2011
Date Made Active in Reports: 03/21/2011
Number of Days to Update: 59 Source:  Environmental Protection Agency Telephone:  202-564-5088
Last EDR Contact: 09/26/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Quarterly PADS:  PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers
of PCB's who are required to notify the EPA of such activities.
Date of Government Version: 11/01/2010 Date Data Arrived at EDR: 11/10/2010
Date Made Active in Reports: 02/16/2011
Number of Days to Update: 98 Source:  EPA Telephone:  202-566-0500
Last EDR Contact: 10/19/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Annually MLTS:  Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which
possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency,
EDR contacts the Agency on a quarterly basis.
Date of Government Version: 06/21/2011 Date Data Arrived at EDR: 07/15/2011
Date Made Active in Reports: 09/13/2011
Number of Days to Update: 60 Source:  Nuclear Regulatory Commission Telephone:  301-415-7169
Last EDR Contact: 09/12/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Quarterly TC3220399.2s    Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT RADINFO:  Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S.
Environmental Protection Agency (EPA) regulations for radiation and radioactivity.
Date of Government Version: 01/11/2011 Date Data Arrived at EDR: 01/13/2011
Date Made Active in Reports: 02/16/2011
Number of Days to Update: 34 Source:  Environmental Protection Agency Telephone:  202-343-9775
Last EDR Contact: 10/13/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly FINDS:  Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and 'pointers' to other sources that contain more
detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric
Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial
enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal
Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities
Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System).
Date of Government Version: 04/14/2010 Date Data Arrived at EDR: 04/16/2010
Date Made Active in Reports: 05/27/2010
Number of Days to Update: 41 Source:  EPA Telephone:  (312) 353-2000
Last EDR Contact: 09/13/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Quarterly RAATS:  RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA
pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration
actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of
the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources
made it impossible to continue to update the information contained in the database.
Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995
Date Made Active in Reports: 08/07/1995
Number of Days to Update: 35 Source:  EPA Telephone:  202-564-4104
Last EDR Contact: 06/02/2008
Next Scheduled EDR Contact: 09/01/2008
Data Release Frequency: No Update Planned BRS:  Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation
and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG)
and Treatment, Storage, and Disposal Facilities.
Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 03/01/2011
Date Made Active in Reports: 05/02/2011
Number of Days to Update: 62 Source:  EPA/NTIS Telephone:  800-424-9346
Last EDR Contact: 11/30/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Biennially BRRTS:  Bureau of Remediation & Redevelopment Tracking System TC3220399.2s    Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT BRRTS is a tracking system of contaminated sites. It holds key information for finding out more about a site or an activity. Activity types included are: Abandoned Container - An abandoned container with potentially hazardous
contents recovered from a site. No discharge to the environment occurs. If the container did release a hazardous
substance, a spill would be associated with the site. Superfund - is a federal program created by Congress in
1980 to finance cleanup of the nation's worst hazardous waste sites. VPLE - Voluntary Property Liability Exemptions
apply to sites in which a property owner conducts an environmental investigation and cleanup of an entire property
and then receives limits on their future liability. General Property - Environmental actions which apply to the
property as a whole, rather than a specific source of contamination, such as the LUST or environmental repair
site. Examples would be off-site letters, municipal liability clarification letters, lease letters, voluntary
party liability exemption actions, and general liability clarification letters.
Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
Date Made Active in Reports: 08/01/2011
Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 11/03/2011
Next Scheduled EDR Contact: 01/23/2012
Data Release Frequency: Quarterly NPDES:  NPDES Permit Listing A listing of stormwater permit industrial facilities.
Date of Government Version: 09/01/2011 Date Data Arrived at EDR: 09/01/2011
Date Made Active in Reports: 10/14/2011
Number of Days to Update: 43 Source:  Department of Natural Resources Telephone:  608-264-8971
Last EDR Contact: 11/30/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Quarterly WI MANIFEST:  Manifest Information Hazardous waste manifest information.
Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/19/2011
Date Made Active in Reports: 09/15/2011
Number of Days to Update: 27 Source:  Department of Natural Resources Telephone:  N/A
Last EDR Contact: 09/19/2011
Next Scheduled EDR Contact: 01/02/2012
Data Release Frequency: Annually DRYCLEANERS:  Five Star Recognition Program Sites Drycleaning facilities enrolled in the Five Star Recognition Program. The primary focus of the Five Star program
is to encourage reductions in the use and emissions of perchloroethylene (perc), a common but potentially hazardous
drycleaning solvent. Participating cleaners pursue recycling opportunities, spill prevention strategies, more
efficient solvent use, and more wet cleaning to reduce their perc consumption.
Date of Government Version: 10/05/2011 Date Data Arrived at EDR: 10/06/2011
Date Made Active in Reports: 10/25/2011
Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-267-3125
Last EDR Contact: 09/23/2011
Next Scheduled EDR Contact: 01/02/2012
Data Release Frequency: Varies WRRSER:  Wisconsin Remedial Response Site Evaluation Report The WRRSER provides information about location, status, and priority of sites or facilities in the state which
are known to cause or have a high potential to cause environmental pollution.
Date of Government Version: 10/01/1995 Date Data Arrived at EDR: 01/02/1996
Date Made Active in Reports: 02/01/1996
Number of Days to Update: 30 Source:  Department of Natural Resources Telephone:  608-261-6422
Last EDR Contact: 10/03/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: No Update Planned AIRS:  Air Permit Program Listing A listing of permits issued by the Air Permit Program.
TC3220399.2s    Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/05/2011
Date Made Active in Reports: 09/15/2011
Number of Days to Update: 41 Source:  Department of Natural Resources Telephone:  608-266-2621
Last EDR Contact: 10/24/2011
Next Scheduled EDR Contact: 02/06/2012
Data Release Frequency: Annually TIER 2:  Tier 2 Facility Listing A listing of facilities which store or manufacture hazardous materials that submit a chemical inventory report.
Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/17/2010
Date Made Active in Reports: 09/29/2010
Number of Days to Update: 43 Source:  Department of Natural Resources Telephone:  608-242-3225
Last EDR Contact: 10/24/2011
Next Scheduled EDR Contact: 02/06/2012
Data Release Frequency: Varies LEAD:  Lead Inspection Data Lead inspection information.
Date of Government Version: 04/29/2011 Date Data Arrived at EDR: 04/29/2011
Date Made Active in Reports: 06/06/2011
Number of Days to Update: 38 Source:  Department of Health & Family Services Telephone:  608-267-0473
Last EDR Contact: 10/25/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Annually INDIAN RESERV:  Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater
than 640 acres.
Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 12/08/2006
Date Made Active in Reports: 01/11/2007
Number of Days to Update: 34 Source:  USGS Telephone:  202-208-3710
Last EDR Contact: 10/20/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Semi-Annually SCRD DRYCLEANERS:  State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office
of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established
drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas,
Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin.
Date of Government Version: 03/07/2011 Date Data Arrived at EDR: 03/09/2011
Date Made Active in Reports: 05/02/2011
Number of Days to Update: 54 Source:  Environmental Protection Agency Telephone:  615-532-8599
Last EDR Contact: 10/24/2011
Next Scheduled EDR Contact: 02/06/2012
Data Release Frequency: Varies FEDLAND:  Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps
of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land,
Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management,
Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service.
Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006
Date Made Active in Reports: 01/11/2007
Number of Days to Update: 339 Source:  U.S. Geological Survey Telephone:  888-275-8747
Last EDR Contact: 10/20/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: N/A COAL ASH EPA:  Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings.
TC3220399.2s    Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/17/2010 Date Data Arrived at EDR: 01/03/2011
Date Made Active in Reports: 03/21/2011
Number of Days to Update: 77 Source:  Environmental Protection Agency Telephone:  N/A
Last EDR Contact: 09/16/2011
Next Scheduled EDR Contact: 12/26/2011
Data Release Frequency: Varies FINANCIAL ASSURANCE 1:  Financial Assurance Information Listing Financial Assurance information.
Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 09/27/2011
Date Made Active in Reports: 10/14/2011
Number of Days to Update: 17 Source:  Department of Natural Resources Telephone:  608-266-6965
Last EDR Contact: 09/26/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Varies COAL ASH:  Coal Ash Disposal Site Listing A listing of coal combusion monofills.
Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/18/2011
Date Made Active in Reports: 04/12/2011
Number of Days to Update: 25 Source:  Deaprtment of Natural Resources Telephone:  608-267-3538
Last EDR Contact: 10/03/2011
Next Scheduled EDR Contact: 01/16/2012
Data Release Frequency: Varies PCB TRANSFORMER:  PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals.
Date of Government Version: 01/01/2008 Date Data Arrived at EDR: 02/18/2009
Date Made Active in Reports: 05/29/2009
Number of Days to Update: 100 Source:  Environmental Protection Agency Telephone:  202-566-0517
Last EDR Contact: 11/04/2011
Next Scheduled EDR Contact: 02/13/2012
Data Release Frequency: Varies COAL ASH DOE:  Sleam-Electric Plan Operation Data A listing of power plants that store ash in surface ponds.
Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009
Date Made Active in Reports: 10/22/2009
Number of Days to Update: 76 Source:  Department of Energy Telephone:  202-586-8719
Last EDR Contact: 10/18/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Varies FINANCIAL ASSURANCE 2:  Financial Assurance Information Listing Information for underground storage tanks. Financial assurance is intended to ensure that resources are available
to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated
facility is unable or unwilling to pay.
Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 10/19/2011
Date Made Active in Reports: 11/22/2011
Number of Days to Update: 34 Source:  Department of Commerce Telephone:  608-266-0956
Last EDR Contact: 09/26/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Varies EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas Plants:  EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants)
compiled by EDR's researchers. Manufactured gas sites were used in the United States from the 1800's to 1950's
to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture
of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production,
such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds
are potentially hazardous to human health and the environment. The byproduct from this process was frequently
disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil
and groundwater contamination.
TC3220399.2s    Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: N/A Date Data Arrived at EDR: N/A
Date Made Active in Reports: N/A
Number of Days to Update: N/A Source:  EDR, Inc.
Telephone:  N/A
Last EDR Contact: N/A
Next Scheduled EDR Contact: N/A
Data Release Frequency: No Update Planned OTHER DATABASE(S)
Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the
area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily
mean that wetlands do not exist in the area covered by the report.
CT MANIFEST:  Hazardous Waste Manifest Data Facility and manifest data. Manifest is a document that lists and tracks hazardous waste from the generator through
transporters to a tsd facility.
Date of Government Version: 12/31/2007 Date Data Arrived at EDR: 08/26/2009
Date Made Active in Reports: 09/11/2009
Number of Days to Update: 16 Source:  Department of Environmental Protection Telephone:  860-424-3375
Last EDR Contact: 11/22/2011
Next Scheduled EDR Contact: 03/05/2012
Data Release Frequency: Annually NJ MANIFEST:  Manifest Information Hazardous waste manifest information.
Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 07/20/2011
Date Made Active in Reports: 08/11/2011
Number of Days to Update: 22 Source:  Department of Environmental Protection Telephone:  N/A
Last EDR Contact: 10/18/2011
Next Scheduled EDR Contact: 01/30/2012
Data Release Frequency: Annually NY MANIFEST:  Facility and Manifest Data Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a TSD
facility.
Date of Government Version: 08/01/2011 Date Data Arrived at EDR: 08/09/2011
Date Made Active in Reports: 09/16/2011
Number of Days to Update: 38 Source:  Department of Environmental Conservation Telephone:  518-402-8651
Last EDR Contact: 11/08/2011
Next Scheduled EDR Contact: 02/20/2012
Data Release Frequency: Annually PA MANIFEST:  Manifest Information Hazardous waste manifest information.
Date of Government Version: 12/31/2008 Date Data Arrived at EDR: 12/01/2009
Date Made Active in Reports: 12/14/2009
Number of Days to Update: 13 Source:  Department of Environmental Protection Telephone:  717-783-8990
Last EDR Contact: 09/26/2011
Next Scheduled EDR Contact: 01/09/2012
Data Release Frequency: Annually RI MANIFEST:  Manifest information Hazardous waste manifest information Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 06/24/2011
Date Made Active in Reports: 06/30/2011
Number of Days to Update: 6 Source:  Department of Environmental Management Telephone:  401-222-2797
Last EDR Contact: 11/28/2011
Next Scheduled EDR Contact: 03/12/2012
Data Release Frequency: Annually TC3220399.2s    Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT VT MANIFEST:  Hazardous Waste Manifest Data Hazardous waste manifest information.
Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/26/2011
Date Made Active in Reports: 09/14/2011
Number of Days to Update: 19 Source:  Department of Environmental Conservation Telephone:  802-241-3443
Last EDR Contact: 10/24/2011
Next Scheduled EDR Contact: 02/06/2012
Data Release Frequency: AnnuallyOil/Gas Pipelines:This data was obtained by EDR from the USGS in 1994. It is referred to by USGS as GeoData Digital Line Graphs from 1:100,000-Scale Maps. It was extracted from the transportation category including some oil, but primarily
gas pipelines.
Electric Power Transmission Line Data Source:  Rextag Strategies Corp.
Telephone: (281) 769-2247
U.S. Electric Transmission and Power Plants Systems Digital GIS DataSensitive Receptors:There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivit yto environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the locat ion of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers,and nursing homes - where individuals who are sensitive receptors are likely to be located.
AHA Hospitals:
Source: American Hospital Association, Inc.
Telephone: 312-280-5991
The database includes a listing of hospitals based on the American Hospital Association's annual survey of hospitals.
Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services
Telephone: 410-786-3000
A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services,
a federal agency within the U.S. Department of Health and Human Services.
Nursing Homes Source: National Institutes of Health
Telephone: 301-594-6248
Information on Medicare and Medicaid certified nursing homes in the United States.
Public Schools Source: National Center for Education Statistics
Telephone: 202-502-7300
The National Center for Education Statistics' primary database on elementary
and secondary public education in the United States. It is a comprehensive, annual, national statistical
database of all public elementary and secondary schools and school districts, which contains data that are
comparable across all states.
Private Schools Source: National Center for Education Statistics
Telephone: 202-502-7300
The National Center for Education Statistics' primary database on private school locations in the United States.
Daycare Centers: Day Care Directory Source: Department of Health & Family Services
Telephone: 608-266-9314Flood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
Scanned Digital USGS 7.5' Topographic Map (DRG)
Source: United States Geologic Survey
A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images
are made by scanning published paper maps on high-resolution scanners. The raster image
is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
TC3220399.2s    Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT STREET AND ADDRESS INFORMATION
&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
TC3220399.2s    Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT TC3220399.2s  Page A-1 geologic strata.
of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the
Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics
: 2. Groundwater flow velocity.
: 1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components:
forming an opinion about the impact of potential contaminant migration.
EDR's GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1991Most Recent Revision:
44089-E5 STEVENS POINT, WI West Map:
1976Most Recent Revision:
44089-D5 WHITING, WI Southwest Map:
1969Most Recent Revision:
44089-D4 ARNOTT, WI South Map:
1986Most Recent Revision:
44089-E4 POLONIA, WI Target Property Map:
USGS TOPOGRAPHIC MAP 1113 ft. above sea level Elevation:
4931000.0 UTM Y (Meters):
301598.3UTM X (Meters):
Zone 16Universal Tranverse Mercator:
89.4959 - 89 29' 45.3''
Longitude (West):
44.50700 - 44 30' 25.2''
Latitude (North):
TARGET PROPERTY COORDINATES STEVENS POINT, WI 54482 LANDS END WAY,
SHINE MEDICAL STEVENS POINT, WI TARGET PROPERTY ADDRESSGEOCHECK  - PHYSICAL SETTING SOURCE ADDENDUMDRAFT TC3220399.2s  Page A-2 should be field verified.
on a relative (not an absolute) basis. Relative elevation information between sites of close proximity
Source: Topography has been determined from the USGS 7.5' Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)
Elevation (ft)
TPTP01/21 MilesTarget Property Elevation: 1113 ft.NorthSouthWestEast1106110711081110 111011111111 111111111113 111311141115111411131113 1113111211121105110511071108110911101111 111111111113 111311141115111611181120112111241125General SW General Topographic Gradient:
TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted.
assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or,
Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).
sources of information, such as surface topographic information, hydrologic information, hydrogeologic data
using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other
Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATIONGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s  Page A-3 Not Reported GENERAL DIRECTION LOCATIONGROUNDWATER FLOW FROM TPMAP IDhydrogeologically, and the depth to water table.
authorities at select sites and has extracted the date of the report, groundwater flow direction as determined
flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory
EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW Search Radius: 1.000 Mile.
Not found Status:
1.25 miles Search Radius:
Site-Specific Hydrogeological Data*:
* &#xa9;1996 Sitespecific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the inform ation and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation.
contamination exist on the target property, what downgradient sites might be impacted.
environmental professional in forming an opinion about the impact of nearby contaminated properties or, should
of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the
Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail Map NOT AVAILABLE NATIONAL WETLAND INVENTORY NWI Electronic Data Coverage NWI Quad at Target Property Not Reported Additional Panels in search area:
55097C  - FEMA DFIRM Flood data Flood Plain Panel at Target Property:
YES - refer to the Overview Map and Detail Map PORTAGE, WI FEMA FLOOD ZONE FEMA Flood Electronic Data Target Property County and bodies of water).
Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted.
the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should
Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATIONGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s  Page A-4 Map, USGS Digital Data Series DDS - 11 (1994).
of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman
Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, GeologyROCK STRATIGRAPHIC UNITGEOLOGIC AGE IDENTIFICATION Stratified Sequence Category:
Paleozoic Era:CambrianSystem:CambrianSeries:CCode:  (decoded above as Era, System & Series) at which contaminant migration may be occurring.
Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils.
characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes
to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil
using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary
Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATIONGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT EDR Inc.EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.
EDR Inc.1230  1/16  1/8 1/4 Miles DRAFT TC3220399.2s  Page A-6 Well drained Soil Drainage Class:
textures.
moderately well and well drained soils with moderately coarse
Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
sandy loam Soil Surface Texture:
BillettSoil Component Name:
Soil Map ID: 2 Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sand59 inches 40 inches 5Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 40 inches 33 inches 4Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sandy loam 33 inches 27 inches 3Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 27 inches 7 inches 2Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
conductivity
micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
> 0 inches Depth to Bedrock Min:
LowCorrosion Potential - Uncoated Steel:
Hydric Status: Not hydric Somewhat excessively drained Soil Drainage Class:
excessively drained sands and gravels.
Class A - High infiltration rates. Soils are deep, well drained to Hydrologic Group:
loamy sand Soil Surface Texture:
RichfordSoil Component Name:
Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data.
for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns
Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information
The U.S. Department of Agriculture's (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTYGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s  Page A-7 Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported loam 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
conductivity
micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
> 0 inches Depth to Bedrock Min:
LowCorrosion Potential - Uncoated Steel:
Hydric Status: Not hydric Well drained Soil Drainage Class:
textures.
moderately well and well drained soils with moderately coarse
Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
loamSoil Surface Texture:
RosholtSoil Component Name:
Soil Map ID: 3 Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 59 inches 33 inches 4Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 33 inches 27 inches 3Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 27 inches 9 inches 2Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 9 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
conductivity
micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
> 0 inches Depth to Bedrock Min:
LowCorrosion Potential - Uncoated Steel:
Hydric Status: Not hydricGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s  Page A-8 1/2 - 1 Mile SSW USGS2429210 161/2 - 1 Mile South USGS2429203 151/2 - 1 Mile WSW USGS2429044 141/2 - 1 Mile South USGS2429204 131/2 - 1 Mile NE USGS2429102 121/2 - 1 Mile WNW USGS2429076 111/2 - 1 Mile West USGS2429070 101/2 - 1 Mile West USGS2429067 91/2 - 1 Mile SSE USGS2429032 A71/2 - 1 Mile SSE USGS2429033 A61/2 - 1 Mile SE USGS2429047 51/2 - 1 Mile North USGS2429094 41/2 - 1 Mile ENE USGS2429073 31/2 - 1 Mile West USGS2429066 21/4 - 1/2 Mile SSW USGS2429048 1FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP ID1.000State Database Nearest PWS within 1 mile Federal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)
DATABASEopinion about the impact of contaminant migration on nearby drinking water wells.
professional in assessing sources that may impact ground water flow direction, and in forming an
EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported to gravel stratified sand 59 inches 33 inches 5Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandgravelly loamy 33 inches 27 inches 4Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandy loam gravelly fine 27 inches 12 inches 3Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported fine sandy loam 12 inches 7 inches 2Soil Layer InformationBoundaryClassification Saturated hydraulic
conductivity
micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)GEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s  Page A-9 1/2 - 1 Mile WSW WI3000000008386 8STATE DATABASE WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDNote: PWS System location is not always the same as well location.
No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATIONFROM TPWELL IDMAP ID1/2 - 1 Mile SSW USGS2429138 201/2 - 1 Mile ENE USGS2429081 B191/2 - 1 Mile ENE USGS2429083 B181/2 - 1 Mile ENE USGS2429082 B17FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDGEOCHECK  - PHYSICAL SETTING SOURCE SUMMARYDRAFT PHYSICAL SETTING SOURCE MAP-3220399.2s N County Boundary N Major Roads N Contour Lines @ Earthquake epicenter, Richw 5 or greater  Wa1BI'Wells Public Water Supply W*lls Cluster of Multiple Icons SITE NAME: SHINE Medical Stevens Point, WI ADDRESS: Lands End Way, Stevens Point WI 54482 LAT/LONG: 44.5070/89.4959 0 1/4 112 + Groundwater Flow Direction
@I) lndetarrninata Groundwa1ar Flow at Location (ill Grol.ndwatlr Flow Varies at Location
<HID Closest Hydrogeological Data ' i:l : Golder Associates CONTACT:
INQUIRY II: 3220399.2s DATE: December 07, 2011 11:47 am TC3220399.2s  Page A-11 2West 1/2 - 1 Mile
LowerUSGS2429066 FED USGS1964-06-0712.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1964-06-07 Ground water data end date:
Ground water data begin date: 1964-06-07 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
80.0Hole depth:
80.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1110.00Altitude:
24000Map scale:
POLONIALocation map:
NESWS01 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.49872787 Dec lon:44.50135807 Dec lat:0892955Longitude:
USGS2429048 EDR Site id:
443005Latitude:
PT-23/08E/01-0511 Site name:
443005089295501 Site no:USGSAgency cd:
1SSW 1/4 - 1/2 Mile
LowerUSGS2429048 FED USGSMap IDDirection
Distance Elevation EDR ID Number DatabaseGEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-12 CSTMean greenwich time offset:
19870429Date inventoried:
19850618Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Not Reported Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1120Altitude:
24000Map scale:
POLONIALocation map:
NWNWS06 T23N  R09E  4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.48650552 Dec lon:44.51052505 Dec lat:0892911Longitude:
USGS2429073 EDR Site id:
443038Latitude:
PT-23/09E/06-1157 Site name:
443038089291101 Site no:USGSAgency cd:
3ENE 1/2 - 1 Mile
HigherUSGS2429073 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
Not Reported Hole depth:
Not Reported Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
Not Reported Altitude datum:
Not Reported Altitude accuracy:
Not Reported Altitude method:
Not Reported Altitude:
Not Reported Map scale:
Not Reported Location map:
Not Reported Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
MCoor accr:
MCoor meth:
-89.50622809 Dec lon:44.50746908 Dec lat:0893022Longitude:
USGS2429066 EDR Site id:
443027Latitude:
PERM 24126 Site name:
443027089302201 Site no:WI001Agency cd:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-13 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
Not Reported Hole depth:
Not Reported Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
Not Reported Altitude datum:
Not Reported Altitude accuracy:
Not Reported Altitude method:
Not Reported Altitude:
Not Reported Map scale:
Not Reported Location map:
Not Reported Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
MCoor accr:
MCoor meth:
-89.49733911 Dec lon:44.51469148 Dec lat:0892950Longitude:
USGS2429094 EDR Site id:
443053Latitude:
PERM 24279 Site name:
443053089295001 Site no:WI001Agency cd:
4North 1/2 - 1 Mile
HigherUSGS2429094 FED USGS1985-06-186.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1985-06-18 Ground water data end date:
Ground water data begin date: 1985-06-18 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
other government (other than USGS)
Source of depth data:
71.0Hole depth:
71.0Well depth:
SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-14 A6SSE 1/2 - 1 Mile
HigherUSGS2429033 FED USGS1963-04-0121.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1963-04-01 Ground water data end date:
Ground water data begin date: 1963-04-01 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
116Hole depth:
116Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1130.00Altitude:
24000Map scale:
POLONIALocation map:
S06 T023N R009E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
TCoor accr:
MCoor meth:
-89.48733876 Dec lon:44.50108056 Dec lat:0892914Longitude:
USGS2429047 EDR Site id:
443004Latitude:
PT-23/09E/06-0486 Site name:
443004089291401 Site no:USGSAgency cd:
5SE 1/2 - 1 Mile
HigherUSGS2429047 FED USGSMap IDDirection
Distance Elevation EDR ID Number DatabaseGEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-15 CSTMean greenwich time offset:
Not Reported Date inventoried:
19591113Date construction:
Ground-water other than Spring Site type:
Flat surface Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
.1Altitude accuracy:
Level or other surveying method Altitude method:
1115.32Altitude:
24000Map scale:
ARNOTTLocation map:
NENENES12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:
USGS2429032 EDR Site id:
442954Latitude:
PT-23/08E/12-0361 Site name:
442954089292101 Site no:USGSAgency cd:
A7SSE 1/2 - 1 Mile
HigherUSGS2429032 FED USGS1959-10-1613.83 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1959-10-16 Ground water data end date:
Ground water data begin date: 1959-10-16 2Water quality data count:
1974-07-12 Water quality data end date:
1965-06-10 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
drillerSource of depth data:
92.0Hole depth:
87.4Well depth:
QUATERNARY Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
19591016Date construction:
Ground-water other than Spring Site type:
Flat surface Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1113.00Altitude:
24000Map scale:
ARNOTTLocation map:
NENENES12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:
USGS2429033 EDR Site id:
442954Latitude:
PT-23/08E/12-0360 Site name:
442954089292102 Site no:USGSAgency cd:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-16 Not Reported Block no:
Not Reported Lot no:Not Reported Subdivisio:
Not Reported Well stree:
Not Reported Fire:STEVENS POINT Municipal1:
CMunicipal:
0490Construc 6:
54467Construc 5:
WIConstruc 4:
PLOVERConstruc 3:
PO BOX 490 Construc 2:
3262Construc 1:
ROBERTS IRRIGATION CO INC Constructo:
01/03/2008 Dnr rece 2:
01/03/2008 Dnr rece 1:
10/18/2007 Dnr receiv:
06/21/2007 Complete d:
Not Reported Owner ph 1:
Not Reported Owner phon:
Not Reported Owner are:
Not Reported Owner zip2:
54481Owner zip1:
WIOwner stat:
STEVENS POINT Owner city:
3217 JOHN JOANIS DR Owner mail:
ADVENTURE 2120 Owner name:
Not Reported Tax parcel:
6District c:
5.0E+001County cod:
Not Reported County wel:
TY626Wi unique:
8WSW 1/2 - 1 Mile
LowerWI3000000008386 WI WELLS1959-11-139.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1959-11-13 Ground water data end date:
Ground water data begin date: 1959-11-13 1Water quality data count:
1965-06-10 Water quality data end date:
1965-06-10 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
drillerSource of depth data:
31.3Hole depth:
31.3Well depth:
QUATERNARY Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-17 Not Reported Animal yar:
0Pav anim 1:
Not Reported Pav animal:
0Wastewtr a:
Not Reported Wastewtr s:
0Clewtr amt:
Not Reported Clewtr sum:
0Coll sew 1:
Not Reported Coll sewer:
Not Reported Build se 3:
Not Reported Build se 2:
0Build se 1:
Not Reported Build sewe:
Not Reported Build dr 2:
0Build dr 1:
Not Reported Build drai:
0Found dr 1:
Not Reported Found drai:
0Found cl 1:
Not Reported Found clwt:
0Privy amt:
Not Reported Privy code:
0Dwnspot 1:
Not Reported Dwnspot hy:
0Shorline p:
Not Reported Shoreline:
0Buried p 1:
Not Reported Buried pet:
0Buried o 1:
Not Reported Buried oil:
0Nonconfo 1:
Not Reported Nonconform:
0Sew abso 1:
Not Reported Sew absorb:
0Septic t 1:
Not Reported Septic tan:
1.4E+001Build oh a:
Not Reported Build over:
0Landfill a:
Not Reported Landfill q:
NFlood plai:
Not Reported Highest po:
NHicap prop:
NHicap well:
IRRIGATION Facility t:
Not Reported Service co:
XWell categ:
Not Reported Other expl:
1Well type:
Not Reported New well i:
Not Reported Prev well:
Not Reported Replace re:
Not Reported Orig year:
1Well statu:
EE w:8.0E+000Range no:
2.3E+001Township n:
2.0E+000Section:NEQuar:SEQuar quar:
Not Reported Govt lot:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-18 BStatic w 1:
2.7E+001Static wtr:
Not Reported Depth:SSacks ya 1:
Not Reported Seal num 1:
5.3E+001Seal to 1:
3.1E+001Seal from1:
#20 RED FLINT Seal kind1:
SSacks yard:
Not Reported Seal numbe:
3.1E+001Seal to am:
0Seal from:
DRILL CUTTINGS Seal kind:
Not Reported Seal metho:
5.3E+001Screen to:
4.3E+001Screen fro:
JOHNSON #20 GALV Screen Type:
6.0E+000Screen dia:
0Cls to a 3:
0Cls to a 2:
0Cls to a 1:
4.3E+001Cls to amt:
0Cls from 3:
0Cls from 2:
0Cls from 1:
0Cls from a:
Not Reported Cls desc 3:
Not Reported Cls desc 2:
Not Reported Cls desc 1:
A53 BLACK NORTHWEST PIPE .280 WELDED Cls desc t:
0Cls dia 3:
0Cls dia 2:
0Cls dia 1:
6.0E+000Cls dia am:
Not Reported Other ex 1:
Not Reported Other dril:
Not Reported Remove exp:
Not Reported Temp otr r:
0Dia temp a:
Not Reported Tem otr ca:
0Cable bit1:
Not Reported Cable bit:
Not Reported Rev rot co:
Not Reported Rot foam c:
Not Reported Rot air co:
XRot mud co:
0Dr4 to amt:
0Dr4 from a:
0Dr4 dia am:
0Dr3 to amt:
0Dr3 from a:
0Dr3 dia am:
0Dr2 to amt:
0Dr2 from a:
0Dr2 dia am:
5.3E+001Dr1 to amt:
0Dr1 from a:
9.0E+000Dr1 dia am:
Not Reported Nr112 text:
0Nr 112 a 1:
Not Reported Nr 112 amt:
Not Reported Manure s 2:
0Manure s 1:
Not Reported Manure sto:
Not Reported Manure t 1:
Not Reported Manure typ:
0Manure p 1:
Not Reported Manure pip:
0Barn gut 1:
Not Reported Barn gutte:
Not Reported Silo type:
0Silo amt:
Not Reported Silo:0Animal y 1:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-19 9West 1/2 - 1 Mile
LowerUSGS2429067 FED USGSWI3000000008386 Site id:Not Reported Empty gy:
26915464Notificati:
WELL CONSTRUCTION Record sou:
1117Batch:4Spec capac:
09/07/2006 Approval d:
Not Reported Approval n:
Not Reported Fid 1:Not Reported Common wel:
Not Reported Hicap no:
0Collet sew:
Not Reported Collect se:
Not Reported Varince is:
Not Reported Temp outer:
Not Reported Lower cabl:
Not Reported Lower ro 2:
Not Reported Lower ro 1:
Not Reported Lower rota:
Not Reported Drill casi:
GPS008Lat long m:
30.555Long minut:
89Long degre:
30.192Lat minute:
44Lat degree:
PORTAGECounty tex:
5.3E+001Bottom:05/22/2008 File creat:
Not Reported Shoreline1:
Not Reported Septic typ:
0Ditch amt:
YLabel sent:
Not Reported Comment fl:
10/15/2007 Ro sign da:
PRRig op ini:
10/15/2007 Wc sign da:
JPWell cont:
Not Reported Proper s 1:
Not Reported Proper sea:
YWell cappe:
YWell disin:
YWell dev c:
AWell abvbe:
1.3E+001Well depth:
1.0E+000Pump hrs t:
MPump by co:
3.0E+001Pump gals:
3.4E+001Pump wtr b:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-20 CSTMean greenwich time offset:
19870422Date inventoried:
19830603Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Not Reported Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1112Altitude:
24000Map scale:
STEVENS POINT Location map:
NENWS01 T23N  R08E  4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.51122822 Dec lon:44.50913568 Dec lat:0893040Longitude:
USGS2429070 EDR Site id:
443033Latitude:
PT-23/08E/01-1125 Site name:
443033089304001 Site no:USGSAgency cd:
10West 1/2 - 1 Mile
LowerUSGS2429070 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
78.0Hole depth:
78.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
10Altitude accuracy:
Interpolated from topographic map Altitude method:
1105.00Altitude:
24000Map scale:
STEVENS POINT Location map:
NWSENES02 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.51095042 Dec lon:44.50746901 Dec lat:0893039Longitude:
USGS2429067 EDR Site id:
443027Latitude:
PT-23/08E/02-0895 Site name:
443027089303901 Site no:USGSAgency cd:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-21 1Ground water data count:
1975-05-05 Ground water data end date:
Ground water data begin date: 1975-05-05 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
45.0Hole depth:
45.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1106.00Altitude:
24000Map scale:
STEVENS POINT Location map:
NENES02 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.51095046 Dec lon:44.51108014 Dec lat:0893039Longitude:
USGS2429076 EDR Site id:
443040Latitude:
PT-23/08E/02-0875 Site name:
443040089303901 Site no:USGSAgency cd:
11WNW1/2 - 1 Mile
LowerUSGS2429076 FED USGS1983-06-037.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1983-06-03 Ground water data end date:
Ground water data begin date: 1983-06-03 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
other government (other than USGS)
Source of depth data:
54.0Hole depth:
54.0Well depth:
SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-22 13South 1/2 - 1 Mile
LowerUSGS2429204 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
other government (other than USGS)
Source of depth data:
76Hole depth:
76Well depth:
SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
19870203Date inventoried:
19820512Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Not Reported Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1117Altitude:
24000Map scale:
POLONIALocation map:
NWSWS31 T024N R009E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
TCoor accr:
MCoor meth:
-89.48678338 Dec lon:44.51663617 Dec lat:0892912Longitude:
USGS2429102 EDR Site id:
443100Latitude:
PT-24/09E/31-1076 Site name:
443100089291201 Site no:USGSAgency cd:
12NE1/2 - 1 Mile
HigherUSGS2429102 FED USGS1975-05-0523.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-23 CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
2.5Altitude accuracy:
Interpolated from topographic map Altitude method:
1100.00Altitude:
24000Map scale:
WHITINGLocation map:
SESES02 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.51122811 Dec lon:44.49996898 Dec lat:0893040Longitude:
USGS2429044 EDR Site id:
443000Latitude:
PT-23/08E/02-0593 Site name:
443000089304001 Site no:USGSAgency cd:
14WSW 1/2 - 1 Mile
LowerUSGS2429044 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
78.0Hole depth:
78.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1110.00Altitude:
24000Map scale:
ARNOTTLocation map:
NES12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.49345004 Dec lon:44.49413604 Dec lat:0892936Longitude:
USGS2429204 EDR Site id:
442939Latitude:
PT-23/08E/12-1054 Site name:
442939089293601 Site no:USGSAgency cd:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-24 4Ground water data count:
1953-10-14 Ground water data end date:
Ground water data begin date: 1950-07-20 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
30.0Hole depth:
29.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1100.00Altitude:
24000Map scale:
ARNOTTLocation map:
SWNES12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
SCoor accr:
MCoor meth:
-89.49706122 Dec lon:44.49385818 Dec lat:0892949Longitude:
USGS2429203 EDR Site id:
442938Latitude:
PT-23/08E/12-0002 Site name:
442938089294901 Site no:USGSAgency cd:
15South1/2 - 1 Mile
LowerUSGS2429203 FED USGS1967-05-0421.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 1 1Ground water data count:
1967-05-04 Ground water data end date:
Ground water data begin date: 1967-05-04 0Water quality data count:
0000-00-00 Water quality data end date:
0000-00-00 Water quality data begin date:
0Peak flow data count:
0000-00-00 Peak flow data end date:
0000-00-00 Peak flow data begin date:
0Daily flow data count:
0000-00-00 Daily flow data end date:
0000-00-00 Daily flow data begin date:
0Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
86.0Hole depth:
86.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-25 B17ENE 1/2 - 1 Mile
HigherUSGS2429082 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
90.0Hole depth:
90.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1105.00Altitude:
24000Map scale:
WHITINGLocation map:
NWNWS12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
SCoor accr:
MCoor meth:
-89.50567249 Dec lon:44.49580245 Dec lat:0893020Longitude:
USGS2429210 EDR Site id:
442945Latitude:
PT-23/08E/12-0894 Site name:
442945089302001 Site no:USGSAgency cd:
16SSW1/2 - 1 Mile
LowerUSGS2429210 FED USGS1950-10-1710.421950-07-2010.031953-10-149.201950-11-2510.91 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
DateFeet below SurfaceFeet toSealevel-------------------------------------------------
Ground-water levels, Number of Measurements: 4GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-26 CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
Not Reported Altitude datum:
Not Reported Altitude accuracy:
Not Reported Altitude method:
Not Reported Altitude:
Not Reported Map scale:
Not Reported Location map:
Not Reported Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
MCoor accr:
MCoor meth:
-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
USGS2429083 EDR Site id:
443043Latitude:
PERM 24110 Site name:
443043089284103 Site no:WI001Agency cd:
B18ENE 1/2 - 1 Mile
HigherUSGS2429083 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
Not Reported Hole depth:
Not Reported Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
Not Reported Altitude datum:
Not Reported Altitude accuracy:
Not Reported Altitude method:
Not Reported Altitude:
Not Reported Map scale:
Not Reported Location map:
Not Reported Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
MCoor accr:
MCoor meth:
-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
USGS2429082 EDR Site id:
443043Latitude:
PERM 23908 Site name:
443043089284102 Site no:WI001Agency cd:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-27 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
96.0Hole depth:
96.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1132.00Altitude:
24000Map scale:
POLONIALocation map:
SESWS31 T024N R009E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
FCoor accr:
MCoor meth:
-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
USGS2429081 EDR Site id:
443043Latitude:
PT-24/09E/31-0828 Site name:
443043089284101 Site no:USGSAgency cd:
B19ENE 1/2 - 1 Mile
HigherUSGS2429081 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
Not Reported Source of depth data:
Not Reported Hole depth:
Not Reported Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:GEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-28 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
Not Reported Ground water data end date:
Ground water data begin date: Not Reported Not Reported Water quality data count:
Not Reported Water quality data end date:
Not Reported Water quality data begin date:
Not Reported Peak flow data count:
Not Reported Peak flow data end date:
Not Reported Peak flow data begin date:
Not Reported Daily flow data count:
Not Reported Daily flow data end date:
Not Reported Daily flow data begin date:
Not Reported Real time data flag:
Not Reported Project number:
drillerSource of depth data:
80.0Hole depth:
80.0Well depth:
Not Reported Aquifer:Not Reported Aquifer Type:
Single well, other than collector or Ranney type Type of ground water site:
YLocal standard time flag:
CSTMean greenwich time offset:
Not Reported Date inventoried:
Not Reported Date construction:
Ground-water other than Spring Site type:
Not Reported Topographic:
Castle Rock. Wisconsin. Area = 3250 sq.mi.
Hydrologic:
National Geodetic Vertical Datum of 1929 Altitude datum:
5Altitude accuracy:
Interpolated from topographic map Altitude method:
1110.00Altitude:
24000Map scale:
WHITINGLocation map:
NWSENWS12 T023N R008E 4 Land net:
USCountry:097County:55State:55District:
NAD83Dec latlong datum:
NAD27Latlong datum:
SCoor accr:
MCoor meth:
-89.50372802 Dec lon:44.49385806 Dec lat:0893013Longitude:
USGS2429138 EDR Site id:
442938Latitude:
PT-23/08E/12-0512 Site name:
442838089301301 Site no:USGSAgency cd:
20SSW 1/2 - 1 Mile
LowerUSGS2429138 FED USGSMap IDDirection
Distance Elevation EDR ID Number DatabaseGEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s  Page A-29 0%33%67%4.258 pCi/L BasementNot Reported Not Reported Not Reported Not Reported Living Area - 2nd Floor 0%0%100%1.150 pCi/L Living Area - 1st Floor
% >20 pCi/L
% 4-20 pCi/L
% <4 pCi/L Average Activity AreaNumber of sites tested: 24
Federal Area Radon Information for PORTAGE COUNTY, WI
            : Zone 3 indoor average level < 2 pCi/L.
            : Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L.
Note: Zone 1 indoor average level > 4 pCi/L.
Federal EPA Radon Zone for PORTAGE County:  1 AREA RADON INFORMATIONGEOCHECK  - PHYSICAL SETTING SOURCE MAP FINDINGS RADONDRAFT TOPOGRAPHIC INFORMATION USGS 7.5' Digital Elevation Model (DEM)
Source: United States Geologic Survey
EDR acquired the USGS 7.5' Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds
to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data
with consistent elevation units and projection.
Scanned Digital USGS 7.5' Topographic Map (DRG)
Source: United States Geologic Survey
A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images
are made by scanning published paper maps on high-resolution scanners. The raster image
is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
HYDROLOGIC INFORMATIONFlood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
HYDROGEOLOGIC INFORMATION AQUIFLOW      Information System RSource:  EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has
extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table
information.
GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital
representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994).STATSGO:State Soil Geographic Database Source:  Department of Agriculture, Natural Resources Conservation Services
The U.S. Department of Agriculture's (USDA) Natural Resources Conservation Service (NRCS) leads the national
Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil
survey information for privately owned lands in the United States. A soil map in a soil survey is a representation
of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO)
soil survey maps.
SSURGO: Soil Survey Geographic Database Source:  Department of Agriculture, Natural Resources Conservation Services (NRCS)
Telephone:  800-672-5559
SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping
scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to
construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the
original soil survey maps. This level of mapping is designed for use by landowners, townships and county
natural resource planning and management.
TC3220399.2s    Page A-30 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLSPWS:Public Water Systems Source:  EPA/Office of Drinking Water
Telephone:  202-564-3750
Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources.PWS ENF:Public Water Systems Violation and Enforcement Data Source:  EPA/Office of Drinking Water
Telephone:  202-564-3750
Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS).USGS Water Wells: USGS National Water Inventory System (NWIS)
This database contains descriptive information on sites where the USGS collects or has collected data on surface
water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater.
STATE RECORDS
Wisconsin Well Construction Report File Source:  Department of Natural Resources
Telephone:  608-266-0153
In the past, not all latitude/longitudes were accurate. Many were protracted from centroid (center of the quarter sections given in PLSS). The ones that were not accurate were removed from the well database.
OTHER STATE DATABASE INFORMATION RADONState Database: WI Radon Source: Department of Health & Family Services
Telephone: 608-266-1865
Wisconsin Measurement Summary Area Radon Information Source: USGS
Telephone:  703-356-4020
The National Radon Database has been developed by the U.S. Environmental Protection Agency
(USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey.
The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at
private sources such as universities and research institutions.
EPA Radon Zones Source:  EPA
Telephone:  703-356-4020
Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor
radon levels.
OTHERAirport Landing Facilities:Private and public use landing facilities Source:  Federal Aviation Administration, 800-457-6656Epicenters:World earthquake epicenters, Richter 5 or greater Source:  Department of Commerce, National Oceanic and Atmospheric Administration TC3220399.2s    Page A-31 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT STREET AND ADDRESS INFORMATION
&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
TC3220399.2s    Page A-32 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT}}

Revision as of 17:01, 3 July 2018

Shine Medical Technologies, Inc., Application for Construction Permit Response to Environmental Requests for Additional Information, Enclosure 2 Attachment 19 - Draft Phase I Environmental Site Assessment (Stevens Point, Wi) [Part 1 of 9]
ML13309B013
Person / Time
Site: SHINE Medical Technologies
Issue date: 02/10/2012
From:
SHINE Medical Technologies
To:
Office of Nuclear Reactor Regulation
Shared Package
ML13303A887 List:
References
113-81093, SMT-2013-034
Download: ML13309B013 (111)


Text

156 pages follow ENCLOSURE 2 ATTACHMENT 19

SHINE MEDICAL TECHNOLOGIES, INC.

SHINE MEDICAL TECHNOLOGIES, INC. APPLICATION FOR CONSTRUCTION PERMIT RESPONSE TO ENVIRONMENTAL REQUESTS FOR ADDITIONAL INFORMATION DRAFT PHASE I ENVIRONMENTAL SITE ASSESSMENT STEVENS POINT, WISCONSIN FEBRUARY 10, 2012 Aworldcapabilitieslocally

REPORTPHASE I ENVIRONMENTAL SITE ASSESSMENTSHINE MEDICAL STEVENS POINT, WI T23N R8W, SECTION 1 STEVENS POINT, WI 54481SubmittedTo:SHINE Medical Technologies8123 Forsythia St. Suite 140 Middleton,WI 53562 Submitted By:

Golder Associates Inc.

4438 Haines Road

Duluth, MN 55811February 10, 2012Project No. 113-81093 DRAFT Golder Associates 4438 Haines Road Duluth, MN 55811 Ph. 218-724-0088 Fax 218-724-0089 February 10, 2012 Dr. Gregory Piefer/CEO SHINE Medical Technologies

8123 Forsythia St. Suite 140

Middleton, WI 53562 Our Ref: 113-81093 RE: Phase I Environmental Site Assessment P113-81093 SHINE Medical - Stevens Point, WI

Lands End Way

Stevens Point, WI

Dear Dr. Piefer:

Golder Associates (Golder) is pleased to present to SHINE Medical Technolgies this Phase IEnvironmental Site Assessment Report for the Subject Property. Information presented in this Report is subject to the general limitations presented in the Report and Golder's Proposal dated December 7,

2011.Golder appreciates this opportunity to assist you with your environmental needs. If you have any questions or comments regarding the information presented in this report, please call our office.

Sincerely, GOLDER ASSOCIATES INC.

Kathryn R Larson Kathryn R Larson Senior Project Geologist Golder Associates DRAFT 2/10/2012 Table of Contents Project No. 113-81093SUMMARY1...............................................................................................................................

.....................

1.0INTRODUCTION

2...............................................................................................................................

.....1.1Purpose 2...............................................................................................................................

........1.2Scope of Services 2........................................................................................................................1.3Limitations and Exceptions3

..........................................................................................................1.4Special Terms and Conditions4

.....................................................................................................1.5User Reliance 4..............................................................................................................................2.0PROPERTY DESCRIPTION5

..................................................................................................................2.1Location and Legal Description5

...................................................................................................2.2Site and Vicinity General Characteristics5

.....................................................................................2.3Current Use of the Subject Property5

............................................................................................2.4Description of Structures, Roads, and Other Improvements on the Subject Property5

.................2.5Current Use of Adjoining Properties6

............................................................................................3.0USER PROVIDED INFORMATION7

........................................................................................................3.1Environmental Cleanup Liens7

......................................................................................................3.2Activity and Use Limitations7

.........................................................................................................3.3Relationship of the Purchase Price to the Fair Market Value7

.......................................................3.4Commonly Known or Reasonably Ascertainable Information7

......................................................3.5The Degree of Obviousness or the Presence of Contamination8

.................................................3.6Reason for Conducting ESA8

........................................................................................................4.0RECORDS REVIEW 9..............................................................................................................................4.1Standard Environmental Records Sources, Federal and State9

...................................................4.1.1Subject Property Database Listing9

....................................................................................4.1.2Off-Site Properties Database Listings10

.............................................................................4.1.3Orphans Summary10

..........................................................................................................4.1.4Other Agency Records10

....................................................................................................4.2Additional Environmental Record Sources10

................................................................................4.3Physical Setting Sources10

...........................................................................................................4.3.1Sources Reviewed10

..........................................................................................................4.3.2General Topographic Setting of the Area10

........................................................................4.3.3Geologic and Hydrogeologic Setting10

...............................................................................4.3.4Surface Water and Hydrologic Setting11

............................................................................4.4Historical Use Information on the Subject Property11

...................................................................4.4.1Subject Property Historical Use Summary11

......................................................................4.4.2Standard Historical Records11

...........................................................................................4.5Historical Use Information on Adjoining Properties13

...................................................................5.0SITE RECONNAISSANCE14

...................................................................................................................5.1Methodology and Limiting Conditions14

........................................................................................5.2General Site Setting14

...................................................................................................................5.2.1Current Use of the Subject Property14

...............................................................................5.2.2Past Use of the Subject Property14

....................................................................................5.2.3General Description of Structures14

...................................................................................5.2.4Roads 14..............................................................................................................................5.2.5Potable Water Supply14

......................................................................................................5.2.6Sewage Disposal System14

...............................................................................................

DRAFT 2/10/2012 Table of Contents Project No. 113-810935.3Interior and Exterior Observations15

.............................................................................................5.3.1Storage Tanks15

.................................................................................................................5.3.2Odors 15..............................................................................................................................5.3.3Pools of Liquid15

.................................................................................................................5.3.4Drums 15.............................................................................................................................5.3.5Hazardous Substance and Petroleum Product Containers15

.............................................5.3.6Unidentied Substance Containers15

.................................................................................5.3.7Evidence of Polychlorinated Biphenyls15

...........................................................................5.3.8Heating/Conditioning15

.......................................................................................................5.3.9Stains or Corrosion15

.........................................................................................................5.3.10Drains and Sumps15

...........................................................................................................5.3.11Pits, Ponds, or Lagoons16

..................................................................................................5.3.12Stained Soil or Pavements16

..............................................................................................5.3.13Stressed Vegetation16

........................................................................................................5.3.14Solid Waste Disposal16

......................................................................................................5.3.15Waste Water 16....................................................................................................................5.3.16Wells 16...............................................................................................................................5.3.17Septic Systems16

...............................................................................................................5.3.18Other Interior and Exterior Observations16

........................................................................5.4Off-Site Conditions 16.....................................................................................................................5.4.1Adjoining Properties16

........................................................................................................5.4.2Other Surrounding Properties16

.........................................................................................6.0INTERVIEWS 17...............................................................................................................................

........6.1Overview 17...............................................................................................................................

.....6.2Interview with Owners, Past Owners, Past Operators and Past Occupants17

..............................6.3Interview with Site Manager17

.......................................................................................................6.4Interview with Occupants17

...........................................................................................................6.5Interview with Local Government Ofcials18.................................................................................6.6Interviews with Others18

...............................................................................................................7.0DISCUSSION 19...............................................................................................................................

........7.1Findings and Opinions19

...............................................................................................................7.1.1Recognized Environmental Conditions19

...........................................................................7.1.2Historical Recognized Environmental Conditions19

...........................................................7.1.3De Minimis Conditions19

....................................................................................................7.2Additional Investigation19

..............................................................................................................7.3Data Gaps 19...............................................................................................................................

...

8.0CONCLUSION

S 20...............................................................................................................................

....9.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS21

...........................

10.0REFERENCES

22...............................................................................................................................

......LIST OF FIGURESFIGURE 1 VICINITY MAP FIGURE 2 SITE MAP LIST OF APPENDICESAppendix A Legal Description of the Subject Property/Chain of Title Report Appendix B Federal and State Regulatory Database Search DRAFT 2/10/2012 Table of Contents Project No. 113-81093Appendix C Historical DocumentationAppendix D Photographs Recorded During the Subject Property Inspection

Appendix E User Questionnaire Appendix F Resumes of Environmental Professionals DRAFT 2/10/20121Project No. 113-81093 SUMMARYSHINE Medical retained Golder Associates Inc. (Golder) to perform a Phase I Environmental SiteAssessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose ofthis Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December

15th, 2011 (the Proposal), and Golder's professional judgment.

This Summary is to be used only in conjunction with the attached Phase I ESA for SHINE Medical, Stevens Point, Wisconsin dated February 2, 2012 (the Report). All definitions used in this Summary have the same meanings as in the Report, and the use of this Summary is subject to the limitations and conditions contained in the Report. The Report shall govern in the event of any inconsistency between

this Summary and the Report.

This assessment has revealed no evidence of RECs in connection with the Subject Property except for the following:

Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and

herbicides is a de minimis condition.

De minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.

DRAFT 2/10/20122Project No. 113-8109

31.0INTRODUCTION

1.1PurposeSHINE Medical (the User) retained Golder Associates Inc. (Golder) to perform a Phase I EnvironmentalSite Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposaldated December 7, 2011, and Golder's professional judgment. Golder representatives performed the Phase I ESA in conformance with these criteria.The AAI Rule states that the ASTM Standard may be used to comply with the requirements of the AAI Rule, so whenever reference is made in this Report to the ASTM Standard, it shall include the AAI Rule.

The ASTM Standard defines RECs as "the presence or likely presence of any hazardous substances orpetroleum products on a property under conditions that indicate an existing release, a past release, or amaterial threat of a release of any hazardous substances or petroleum products into structures on the property or into the ground, groundwater, or surface water of the property. The term includes hazardous

substances or petroleum products even under conditions in compliance with laws."1.2Scope of Services The scope of services for this ESA consisted of the following tasks:

Records Review

  • Reviewing property information to confirm the legal description and location of the Subject Property.

This information is included in Appendix A;*Reviewing environmental record sources including federal and state regulatory databases to identifyfacilities with past or current regulatory enforcement actions within applicable distances of the Subject Property as defined in the ASTM Standard. The regulatory database search report is

presented in Appendix B;*Reviewing physical setting information sources to identify information about the geologic,hydrogeologic, hydrologic, and topographic conditions in the area of the Subject Property. The U.S.

Geological Survey (USGS) 7.5-minute topographic map of the area of the Subject Property is shown on Figure 1;*Reviewing historical record sources to identify past land use activities at the Subject Property andsurrounding properties. Selected historical information obtained during performance of the Phase I

ESA investigation is included in Appendix C.

Site Reconnaissance

  • Performing a visual inspection of the Subject Property and surrounding properties to identify potentialsources of chemical and petroleum contamination such as aboveground storage tanks (ASTs),underground storage tanks (USTs), potential sources of polychlorinated biphenyls (PCBs),chemicals, and hazardous materials. Surficial evidence of potential RECs such as distressedvegetation, stained soils, and/or stained paving was also evaluated. Photographs recorded during the site reconnaissance are included in Appendix D.

DRAFT 2/10/20123Project No. 113-81093 Interviews*Interviewing available individuals with knowledge of current or historical use, storage, or disposal ofpotentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. User provided information is included in Appendix E.

Report Preparation

  • Preparing a report that documents the findings, opinions, and conclusions of the Phase I ESAinvestigation conducted at the Subject Property, and provides the supporting documentation and references for those findings, opinions, and conclusions (the Report). Resumes for the environmentalprofessionals that performed the assessment and prepared this Phase I ESA Report are included in Appendix F. 1.3Limitations and ExceptionsGolder performed our services in accordance with the following principles, which are an integral part ofthe ASTM Standard: (i) No environmental site assessment can wholly eliminate uncertainty regardingthe potential for RECs in connection with a property. Performance of this ESA is intended to reduce, but not eliminate, uncertainty regarding the potential for RECs in connection with the Subject Property, andthe ASTM Standard recognizes reasonable limits of time and cost; (ii) "all appropriate inquiry" does not mean an exhaustive assessment of a property. Golder performed this ESA in conformance with the ASTM Standard's principle of identifying a balance between the competing goals of limiting the costs and time demands inherent in performing an ESA and the reduction of uncertainty about unknownconditions resulting from additional information; (iii) not every property warrants the same level ofassessment - the type of property subject to the assessment, the expertise and risk tolerance of the user, and the information developed in the course of the inquiry guided the appropriate level of assessment for this ESA; and (iv) ESAs must be evaluated based on the reasonableness of judgments made at the time and under the circumstances in which they were made. Subsequent ESAs should not be considered valid standards to judge the appropriateness of any prior assessment based on hindsight,

new information, use of developing technology or analytical techniques, or other factors.

Along with all of the limitations set forth in various sections of the ASTM E 1527-00 protocol, the accuracy and completeness of this report may be limited by the following:

Access Limitations - None

Physical Obstructions to Observations - Dormant winter vegetation, dense woodland

Outstanding Information Requests - None

Other - None The information and conclusions contained in this report are based upon work undertaken by trained professional and technical staff in accordance with generally accepted engineering and scientific practices current at the time the work was performed. The conclusions and recommendations presented represent the best judgment of Golder based on the data obtained from the work. Due to the nature of investigation and the limited data available, Golder cannot warrant against undiscovered environmental liabilities. Conclusions and recommendations presented in this report should not be construed as legal advice.

Should additional information become available which differs significantly from our understanding of conditions presented in this report, we request that this information be brought to our attention so that

we may reassess the conclusions provided herein.

DRAFT 2/10/20124Project No. 113-810931.4Special Terms and Conditions No special terms and conditions are applicable to this ESA.1.5User RelianceGolder has prepared this Report at the request of the User for the purpose identified by the User inSection 3.6. Use of the information contained in this Report by anyone other than User is permissible only with the prior written authorization to do so from Golder, and only under the conditions allowed by the ASTM Standard. Golder is not responsible for independent conclusions, opinions, or recommendations made by others or otherwise based on the findings presented in this Report.

DRAFT 2/10/20125Project No. 113-810932.0PROPERTY DESCRIPTION2.1Location and Legal DescriptionTheSubject Property is located at T23N, R8W, Section 1, Stevens Point, WI. The parcel is located onequarter-mile north of County Road HH and one half-mile west of Burbank Road and is accessed by a private road that extends west from Burbank Road. The square-shaped parcel is comprised of

88.08 acres of land. The Subject Property is located in Section 1, T23N, R8W on the United States Geological Survey(USGS) 7.5-minute, Polonia, WI topographic quadrangle map, as shown on Figure 1. The Assessor'sParcel Numbers for the Subject Property are 020-23-0801-01.04, 020-23-0801-02.02,020-23-0801-02.06, 020-23-0801-03.01, 020-23-0801-03.02, 020-23-0801-04.01, 030-23-0801-13, and 030-23-0801-14.The Subject Property is located at approximately 44 30' 27.45"N and89 29' 41.70"W.

The site layout is shown on Figure 2. According to The City of Stevens Point, the legal description for the Subject Property is a parcel of landlocated in the NE 1/4 of the NE 1/4 of the NE 1/4 of Section 1, T23N, R8W, Town of Hull and Town ofPlover, Marathon and Portage Counties, Wisconsin bounded and described in Appendix A. A copy of the description is included in Appendix A.2.2Site and Vicinity General CharacteristicsThe Subject Property is located on the eastern edge of Stevens Point, WI . The adjacent properties to the north, south, and east of the Subject Property are rural, consisting of agricultural and forest land and,according to aerial photographs, has been agricultural and forest land since at least 1938. The adjacent properties to the west of the Subject Property are developed as industrial and residential areas.

Development to the west of the Subject Property has occurred recently with the adjacent property being developed after 1998. A rail line exists within one quarter-mile to the north of the Subject Property. The

rail line has been north of the Subject Property since at least 1938.

The topographic gradient is low and gently slopes to Portage River and McDill Pond located approximately 2 miles to the southwest. 2.3Current Use of the Subject Property The Subject Property is used for agriculture and forestry. No buildings exist on the property.

Pesticides and herbicides are applied to the agricultural areas of the Subject Property bi-annually. No hazardous substances or petroleum products are stored, generated, or disposed of on site.

Selective tree harvesting has occurred on the wooded portions of the parcel. 2.4Description of Structures, Roads, and Other Improvements on the Subject PropertyNo structures exist on the Subject Property.

A private access road extends west from Burbank Road through the subject property.

A private trap shooting range located near the center of the Subject Property is used approximately twice a year.

Residences and businesses in the vicinity of the Subject Property are served by municipal water from the city of Stevens Point Wisconsin. Wastewater in the vicinity of the Subject Property is handled by the

City of Stevens Point Wastewater Treatment system.

DRAFT 2/10/20126Project No. 113-810932.5Current Use of Adjoining Properties The adjoining property uses are described below:

North - Agriculture and woodland. A rail line exists just north of these parcels.

East - Agriculture and woodland.

South - Agriculture and woodland.

West - Industrial Park. A Land's End Inlet occupies the adjoining parcel.

DRAFT 2/10/20127Project No. 113-810933.0USER PROVIDED INFORMATIONThe ASTM Standard defines User as the party seeking to use Practice E 1527 to complete an ESA ofthe Subject Property. The ASTM Standard requires the User to provide certain information to theenvironmental professional. Golder has provided a User Questionnaire to SHINE Medial to facilitate the transfer of this information to Golder. Dawn Sovinec of SHINE Medical completed the User Questionnaire and provided it to Golder on December 21st, 2011. A copy of the completed User

Questionnaire is included in Appendix E. 3.1Environmental Cleanup LiensGolder representatives asked the User about their knowledge of environmental cleanup liens against the

Subject Property that are filed or recorded under federal, tribal, state or local law. The User replied:

User has no knowledge of environmental cleanup liens on the Subject Property.3.2Activity and Use LimitationsGolder representatives asked the User about their knowledge of activity and use limitations (AULs),such as engineering controls, land use restrictions or institutional controls that are in place on theSubject Property or have that been filed or recorded in a registry under federal, tribal, state or local law.

The User replied:

User has no information regarding activity or land use limitations at the Subject Property.3.3Relationship of the Purchase Price to the Fair Market ValueGolder representatives asked the User if the purchase price being paid for this property reasonably reflects the fair market value of the property. The User replied:

User believes the purchase price being paid for the Subject Property reasonably reflects the fair market value of the property. 3.4Commonly Known or Reasonably Ascertainable InformationGolder representatives asked the User if they were aware of commonly known or reasonably ascertainable information about the Subject Property that would assist the environmental professional inidentifying conditions indicative of releases or threatened releases. Golder representatives asked the following questions:

a) Do you know the past uses of the Subject Property? The User replied:

The User knows that the Subject Property has been used as an agricultural field and that selective tree harvesting/logging has occurred on the wooded portions of the parcel, and is being used for such purposes currently.b) Do you know of specific chemicals that are present or once were present at the Subject Property?

The User replied:

The User has no information regarding specific chemicals that are, or once were, present at the Subject

Property.c) Do you know of spills or other chemical releases that have taken place at the Subject Property? The User replied:

The User knows of no spills or other chemical releases that have taken place at the Subject Property.

DRAFT 2/10/20128Project No. 113-81093d) Do you know of any environmental cleanups that have taken place at the Subject Property? The User replied:

The User knows of no environmental cleanups that have taken place at the Subject Property. 3.5The Degree of Obviousness or the Presence of ContaminationGolder representatives asked the User if, based on User's knowledge and experience related to theSubject Property, there are any obvious indicators that point to the presence or likely presence of contamination at the Subject Property. The User replied:

The User has no information regarding contamination on the Subject Property. 3.6Reason for Conducting ESAThe User indicated the ESA is being conducted as part of a property transfer and financing, to satisfy one of the conditions required for landowner liability protection (LLP) under CERCLA.

DRAFT 2/10/20129Project No. 113-810934.0RECORDS REVIEW4.1Standard Environmental Records Sources, Federal and StateGolder retained Environmental Data Resources (EDR) to perform an environmental regulatory databasesearch of the general area of the Subject Property, which is presented in Appendix B. In accordance with the search requirements of ASTM E-1527-05 Standard, Golder representatives reviewed the federal and state regulatory agency records listed below to identify the use, generation, storage, treatment or disposal of hazardous substances or petroleum products, or release incidents of such materials that might impact the Subject Property. A summary of significant listings (Subject Property and adjacent properties with the potential to impact the Subject Property) presented in the environmentalregulatory database report is presented below. The following is a listing of databases reviewed during the Phase I ESA.

Federal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance Federal NPL (National Priorities List)1.0 mileFederal delisted NPL site list0.5 mile Federal Comprehensive Environmental Response,

Compensation and Liability Information System

(CERCLIS) site list 0.5 mileFederal CERCLIS-No Further Remedial Action Planned (NFRAP) site list 0.5 mileFederal Resource Conservation and Recovery Act (RCRA) CORRACTS (Corrective Action Report) facilities list 1.0 mileFederal RCRA non-CORRACTS Treatment Storage and Disposal (TSD) facilities list 0.5 mileFederal RCRA Generators listSubject Property and adjoining properties Federal Institutional Control/Engineering Control Registries Subject Property Federal Emergency Response Notification System (ERNS) list Subject Property State and Tribal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance State and tribal hazardous waste sites identified

for investigation or remediation: NPL - equivalent sites1.0 mileState and tribal hazardous waste sites identified for investigation or remediation: CERCLIS -

equivalent sites 0.5 mileState and tribal landfill and/or solid waste disposal site list 0.5 mileState and tribal leaking storage tank lists0.5 mileState and tribal registered storage tank listsSubject Property and adjoining properties State and tribal Institutional Control/Engineering Control Registries Subject PropertyState and tribal voluntary cleanup sites0.5 mileState and tribal Brownfield sites0.5 mile4.1.1Subject Property Database Listing The Subject Property is not listed on any of the databases listed in the EDR database report.

DRAFT 2/10/201210Project No. 113-810934.1.2Off-Site Properties Database ListingsNo off-site facilities were identified in the environmental database report that are considered potential environmental concerns to the Subject Property.4.1.3Orphans SummaryThirteen facilities listed in the EDR Report were shown as "orphan sites." These are sites that are listedin environmental databases, but which EDR has been unable to locate with adequate precision to determine whether they are pertinent to the investigation at the Subject Property. Golder was able todetermine to a reasonable degree of certainty that these orphan sites were not listed on databases that indicated environmental impairment and/or were not within the specified database search distances. 4.1.4Other Agency Records No other agency records were reviewed for this Phase I ESA.4.2Additional Environmental Record SourcesGolder representatives did not review additional environmental record sources as part of this Phase I

ESA.4.3Physical Setting Sources4.3.1Sources ReviewedThe USGS 7.5-minute Polonia, WI topographic map was reviewed in order to obtain information regarding the topographic, geologic, hydrogeologic, and hydrologic characteristics of the area of the Subject Property. In the sections below (4.3.2 through 4.3.4), topographic conditions are noted to the extent that they can be determined from review of topographic maps, or were visually and/or physically observed during the Site visit.4.3.2General Topographic Setting of the AreaBased on the site reconnaissance, the EDR Radius Map with GeoCheck and information provided onthe USGS Polonia, Wisconsin, 7.5 Minute Series Topographic Maps, the Subject Property is

characterized by low topographic relief, lying approximately 1090 feet above mean sea level. 4.3.3Geologic and Hydrogeologic SettingGolder installed four groundwater monitoring wells at the Subject Property in December of 2011 (Figure 2). Based on Golder's 2012 Geotechnical and Hydrological Investigation of the site the soil conditions indicated by the boreholes is about one foot of topsoil and crop residue overlying a medium to coarsegrained, silty SAND nding to depths of 9 to 14 feet. Below this is a relatively clean, medium to coarsegrained, SAND with silt to the borehole termination depth of 31 feet. One borehole was advanced without sampling to a depth of 140 feet adjacent to SM-GW3A. This borehole was intended for a well installation into bedrock and bedrock was not encountered within 140 feet of the urface. Groundwater was encountered in all of the wells at elevations ranging from about 1096 to 1106 (about 8 to 11 feet below grade) as indicated in the table below. Groundwater levels should be expected to fluctuate

seasonally and annually with changes in precipitation patterns.

DRAFT 2/10/201211Project No. 113-810934.3.4Surface Water and Hydrologic SettingSurface water runoff in the vicinity of the Subject Property is to the southwest toward the Portage River and McDill Pond. The Portage River flows to the Mississippi River to the Southwest.4.4Historical Use Information on the Subject Property4.4.1Subject Property Historical Use SummaryLand adjacent in to the Subject Property has supported agriculture and forestry since at least 1938.

Sometime between 1998 and 2005, a business park has developed to the west of the Subject Property.4.4.2Standard Historical Records4.4.2.1Aerial Photographs ReviewGolder representatives obtained historical aerial photographs from Historical Information Gatherers, Inc.for the years 2010, 2005, 1998, 1992, 1986, 1978, 1968, 1960, 1953, and 1938. Selected historicalaerial photographs are provided in Appendix C. The following table summarizes observations from the

review of these aerial photographs.YearScaleDescription19381" = 500'The Subject Property and surrounding area is a mix of woodlands and argicultural land. A railroad appears to run east west approximately 700 feet north of the Subject Property.19531" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 photograph. 19601" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 and 1953 photographs. 19681" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953 and 1960 photographs. 19781" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960 and 1968

photographs.19861" = 800'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968 and 1978

photographs.19921" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978 and 1986 photographs.19981" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978, 1986

and 1992 photographs. 20051' = 500'The Subjecr Property and surrounding area appear unchanged from the previous photographs except that the edge of a business park is visible just west of the Subject Property.20101" = 500'The Subject Property and surrounding area appears relatively unchanged from the 2005 photograph.4.4.2.2Sanborn Fire Insurance Map ReviewGolder representatives requested historical Sanborn© Fire Insurance Maps from Environmental Data Resources, Inc. Golder was informed that Sanborn© maps were not developed for the area surrounding

the Subject Property. A copy of the "No Coverage" document is included in Appendix C.

DRAFT 2/10/201212Project No. 113-810934.4.2.3Property Tax Files Golder representatives obtained Subject Property Tax records for the County Parcel ID Nos:

Parcel ID Number 020-23-0801-02.06- Owner = Thomas Mocadlo and Margaret Jakusz

020-23-0801-03.01- Owner = Thomas Mocadlo and Margaret Jakusz

020-23-0801-02.02- Owner = Thomas J. and Sandra M. Mocadlo

020-23-0801-01.04- Owner = Bernard Mocadlo

020-23-0801-04.01- Owner = Bernard Mocadlo 020-23-0801-03.02- Owner = Blue Top Farms, Inc.

030-23-0801 Owner = Blue Top Farms, Inc.

030-23-0801 Owner = MS & S Enterprises Limited Partnership

Copies and parcel maps are provided in Appendix A.

The property tax records did not indicate records of past ownership, appraisals, maps, sketches, photos, or other information pertaining to the property. 4.4.2.4Recorded Land Title Records Title documents were not obtained for this Phase I ESA. 4.4.2.5Historical Topographic Map ReviewGolder representatives obtained historical USGS topographic quadrangle maps from EnvironmentalData Resources, Inc. for the years 1955, 1957, 1969, 1970, 1976, 1978, 1980, 1986, and 1991. Copies of the historical topographic maps are provided in Appendix C. The following paragraphs summarize our

observations from the review of these historical topographic maps.YearScaleDescription19551:48000A portion of the Subject Property is visible in the southwest corner of the topographic map. An elecric tranmission line

runs near the southern boundary of the Subject Property.

The Minneapolis, St. Paul and Sault Ste Marie Rail Line is

visible north of the Subject Property.19691:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.19861:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.4.4.2.6Local Street DirectoriesLocal Street Directories from EDR were requested. The Subject Property address was not included in the city directory listing.4.4.2.7Building Department Records No building records pertaining to the Subject Property were available.4.4.2.8Zoning and Land Use RecordsGolder used the Portage County Geographic Information Systems (GIS) Map to review a property profile for the Subject Property. Information indicated that the Subject Property is zoned A1 for agricultural use.

DRAFT 2/10/201213Project No. 113-810934.4.2.9Other Historical Records No additional historical records were reviewed during this assessment. 4.5Historical Use Information on Adjoining PropertiesThe following is a summary of historical use information for adjacent properties based on informationobtained from the Subject Property visit, a review of historical topographic maps and previous ESA

reports for the Subject Property:

The adjacent properties were all agricultural and woodland since at least 1938. The rail line presentnorth of the Subject Property was operational since at least 1938 and has been operated by at least two railroads. An electrical transmission line has run near the southern boundary of the Subject Property since at least 1938. A business park was built west of the Subject Property some time between 1998 and 2005.

DRAFT 2/10/201214Project No. 113-810935.0SITE RECONNAISSANCEGolder representative Alexandra A. Prasch performed a visual assessment of the Subject Propertyon December 15th, 2011 to identify potential sources of chemical and petroleum contamination. The Golder representative assessed surficial evidence of potential impacts such as waste or refuse dumping, distressed vegetation, stained soils, and/or stained paving. Photographs recorded during the site

assessment are presented in Appendix D.5.1Methodology and Limiting ConditionsThe site reconnaissance was conducted during the period of December 15th - December 17th, 2011 by Alexandra Prasch, Environmental Technician with Golder Associates. Weather conditions at the time of the site reconnaissance were sunny, partly cloudy, and windy. The visual reconnaissance consisted of observing the boundaries of the property and systematically traversing the site to provide an overlapping field of view, wherever possible. Portions of the property and boundaries were inaccessible due to heavily wooded land and brush. Photographs of pertinent site features identified during the site

reconnaissance are included in Appendix D. 5.2General Site SettingThe Subject Property consists of approximately 88.08 acres of farmland and forest with no buildings, utilities, or other developments. The ground surface at the site is level and slopes gently to the southwest. The Subject Property is accessed from a private road extending west from Burbank Road.5.2.1Current Use of the Subject Property Information about the current use of the Subject Property is detailed in section 2.3 of this report. 5.2.2Past Use of the Subject PropertyThe Subject Property has been used for agricultural and forestry purposes since 1938 or before. The

use of the Subject Property prior to 1938 is unknown. 5.2.3General Description of Structures No structures were observed on the Subject Property.5.2.4RoadsThere are no public roads through or leading to the Subject Property. A private access road extends to

and through the Subject Property from Burbank Road.5.2.5Potable Water Supply Currently the Subject Property has no potable water supply. 5.2.6Sewage Disposal System There is no sewage disposal system within the Subject Property.

DRAFT 2/10/201215Project No. 113-810935.3Interior and Exterior ObservationsGolder identified current or past uses likely to involve the use, treatment, storage, disposal or generationof hazardous substances or petroleum products, to the extent they were visually and/or physicallyobserved during the Subject Property visit or identified from the interviews or the records review. The substances and approximate quantities, types of containers (if any) and storage conditions are

discussed in the following subsections.5.3.1Storage TanksGolder observed no evidence of underground or aboveground storage tanks at the Subject Property at

the time of the site visit.5.3.2Odors Golder observed no unusual odors at the Subject Property at the time of the site visit. 5.3.3Pools of Liquid Golder observed no pools of liquid at the Subject Property at the time of the site visit.5.3.4Drums Golder observed no drums at the Subject Property at the time of the site visit. 5.3.5Hazardous Substance and Petroleum Product Containers Golder observed no hazardous substance or petroleum product containers at the Subject Property at the

time of the site visit. 5.3.6Unidentified Substance Containers Golder observed no unidentified substance containers at the Subject Property at the time of the site visit. 5.3.7Evidence of Polychlorinated Biphenyls Golder observed no evidence of polychlorinated biphenyls.5.3.8Heating/Conditioning The Subject Property is undeveloped. No heating or air conditioning systems were present. 5.3.9Stains or Corrosion Golder observed no evidence of stains or corrosion at the Subject Property at the time of the site visit.5.3.10Drains and Sumps Golder observed no drains or sumps on the Subject Property at the time of the site visit.

DRAFT 2/10/201216Project No. 113-810935.3.11Pits, Ponds, or Lagoons Golder observed no pits, ponds, or lagoons on the Subject Property at the time of the site visit.5.3.12Stained Soil or Pavements Golder observed no stained soil or pavements at the Subject Property at the time of the site visit.5.3.13Stressed Vegetation Golder observed no stressed vegetation at the Subject Property at the time of the site visit.5.3.14Solid Waste DisposalNo readily apparent evidence of solid waste dumping, suspect fill material, or landfills was identified on the Subject Property during the site reconnaissance.5.3.15Waste WaterGolder observed no evidence that industrial waste water is generated or discharged from the Subject

Property at the time of the site visit. 5.3.16Wells Golder observed no evidence of wells at the Subject Property at the time of the site visit.5.3.17Septic Systems Golder observed no evidence of septic systems at the Subject Property at the time of the site visit.5.3.18Other Interior and Exterior Observations Golder made no other interior or exterior observations of the Subject Property during the site visit.5.4Off-Site ConditionsThe following two sections discuss the off-site observations, to the extent that the current uses of the adjoining properties were observable during the Subject Property reconnaissance, and were likely to

indicate an REC in connection with the adjoining properties or the Subject Property.5.4.1Adjoining PropertiesGolder did not observe any evidence of RECs on adjoining properties from the Subject Property during

the site visit.5.4.2Other Surrounding PropertiesTheadjacent properties were observed to be a business park, forested land and agricultural land duringthe site visit. There were no indications of RECs noted on other surrounding properties during the site visit. DRAFT 2/10/201217Project No. 113-810936.0INTERVIEWS6.1OverviewDuring the completion of this Phase I ESA, available individuals were interviewed with knowledge ofcurrent or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. Information provided is summarized throughout

the text of the report and in the following sections.6.2Interview with Owners, Past Owners, Past Operators and Past OccupantsGolder interviewed the owners identified in section 4.4.2.3 of the report. Interviews were conducted via telephone call. Phase I ESA Interview forms summarizing the interviews are available for review in the

Golder file.

Thomas Mocadlo, owner of parcels 020-23-081-02.02, 020-23-081-02.06 and 020-23-801-03.01, indicated that he purchased the property around 1985 for the purpose of hunting and gatheringfirewood. His brother Bernard owns other parcels that are part of the Subject Property. He was notaware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject

Property, but they have not been stored on the Subject Property.

Bernard Mocadlo, owner of parcels 020-23-0801-04.01 and 020-23-1.04, indicated that he has ownedthe property for 54 years and farmed the property for 30 years. The land has been used for potato,sweet corn, pea and vegetable crops. He was not aware of any solid or liquid wastes that have beenhandled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the

Subject Property.

Curt Soik, owner of parcel 030-230-0801-1.13, indicated that he purchased his parcel in 1962 from a farmer. His parcel has been used for growing of corn and other vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicatedthat small amounts of pesticides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.

Peter Zakrzewski, President of Blue Top Farms and owner of parcels 030-230-801.14 and 020-230-801-03.02, indicated that he is the son of the original owner (J. James Zakrzewski). His father purchased the property 30 years ago. Peter has been the Vice President of Blue Top Farms for the last 10 years. The property has been used for corn, green bean, soy bean and potato crops. He rented aportion of the parcels he owns to a potato farmer in the past. He believed liquid manure was handled in the southwest corner of the parcels he owns in the past, but has not been used in the last two years. He indicated that pesticides and herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. He does maintain a private shooting range on the

parcels that he owns. He uses the shooting range no more than a few times a year. 6.3Interview with Site Manager Golder did not interview a Site Manager for the Phase I ESA.6.4Interview with Occupants Golder did not interview Occupants for the Phase I ESA.

DRAFT 2/10/201218Project No. 113-810936.5Interview with Local Government Officials Golder did not interview Local Government Officials for the Phase I ESA.6.6Interviews with Others Golder did not interview Others for the Phase I ESA.

DRAFT 2/10/201219Project No. 113-810937.0DISCUSSIONThis section identifies the known or suspect RECs, historical RECs, and de minimis conditions identified during the assessment.7.1Findings and Opinions7.1.1Recognized Environmental Conditions No Recognized Environmental Conditions were identified during this assessment.7.1.2Historical Recognized Environmental ConditionsAn HREC is an environmental condition which, in the past, would have been considered a REC, butwhich may or may not be considered a REC currently. Golder's rationale for considering these environmental conditions as HRECs is based solely on the information stated herein. Designation as an

HREC however, does not preclude the potential for the condition to affect the Subject Property.

No Historical Recognized Environmental Conditions were identified during this assessment. 7.1.3De Minimis ConditionsDe minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.

FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored

on the Subject Property in the past.

OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcementaction if brought to the attention of appropriate governmental agencies. The use of pesticides and

herbicides is a de minimis condition. 7.2Additional Investigation No additional investigation is indicated based on the information gathered during this assessment.7.3Data GapsA Data Failure occurs when all of the standard historical sources that are reasonably ascertainable and likely to be useful have been reviewed and yet the objectives have not been met. Some Data Failures may comprise Data Gaps. A Data Gap is defined as the lack of or inability to obtain information requiredby the ASTM Standard despite good faith efforts by the EP to gather such information. A significant data gap occurs when a data gap impacts the ability of the EP to identify RECs.

Golder representatives did not identify significant data gaps during this assessment.

DRAFT 2/10/201220Project No. 113-8109

38.0CONCLUSION

SGolder performed a Phase I ESA of the property located at T23N, R8W, Section 1, Stevens Point, WI inconformancewith the scope and limitations of the ASTM Standard. Any exceptions to, or deletions from,the ASTM Standard are described in the appropriate sections of this Report. This assessment has

revealed no evidence of RECs in connection with the Subject Property except:

Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and

herbicides is a de minimis condition.

De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an

enforcement action if brought to the attention of appropriate governmental agencies.

DRAFT 2/10/201221Project No. 113-810939.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALSAlexandra Prasch, Geologist in Training, Level 1 Environmental Technician with 2 years of professionalexperience, conducted the site visit. Kathryn Larson, Senior Project Geologist with 15 years of experience, prepared this Report, and Amy Thorson, Senior Engineer with 20 years of professional experience, served as the senior reviewer of the Report. Resumes for members of the project team are

included in Appendix F.

"We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental Professional as defined in Section 312.10 of 40 CFR Part 312.

We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject Property. We have developed and performed the all

appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312."

GOLDER ASSOCIATES INC.

DRAFT 2/10/201222Project No. 113-81093

10.0REFERENCES

The Report's author annotated the reference sources relied upon in preparing the Phase I ESA in the relevant sections of this Report.

DRAFT List of Figures DRAFT SCALE011MILESCHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.

TITLEAS SHOWNREV.J:\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\VICINITY_MAP_WI.dwg l 1/11/2012 10:58 AM l AGarrigus l STEVENS POINT 1--------APG1/11/12MTK1/11/12AT1/11/12 0----FIG.113-81051 VICINITY_MAP_WI.dwg SMT / STEVENS POINT / AK VICINITY MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN REFERENCE TOPOGRAPHIC MAP PROVIDED BY WISCONSIN DNR.

PROJECTLOCATIONPROJECTLOCATIONDRAFT 100'162'66'100'60'66'66'66'2308-01-2101-01 2308-01-2201-01 4.26 AC.13 AC.80 AC.2.4 AC.18.61 AC.

S88°58'06"E 1,868' 1,868'N01°01'45"W 1,868' 1,868'TRANSMISSION LINE 1,000'R1,000'R80' FUTURE STREET 100' FUTURE STREET S88°58'06"E TRANSIT FACILITY 21 AC.3 AC.21 AC.2.2 AC.5 AC.2.4 AC.5.1 AC.17.52 AC.

19.93 AC.

3.7 AC.25.23 AC.

10.33 AC.

23.34 AC.

1.5 AC.34.23 AC.

35.69 AC.

700'700'700'0.4 AC.10.43 AC.

5.1 AC.1.5 AC.316'-3"316'-3"SM-GW1ASM-GW2ASM-GW3ASM-GW4A1.) LOCATION OF POTENTIAL LOCATION FOR SHINE MEDICAL FACILITY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.

2.) AERIAL IMAGERY PROVIDED BY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.

REFERENCES\\anc1-s-fs2-vm\Jobs_In_Progress\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\Proposed_building_layout_SP.dwg l 1/11/2012 11:01 AM l AGarrigus l STEVENS POINT SCALE0FEET100O100O2--------APG1/11/12MTK1/11/12AT1/11/121----FIG.113-81051 Proposed_building_layout_SP.dwg SMT / STEVENS POINT / AK SITE MAPSHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN CHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.

TITLEAS SHOWNREV.PROPOSEDBUILDINGOUTLINEPROPOSED BUILDINGAREAINTERSTATE HIGHWAY 39 PROPOSEDPROPERTYBOUNDARY1.) NORTHINGS AND EASTINGS PROVIDED IN NAD_1983_HARN_WISCRS_PORTAGE_COUNTY_FEET NOTESDRAFT Appendix ALegal Description of the Subject Property/Chain of Title Report DRAFT DRAFTRFI RESPONSE FORM PM-001, Revision 2 RFI NO.: GOLDER-2011-RFI Revision:

0 0051 Due Date: 12/16/2011 Sheet 1 of 3 RFI RESPONSE:

The following table is the legal parcels description for the Stevens Point property:

Parcel Township Owner(s)

Approximate Identification Acreage Number 020-23-0801-02.06 Town of Hull 7.2 020-23-0801-03.01 Town of Hull 19.92 . 020-23-0801-02.02 Town of Hull 6.6 020-23-0801-01.04 Town of Hull 25.23 020-23-0801-04.01 020-23-0801-03.02 Town of Hull 19.93 030-23-0801-1 4 Town of Plover 5.5 030-23-0801-13 Town of Plover 3.7 Total Combined 88.08 Parcel Acreage Please also find Phase 1 ESA User Questionnaire responses on pages 2 and 3 of the RFI response.

Responder:

______________

_ Company:

SHINE Medical Independent Reviewer (for Design Input)---------------

Responder's Management:

SHINE Licensing:

Originator Acceptance:

12/28/2011 X

Date: 12.21.11 Phone No.: ----------1 Date:

Date: ------------------1 My Map020230801-01.04This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:26:25 PM.

DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map020230801-02.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:40:03 PM.

DRAFT My Map020230801-02.06This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:42:58 PM.

DRAFT My Map020230801-03.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:15:59 PM.

DRAFTJakuszMargaretAEtalMocadloThomas,J 5931OldHighway18 StevensPoint,WI My Map020-23-0801-03.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:30:47 PM.

DRAFTEmmerichHakrzewskiBluetopFarmsInc 5613CountyRoadHH StevensPoint,WI My Map020230801-04.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:28:50 PM.

DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map030-23-0801-13This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:34:11 PM.

DRAFTMS&SEnterprises6213CountyRoadHH StevensPoint,WI54482 My Map030-23-0801-14This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:32:31 PM.

DRAFTBlueTopFarmsInc.5613CountyRoadHH StevensPoint,WI54482 Appendix BFederal and State Regulatory Database SearchDRAFT FORM-BPK-SPM kcehCoeG htiw tropeR ŽpaM suidaR RDE ehT440 Wheelers Farms Road Milford, CT 06461

Toll Free: 800.352.0050

www.edrnet.com SHINE Medical Stevens Point, WI Lands End Way,

Stevens Point, WI 54482 Inquiry Number: 3220399.2s December 07, 2011 DRAFT SECTIONPAGEExecutive Summary ES1Overview Map 2Detail Map 3Map Findings Summary4 Map Findings 7Orphan Summary 8Government Records Searched/Data Currency TrackingGR-1 GEOCHECK ADDENDUMPhysical Setting Source AddendumA-1Physical Setting Source SummaryA-2Physical Setting SSURGO Soil MapA-5Physical Setting Source MapA-9Physical Setting Source Map FindingsA-11Physical Setting Source Records SearchedA-30 TC3220399.2s Page 1 Thank you for your business.

Please contact EDR at 1-800-352-0050 with any questions or comments.

Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmen tal DataResources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties doe s not exist from other sources.

NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION,

MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL

ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE,

ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL,

CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY

LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT.

Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intend ed to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any prope rty. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental ri sk for any property. Additionally, the information provided in this Report is not to be construed as legal advice.

Copyright 2011 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission.

EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. A ll othertrademarks used herein are the property of their respective owners.

TABLE OF CONTENTS DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 1A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).The report was designed to assist parties seeking to meet the search requirements of EPA's Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-05) or custom requirements developed for the evaluation of

environmental risk associated with a parcel of real estate.

TARGET PROPERTY INFORMATION ADDRESSLANDS END WAY,

STEVENS POINT, WI 54482 COORDINATES 44.507000 - 44 30' 25.2

Latitude (North):

89.495900 - 89 29' 45.2

Longitude (West):

Zone 16Universal Tranverse Mercator:

301598.3UTM X (Meters):

4931000.0 UTM Y (Meters):

1113 ft. above sea level Elevation:

USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 44089-E4 POLONIA, WI Target Property Map:

1986Most Recent Revision:

44089-D4 ARNOTT, WI South Map:

1969Most Recent Revision:

44089-D5 WHITING, WI Southwest Map:

1976Most Recent Revision:

44089-E5 STEVENS POINT, WI West Map:

1991Most Recent Revision:

AERIAL PHOTOGRAPHY IN THIS REPORT 2010Photo Year:

USDASource:TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR.

DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 2 DATABASES WITH NO MAPPED SITESNo mapped sites were found in EDR's search of available ("reasonably ascertainable ") governmentrecords either on the target property or within the search radius around the target property for the

following databases:

STANDARD ENVIRONMENTAL RECORDS Federal NPL site listNPLNational Priority ListProposed NPLProposed National Priority List SitesNPL LIENSFederal Superfund Liens Federal Delisted NPL site list Delisted NPLNational Priority List Deletions Federal CERCLIS list CERCLISComprehensive Environmental Response, Compensation, and Liability Information SystemFEDERAL FACILITYFederal Facility Site Information listing Federal CERCLIS NFRAP site List CERC-NFRAPCERCLIS No Further Remedial Action Planned Federal RCRA CORRACTS facilities list CORRACTSCorrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDFRCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-LQGRCRA - Large Quantity GeneratorsRCRA-SQGRCRA - Small Quantity GeneratorsRCRA-CESQGRCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries US ENG CONTROLSEngineering Controls Sites ListUS INST CONTROLSites with Institutional Controls Federal ERNS list ERNSEmergency Response Notification System State- and tribal - equivalent CERCLIS SHWSHazard Ranking List DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 3 State and tribal landfill and/or solid waste disposal site listsSWF/LFList of Licensed LandfillsWDSRegistry of Waste Disposal SitesSHWIMSSolid & Hazardous Waste Information Management System State and tribal leaking storage tank lists LUSTLeaking Underground Storage Tank DatabaseLASTLeaking Aboveground Storage Tank ListingINDIAN LUSTLeaking Underground Storage Tanks on Indian Land State and tribal registered storage tank lists USTRegistered Underground Storage TanksASTTanks DatabaseINDIAN USTUnderground Storage Tanks on Indian LandFEMA USTUnderground Storage Tank Listing State and tribal institutional control / engineering control registries CRSClosed Remediation SitesAULDeed Restriction at Closeout Sites State and tribal voluntary cleanup sites VCPVoluntary Party Liability Exemption SitesINDIAN VCPVoluntary Cleanup Priority Listing State and tribal Brownfields sites BEAPBrownfields Environmental Assessment ProgramBROWNFIELDSBrownfields Site Locations Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDSA Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites DEBRIS REGION 9Torres Martinez Reservation Illegal Dump Site LocationsODIOpen Dump InventorySWRCYRecycling Center ListingINDIAN ODIReport on the Status of Open Dumps on Indian Lands Local Lists of Hazardous waste / Contaminated Sites US CDLClandestine Drug LabsWI ERPEnvironmental Repair Program DatabaseCDLClandestine Drug Lab ListingUS HIST CDLNational Clandestine Laboratory Register DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 4 Local Land RecordsLIENS 2CERCLA Lien InformationLUCISLand Use Control Information System Records of Emergency Release Reports HMIRSHazardous Materials Information Reporting SystemSPILLSSpills DatabaseAGSPILLSAgricultural Spill Cases Other Ascertainable Records RCRA-NonGenRCRA - Non GeneratorsDOT OPSIncident and Accident DataDODDepartment of Defense SitesFUDSFormerly Used Defense SitesCONSENTSuperfund (CERCLA) Consent DecreesRODRecords Of DecisionUMTRAUranium Mill Tailings SitesMINESMines Master Index FileTRISToxic Chemical Release Inventory SystemTSCAToxic Substances Control ActFTTSFIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act)HIST FTTSFIFRA/TSCA Tracking System Administrative Case ListingSSTSSection 7 Tracking SystemsICISIntegrated Compliance Information SystemPADSPCB Activity Database SystemMLTSMaterial Licensing Tracking SystemRADINFORadiation Information DatabaseFINDSFacility Index System/Facility Registry SystemRAATSRCRA Administrative Action Tracking SystemBRRTSBureau of Remediation & Redevelopment Tracking SystemNPDESNPDES Permit ListingMANIFESTHazardous Waste Manifest DataDRYCLEANERSFive Star Recognition Program SitesWI WRRSERWisconsin Remedial Response Site Evaluation ReportAIRSAir Permit Program ListingTIER 2Tier 2 Facility ListingLEADLead Inspection DataINDIAN RESERVIndian ReservationsSCRD DRYCLEANERSState Coalition for Remediation of Drycleaners ListingCOAL ASH EPACoal Combustion Residues Surface Impoundments ListFINANCIAL ASSURANCEFinancial Assurance Information ListingCOAL ASHCoal Ash Disposal Site ListingPCB TRANSFORMERPCB Transformer Registration DatabaseCOAL ASH DOESleam-Electric Plan Operation Data EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas PlantsEDR Proprietary Manufactured Gas Plants DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 5 SURROUNDING SITES: SEARCH RESULTS Surrounding sites were not identified.

Unmappable (orphan) sites are not considered in the foregoing analysis.

DRAFT EXECUTIVE SUMMARY TC3220399.2s EXECUTIVE SUMMARY 6 Due to poor or inadequate address information, the following sites were not mapped. Count: 13 records.Site Name Database(s)____________ ____________STEVENS POINT MUNICIPAL AIRPORT NPDESSTEVENS POINT MUNI FINDS FROM STEVENS POINT CTY LIMITS TO C SPILLS JUNCTION CITY TO STEVENS POINT SPILLS WI RIVER & WISCONSIN ST SPILLS UW STEVENS POINT BALDWIN HALL SPILLS WISCONSIN RIVER BELOW POINT PAPER SPILLS STEVENS POINT AIRPORT #2 WI WRRSER KWIK TRIP - STEVENS POINT WI WRRSER STEVENS POINT BRRTS WI RIVER BOAT LANDING BRRTS STEVENS POINT BRRTS STEVENS POINT WATER DEPARTMENT - W TIER 2 DRAFT EDR Inc.EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.1120DRAFT N Target Property

... Sillls at eleva1ions higher than or equal to the target property

  • Sbs at eleva11ons lower 1han 1he target property

.1 Manufactured Gas Plants &enslave AecepiDra E;:J Nallonal Priarlly Ust Silltl ITIJ Dept. Delenaa SIIBS SITE NAME: SHINE Mec:lcal Stevena Point, WI ADDRESS:

Lands End Way, Stevens Poln: WI 64482 LA TILONG: 44.5070 /89.4959 It , .. Indian Raaarvatlons BIA N Oil & Gas pipelines from USGS 100-year flood zone 600-yaar flood Z(lne ,,. .... ThiS report includes lntBratliYe Map display and/or hide map information.

11le legend includes only thOse icons for 1he dtlfault map view. D R i::l NT: Golder Associates CONTACT:

INQUIRY 1: 3220399.2&

DATE:

2011 11:47 am MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0 NR 0 0 0 0 1.000NPL 0 NR 0 0 0 0 1.000Proposed NPL 0 NR NR NR NR NR TPNPL LIENS Federal Delisted NPL site list 0 NR 0 0 0 0 1.000Delisted NPL Federal CERCLIS list 0 NR NR 0 0 0 0.500CERCLIS 0 NR 0 0 0 0 1.000FEDERAL FACILITY Federal CERCLIS NFRAP site List 0 NR NR 0 0 0 0.500CERC-NFRAP Federal RCRA CORRACTS facilities list 0 NR 0 0 0 0 1.000CORRACTSFederal RCRA non-CORRACTS TSD facilities list 0 NR NR 0 0 0 0.500RCRA-TSDF Federal RCRA generators list 0 NR NR NR 0 0 0.250RCRA-LQG 0 NR NR NR 0 0 0.250RCRA-SQG 0 NR NR NR 0 0 0.250RCRA-CESQG Federal institutional controls /

engineering controls registries 0 NR NR 0 0 0 0.500US ENG CONTROLS 0 NR NR 0 0 0 0.500US INST CONTROL Federal ERNS list 0 NR NR NR NR NR TPERNSState- and tribal - equivalent CERCLIS 0 NR 0 0 0 0 1.000SHWSState and tribal landfill and/or solid waste disposal site lists 0 NR NR 0 0 0 0.500SWF/LF 0 NR NR 0 0 0 0.500WDS 0 NR NR NR NR NR TPSHWIMSState and tribal leaking storage tank lists 0 NR NR 0 0 0 0.500LUST 0 NR NR 0 0 0 0.500LAST 0 NR NR 0 0 0 0.500INDIAN LUST TC3220399.2s Page 4 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted State and tribal registered storage tank lists 0 NR NR NR 0 0 0.250UST 0 NR NR NR 0 0 0.250AST 0 NR NR NR 0 0 0.250INDIAN UST 0 NR NR NR 0 0 0.250FEMA USTState and tribal institutional control / engineering control registries 0 NR NR NR NR NR TPCRS 0 NR NR 0 0 0 0.500AULState and tribal voluntary cleanup sites 0 NR NR 0 0 0 0.500VCP 0 NR NR 0 0 0 0.500INDIAN VCP State and tribal Brownfields sites 0 NR NR 0 0 0 0.500BEAP 0 NR NR 0 0 0 0.500BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0 NR NR 0 0 0 0.500US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0 NR NR 0 0 0 0.500DEBRIS REGION 9 0 NR NR 0 0 0 0.500ODI 0 NR NR 0 0 0 0.500SWRCY 0 NR NR 0 0 0 0.500INDIAN ODI Local Lists of Hazardous waste /

Contaminated Sites 0 NR NR NR NR NR TPUS CDL 0 NR NR 0 0 0 0.500WI ERP 0 NR NR NR NR NR TPCDL 0 NR NR NR NR NR TPUS HIST CDL Local Land Records 0 NR NR NR NR NR TPLIENS 2 0 NR NR 0 0 0 0.500LUCISRecords of Emergency Release Reports 0 NR NR NR NR NR TPHMIRS 0 NR NR NR NR NR TPSPILLS 0 NR NR NR NR NR TPAGSPILLSOther Ascertainable Records 0 NR NR NR 0 0 0.250RCRA-NonGen TC3220399.2s Page 5 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted 0 NR NR NR NR NR TPDOT OPS 0 NR 0 0 0 0 1.000DOD 0 NR 0 0 0 0 1.000FUDS 0 NR 0 0 0 0 1.000CONSENT 0 NR 0 0 0 0 1.000ROD 0 NR NR 0 0 0 0.500UMTRA 0 NR NR NR 0 0 0.250MINES 0 NR NR NR NR NR TPTRIS 0 NR NR NR NR NR TPTSCA 0 NR NR NR NR NR TPFTTS 0 NR NR NR NR NR TPHIST FTTS 0 NR NR NR NR NR TPSSTS 0 NR NR NR NR NR TPICIS 0 NR NR NR NR NR TPPADS 0 NR NR NR NR NR TPMLTS 0 NR NR NR NR NR TPRADINFO 0 NR NR NR NR NR TPFINDS 0 NR NR NR NR NR TPRAATS 0 NR NR NR NR NR TPBRRTS 0 NR NR NR NR NR TPNPDES 0 NR NR NR 0 0 0.250MANIFEST 0 NR NR NR 0 0 0.250DRYCLEANERS 0 NR NR NR NR NR TPWI WRRSER 0 NR NR NR NR NR TPAIRS 0 NR NR NR NR NR TPTIER 2 0 NR NR NR NR NR TPLEAD 0 NR 0 0 0 0 1.000INDIAN RESERV 0 NR NR 0 0 0 0.500SCRD DRYCLEANERS 0 NR NR 0 0 0 0.500COAL ASH EPA 0 NR NR NR NR NR TPFINANCIAL ASSURANCE 0 NR NR 0 0 0 0.500COAL ASH 0 NR NR NR NR NR TPPCB TRANSFORMER 0 NR NR NR NR NR TPCOAL ASH DOE EDR PROPRIETARY RECORDS EDR Proprietary Records 0 NR 0 0 0 0 1.000Manufactured Gas Plants NOTES: TP = Target Property

NR = Not Requested at this Search Distance

Sites may be listed in more than one database TC3220399.2s Page 6 DRAFT MAP FINDINGS Map IDDirection EDR ID Number DistanceEPA ID Number Database(s)

SiteElevation NO SITES FOUND TC3220399.2s Page 7 DRAFT ORPHAN SUMMARYCityEDR IDSite NameSite AddressZipDatabase(s)

Count: 13 records.STEVENS POINTS109260948STEVENS POINT AIRPORT #2HWY 66 WI WRRSERSTEVENS POINTS110356483STEVENS POINT MUNICIPAL AIRPORTHWY 66 OF POINT ENPDES STEVENS POINTS106975782STEVENS POINT ADDRESS UNKNOWNBRRTSSTEVENS POINTS107426958FROM STEVENS POINT CTY LIMITS TO CFROM STEVENS PTSPILLSSTEVENS POINTS100670543KWIK TRIP - STEVENS POINT3533 E HWY 66 WI WRRSERSTEVENS POINTS107429234JUNCTION CITY TO STEVENS POINTJUNCTION CITY TO STEVENS PTSPILLS STEVENS POINTS109326408WI RIVER & WISCONSIN STWI RIV S SPILLSSTEVENS POINTS110674654WI RIVER BOAT LANDINGRIVER RD BRRTSSTEVENS POINTS107432651UW STEVENS POINT BALDWIN HALLUW STEVENS PTSPILLSSTEVENS POINTS110357602STEVENS POINTSTEVENS PT BRRTSSTEVENS POINT1011985398STEVENS POINT MUNIUNKNOWN FINDSSTEVENS POINTS107685149STEVENS POINT WATER DEPARTMENT - W100 WELL FIELD RDTIER 2 STEVENS POINTS107433219WISCONSIN RIVER BELOW POINT PAPERWISCONSIN RIVER BELOW PTSPILLS TC3220399.2s Page 8 DRAFT To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required.

Number of Days to Update:

Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public.

STANDARD ENVIRONMENTAL RECORDS Federal NPL site list

NPL: National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority

cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon

coverage for over 1,000 NPL site boundaries produced by EPA's Environmental Photographic Interpretation Center

(EPIC) and regional EPA offices.

Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 79 Source: EPA Telephone: N/A

Last EDR Contact: 10/12/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly NPL Site Boundaries Sources:

EPA's Environmental Photographic Interpretation Center (EPIC)

Telephone: 202-564-7333EPA Region 1EPA Region 6Telephone 617-918-1143Telephone: 214-655-6659EPA Region 3EPA Region 7Telephone 215-814-5418Telephone: 913-551-7247EPA Region 4EPA Region 8Telephone 404-562-8033Telephone: 303-312-6774EPA Region 5EPA Region 9Telephone 312-886-6686Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL: Proposed National Priority List SitesA site that has been proposed for listing on the NationalPriorities List through the issuance of a proposed rule in the Federal Register.EPA then accepts public comments on the site, responds to the comments,and places on the NPL those sites that continue to meet therequirements for listing.

Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 79 Source: EPA Telephone: N/A

Last EDR Contact: 10/12/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly NPL LIENS: Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority

to file liens against real property in order to recover remedial action expenditures or when the property owner

received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens.

Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994

Date Made Active in Reports: 03/30/1994

Number of Days to Update: 56 Source: EPA Telephone: 202-564-4267

Last EDR Contact: 08/15/2011

Next Scheduled EDR Contact: 11/28/2011

Data Release Frequency: No Update Planned TC3220399.2s Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal Delisted NPL site list DELISTED NPL: National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the

EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the

NPL where no further response is appropriate.

Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 79 Source: EPA Telephone: N/A

Last EDR Contact: 10/12/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly Federal CERCLIS list

CERCLIS: Comprehensive Environmental Response, Compensation, and Liability Information System CERCLIS contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities,

private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation,

and Liability Act (CERCLA). CERCLIS contains sites which are either proposed to or on the National Priorities

List (NPL) and sites which are in the screening and assessment phase for possible inclusion on the NPL.

Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011

Date Made Active in Reports: 05/02/2011

Number of Days to Update: 62 Source: EPA Telephone: 703-412-9810

Last EDR Contact: 11/29/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Quarterly FEDERAL FACILITY: Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive

Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities

Restoration and Reuse Office is involved in cleanup activities.

Date of Government Version: 12/10/2010 Date Data Arrived at EDR: 01/11/2011

Date Made Active in Reports: 02/16/2011

Number of Days to Update: 36 Source: Environmental Protection Agency Telephone: 703-603-8704

Last EDR Contact: 10/14/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Varies Federal CERCLIS NFRAP site List

CERCLIS-NFRAP: CERCLIS No Further Remedial Action Planned Archived sites are sites that have been removed and archived from the inventory of CERCLIS sites. Archived status

indicates that, to the best of EPA's knowledge, assessment at a site has been completed and that EPA has determined

no further steps will be taken to list this site on the National Priorities List (NPL), unless information indicates

this decision was not appropriate or other considerations require a recommendation for listing at a later time.

This decision does not necessarily mean that there is no hazard associated with a given site; it only means that,

based upon available information, the location is not judged to be a potential NPL site.

Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011

Date Made Active in Reports: 05/02/2011

Number of Days to Update: 62 Source: EPA Telephone: 703-412-9810

Last EDR Contact: 11/29/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list

CORRACTS: Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity.

TC3220399.2s Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 03/09/2011 Date Data Arrived at EDR: 03/15/2011

Date Made Active in Reports: 06/14/2011

Number of Days to Update: 91 Source: EPA Telephone: 800-424-9346

Last EDR Contact: 11/14/2011

Next Scheduled EDR Contact: 02/27/2012

Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list

RCRA-TSDF: RCRA - Treatment, Storage and Disposal RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation

and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database

includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste

as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that

move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the

waste. TSDFs treat, store, or dispose of the waste.

Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011

Date Made Active in Reports: 08/08/2011

Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186

Last EDR Contact: 10/05/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Quarterly Federal RCRA generators list

RCRA-LQG: RCRA - Large Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation

and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database

includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste

as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate

over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month.

Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011

Date Made Active in Reports: 08/08/2011

Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186

Last EDR Contact: 10/05/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Quarterly RCRA-SQG: RCRA - Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation

and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database

includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste

as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate

between 100 kg and 1,000 kg of hazardous waste per month.

Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011

Date Made Active in Reports: 08/08/2011

Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186

Last EDR Contact: 10/05/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Quarterly RCRA-CESQG: RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation

and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database

includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste

as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators

(CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month.

Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011

Date Made Active in Reports: 08/08/2011

Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186

Last EDR Contact: 10/05/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Varies TC3220399.2s Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal institutional controls / engineering controls registries US ENG CONTROLS: Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building

foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental

media or effect human health.

Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011

Date Made Active in Reports: 06/14/2011

Number of Days to Update: 81 Source: Environmental Protection Agency Telephone: 703-603-0695

Last EDR Contact: 09/12/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Varies US INST CONTROL: Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures,

such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation

care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally

required as part of the institutional controls.

Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011

Date Made Active in Reports: 06/14/2011

Number of Days to Update: 81 Source: Environmental Protection Agency Telephone: 703-603-0695

Last EDR Contact: 09/12/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Varies Federal ERNS list

ERNS: Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous

substances.

Date of Government Version: 10/03/2011 Date Data Arrived at EDR: 10/04/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 38 Source: National Response Center, United States Coast Guard Telephone: 202-267-2180

Last EDR Contact: 10/04/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Annually State- and tribal - equivalent CERCLIS

SHWS: Hazard Ranking List State Hazardous Waste Sites. State hazardous waste site records are the states' equivalent to CERCLIS. These sites

may or may not already be listed on the federal CERCLIS list. Priority sites planned for cleanup using state funds

(state equivalent of Superfund) are identified along with sites where cleanup will be paid for by potentially

responsible parties. Available information varies by state.

Date of Government Version: 11/30/1994 Date Data Arrived at EDR: 02/10/1995

Date Made Active in Reports: 03/01/1995

Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2632

Last EDR Contact: 10/03/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: No Update Planned State and tribal landfill and/or solid waste disposal site lists

SWF/LF: List of Licensed Landfills Solid Waste Facilities/Landfill Sites. SWF/LF type records typically contain an inventory of solid waste disposal

facilities or landfills in a particular state. Depending on the state, these may be active or inactive facilities

or open dumps that failed to meet RCRA Subtitle D Section 4004 criteria for solid waste landfills or disposal

sites.TC3220399.2s Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/12/2011 Date Data Arrived at EDR: 10/13/2011

Date Made Active in Reports: 11/22/2011

Number of Days to Update: 40 Source: Department of Natural Resources Telephone: 608-267-7557

Last EDR Contact: 10/03/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Semi-Annually WDS: Registry of Waste Disposal Sites The registry was created by the DNR to serve as a comprehensive listing of all sites where solid or hazardous

wastes have been or may have been deposited.

Date of Government Version: 07/19/2011 Date Data Arrived at EDR: 10/06/2011

Date Made Active in Reports: 10/25/2011

Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2632

Last EDR Contact: 10/06/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: No Update Planned SHWIMS: Solid & Hazardous Waste Information Management System Information on sites, and facilities operating at sites, that are regulated by the Waste Management program Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/06/2011

Date Made Active in Reports: 10/25/2011

Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2414

Last EDR Contact: 10/06/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Quarterly State and tribal leaking storage tank lists

LUST: Leaking Underground Storage Tank Database Leaking Underground Storage Tank Incident Reports. LUST records contain an inventory of reported leaking underground

storage tank incidents. Not all states maintain these records, and the information stored varies by state.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly LAST: Leaking Aboveground Storage Tank Listing A listing of leaking aboveground storage tank sites.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Varies INDIAN LUST R9: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 01/31/2011 Date Data Arrived at EDR: 02/01/2011

Date Made Active in Reports: 03/21/2011

Number of Days to Update: 48 Source: Environmental Protection Agency Telephone: 415-972-3372

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly INDIAN LUST R4: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina.

Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 32 Source: EPA Region 4 Telephone: 404-562-8677

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Semi-Annually TC3220399.2s Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN LUST R10: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington.

Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 7 Source: EPA Region 10 Telephone: 206-553-2857

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly INDIAN LUST R1: Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land.

Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 10 Source: EPA Region 1 Telephone: 617-918-1313

Last EDR Contact: 11/01/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN LUST R6: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma.

Date of Government Version: 09/12/2011 Date Data Arrived at EDR: 09/13/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 59 Source: EPA Region 6 Telephone: 214-665-6597

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN LUST R7: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 02/16/2011 Date Data Arrived at EDR: 06/02/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 103 Source: EPA Region 7 Telephone: 913-551-7003

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN LUST R8: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming.

Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 25 Source: EPA Region 8 Telephone: 303-312-6271

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly State and tribal registered storage tank lists

UST: Registered Underground Storage Tanks Registered Underground Storage Tanks. UST's are regulated under Subtitle I of the Resource Conservation and Recovery

Act (RCRA) and must be registered with the state department responsible for administering the UST program. Available

information varies by state program.

Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011

Date Made Active in Reports: 10/13/2011

Number of Days to Update: 21 Source: Department of Commerce Telephone: 608-266-7874

Last EDR Contact: 09/22/2011

Next Scheduled EDR Contact: 01/02/2012

Data Release Frequency: Quarterly AST: Tanks Database Aboveground storage tank site locations.

TC3220399.2s Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011

Date Made Active in Reports: 10/13/2011

Number of Days to Update: 21 Source: Department of Commerce Telephone: 608-266-7874

Last EDR Contact: 09/22/2011

Next Scheduled EDR Contact: 01/02/2012

Data Release Frequency: Quarterly INDIAN UST R9: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations).

Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 08/05/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 39 Source: EPA Region 9 Telephone: 415-972-3368

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly INDIAN UST R8: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations).

Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 25 Source: EPA Region 8 Telephone: 303-312-6137

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly INDIAN UST R7: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations).

Date of Government Version: 04/01/2011 Date Data Arrived at EDR: 06/01/2011

Date Made Active in Reports: 06/14/2011

Number of Days to Update: 13 Source: EPA Region 7 Telephone: 913-551-7003

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN UST R10: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations).

Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 7 Source: EPA Region 10 Telephone: 206-553-2857

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Quarterly INDIAN UST R1: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal

Nations).

Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 10 Source: EPA, Region 1 Telephone: 617-918-1313

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN UST R4: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee

and Tribal Nations)

TC3220399.2s Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 32 Source: EPA Region 4 Telephone: 404-562-9424

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Semi-Annually INDIAN UST R5: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations).

Date of Government Version: 07/01/2011 Date Data Arrived at EDR: 08/26/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 18 Source: EPA Region 5 Telephone: 312-886-6136

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies INDIAN UST R6: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian

land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes).

Date of Government Version: 05/10/2011 Date Data Arrived at EDR: 05/11/2011

Date Made Active in Reports: 06/14/2011

Number of Days to Update: 34 Source: EPA Region 6 Telephone: 214-665-7591

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Semi-Annually FEMA UST: Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks.

Date of Government Version: 01/01/2010 Date Data Arrived at EDR: 02/16/2010

Date Made Active in Reports: 04/12/2010

Number of Days to Update: 55 Source: FEMA Telephone: 202-646-5797

Last EDR Contact: 10/17/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Varies State and tribal institutional control / engineering control registries

CRS: Closed Remediation Sites A Closed Remediation Site is parcel of land at which the groundwater has become contaminated and which is affected

by a particular type of legal restriction. Specifically, certain steps have been taken to stabilize/remediate

the contamination, and the state is satisfied that no further efforts are necessary provided that the property

is not used for certain purposes.

Date of Government Version: 08/23/2011 Date Data Arrived at EDR: 08/25/2011

Date Made Active in Reports: 09/14/2011

Number of Days to Update: 20 Source: Department of Natural Resources Telephone: 608-267-0554

Last EDR Contact: 11/24/2011

Next Scheduled EDR Contact: 03/05/2012

Data Release Frequency: Semi-Annually AUL: Deed Restriction at Closeout Sites Date a deed restriction is recorded at the Register of Deeds office for a property. Extent of soil contamination

is known but impracticable to remove now or an engineering control is required to be maintained or NR720 industrial

stds are applied. Restricts property use or requires future actions.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly State and tribal voluntary cleanup sites TC3220399.2s Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN VCP R1: Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1.

Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 10/04/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 38 Source: EPA, Region 1 Telephone: 617-918-1102

Last EDR Contact: 10/04/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Varies VCP: Voluntary Party Liability Exemption Sites The Voluntary Party Liability Exemption is an elective environmental cleanup program. Interested persons who meet

the definition of "voluntary party" are eligible to apply. A "voluntary party" is any person who submits an application

and pays all the necessary fees.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Varies INDIAN VCP R7: Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7.

Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008

Date Made Active in Reports: 05/19/2008

Number of Days to Update: 27 Source: EPA, Region 7 Telephone: 913-551-7365

Last EDR Contact: 04/20/2009

Next Scheduled EDR Contact: 07/20/2009

Data Release Frequency: Varies State and tribal Brownfields sites

BEAP: Brownfields Environmental Assessment Program The Brownfields Environmental Assessment Program (BEAP) was a federal program that assisted municipalities with

Environmental Site Assessments (ESA's) for tax delinquent or bankrupt properties, or properties a local government

acquired for redevelopment. Using federal dollars, site assessments were conducted by Department of Natural Resources

(DNR) staff to determine if the properties were contaminated.

Date of Government Version: 12/31/2000 Date Data Arrived at EDR: 05/29/2001

Date Made Active in Reports: 06/29/2001

Number of Days to Update: 31 Source: Department of Natural Resources Telephone: 608-266-1618

Last EDR Contact: 08/17/2009

Next Scheduled EDR Contact: 11/16/2009

Data Release Frequency: No Update Planned BROWNFIELDS: Brownfields Site Locations Listing A listing of brownfields sites included in the BRRTS database. Brownfields are abandoned, idle or underused commercial

or industrial properties, where the expansion or redevelopment is hindered by real or perceived contamination.

Brownfields vary in size, location, age, and past use -- they can be anything from a five-hundred acre automobile

assembly plant to a small, abandoned corner gas station.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-266-3084

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS: A Listing of Brownfields Sites TC3220399.2s Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Included in the listing are brownfields properties addresses by Cooperative Agreement Recipients and brownfields properties addressed by Targeted Brownfields Assessments. Targeted Brownfields Assessments-EPA's Targeted Brownfields

Assessments (TBA) program is designed to help states, tribes, and municipalities--especially those without EPA

Brownfields Assessment Demonstration Pilots--minimize the uncertainties of contamination often associated with

brownfields. Under the TBA program, EPA provides funding and/or technical assistance for environmental assessments

at brownfields sites throughout the country. Targeted Brownfields Assessments supplement and work with other efforts

under EPA's Brownfields Initiative to promote cleanup and redevelopment of brownfields. Cooperative Agreement

Recipients-States, political subdivisions, territories, and Indian tribes become Brownfields Cleanup Revolving

Loan Fund (BCRLF) cooperative agreement recipients when they enter into BCRLF cooperative agreements with the

U.S. EPA. EPA selects BCRLF cooperative agreement recipients based on a proposal and application process. BCRLF

cooperative agreement recipients must use EPA funds provided through BCRLF cooperative agreement for specified

brownfields-related cleanup activities.

Date of Government Version: 06/27/2011 Date Data Arrived at EDR: 06/27/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 78 Source: Environmental Protection Agency Telephone: 202-566-2777

Last EDR Contact: 09/28/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Semi-Annually Local Lists of Landfill / Solid Waste Disposal Sites

ODI: Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258

Subtitle D Criteria.

Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004

Date Made Active in Reports: 09/17/2004

Number of Days to Update: 39 Source: Environmental Protection Agency Telephone: 800-424-9346

Last EDR Contact: 06/09/2004

Next Scheduled EDR Contact: N/A

Data Release Frequency: No Update Planned DEBRIS REGION 9: Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside

County and northern Imperial County, California.

Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009

Date Made Active in Reports: 09/21/2009

Number of Days to Update: 137 Source: EPA, Region 9 Telephone: 415-947-4219

Last EDR Contact: 09/26/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: No Update Planned SWRCY: Recycling Center Listing A listing of recycling center locations.

Date of Government Version: 09/14/2011 Date Data Arrived at EDR: 09/16/2011

Date Made Active in Reports: 10/14/2011

Number of Days to Update: 28 Source: Solid & Hazardous Waste Education center Telephone: 608-262-0936

Last EDR Contact: 11/28/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Varies INDIAN ODI: Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land.

Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007

Date Made Active in Reports: 01/24/2008

Number of Days to Update: 52 Source: Environmental Protection Agency Telephone: 703-308-8245

Last EDR Contact: 11/07/2011

Next Scheduled EDR Contact: 02/20/2012

Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites TC3220399.2s Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT US CDL: Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this

web site as a public service. It contains addresses of some locations where law enforcement agencies reported

they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.

In most cases, the source of the entries is not the Department, and the Department has not verified the entry

and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,

contacting local law enforcement and local health departments.

Date of Government Version: 06/08/2011 Date Data Arrived at EDR: 09/16/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 13 Source: Drug Enforcement Administration Telephone: 202-307-1000

Last EDR Contact: 12/05/2011

Next Scheduled EDR Contact: 03/19/2012

Data Release Frequency: Quarterly ERP: Environmental Repair Program Database Environmental Repair Program sites are sites other than LUST's that have contaminated soil and/or groundwater.

Often, these are old historic releases to the environment.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly CDL: Clandestine Drug Lab Listing A listing of clandestine drug lab locations in the state.

Date of Government Version: 10/11/2011 Date Data Arrived at EDR: 10/21/2011

Date Made Active in Reports: 11/22/2011

Number of Days to Update: 32 Source: Department of Justice Telephone: 920-832-2751

Last EDR Contact: 11/15/2011

Next Scheduled EDR Contact: 02/27/2012

Data Release Frequency: Varies US HIST CDL: National Clandestine Laboratory Register A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this

web site as a public service. It contains addresses of some locations where law enforcement agencies reported

they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.

In most cases, the source of the entries is not the Department, and the Department has not verified the entry

and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,

contacting local law enforcement and local health departments.

Date of Government Version: 09/01/2007 Date Data Arrived at EDR: 11/19/2008

Date Made Active in Reports: 03/30/2009

Number of Days to Update: 131 Source: Drug Enforcement Administration Telephone: 202-307-1000

Last EDR Contact: 03/23/2009

Next Scheduled EDR Contact: 06/22/2009

Data Release Frequency: No Update Planned Local Land Records

LIENS 2: CERCLA Lien Information A Federal CERCLA ('Superfund') lien can exist by operation of law at any site or property at which EPA has spent

Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination.

CERCLIS provides information as to the identity of these sites and properties.

Date of Government Version: 09/09/2011 Date Data Arrived at EDR: 09/16/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 13 Source: Environmental Protection Agency Telephone: 202-564-6023

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies TC3220399.2s Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT LUCIS: Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure

properties.

Date of Government Version: 12/09/2005 Date Data Arrived at EDR: 12/11/2006

Date Made Active in Reports: 01/11/2007

Number of Days to Update: 31 Source: Department of the Navy Telephone: 843-820-7326

Last EDR Contact: 11/22/2011

Next Scheduled EDR Contact: 03/05/2012

Data Release Frequency: Varies Records of Emergency Release Reports

HMIRS: Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT.

Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/04/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 38 Source: U.S. Department of Transportation Telephone: 202-366-4555

Last EDR Contact: 10/04/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Annually SPILLS: Spills Database A discharge of a hazardous substance that may adversely impact, or threaten to adversely impact public health,

welfare or the environment. Spills are usually cleaned up quickly.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly AG SPILLS: Agricultural Spill Cases Spills reported to the Department of Agriculture, Trade & Consumer Protection. There are two types of spills.

Long-term: These are mainly pesticide and fertilizer cases. Some might include other contaminants at the same

site. Some might involve wood-treaters - which use pesticides. All of them involve spills of products, but these

spills generally result from day to day use (chronic spills) rather than accidental spills (acute). Accidental:

These are the acute spills of pesticides and fertilizers and only involve pesticides and fertilizers. Most of

these are cleaned up and closed within 3 to 6 months.

Date of Government Version: 08/15/2011 Date Data Arrived at EDR: 08/19/2011

Date Made Active in Reports: 10/10/2011

Number of Days to Update: 52 Source: Department of Agriculture, Trade & Consumer Protection Telephone: 608-224-5058

Last EDR Contact: 11/14/2011

Next Scheduled EDR Contact: 02/27/2012

Data Release Frequency: Varies Other Ascertainable Records

RCRA-NonGen: RCRA - Non Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation

and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database

includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste

as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous

waste.Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011

Date Made Active in Reports: 08/08/2011

Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186

Last EDR Contact: 10/05/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Varies TC3220399.2s Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT DOT OPS: Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data.

Date of Government Version: 07/29/2011 Date Data Arrived at EDR: 08/09/2011

Date Made Active in Reports: 11/11/2011

Number of Days to Update: 94 Source: Department of Transporation, Office of Pipeline Safety Telephone: 202-366-4595

Last EDR Contact: 11/08/2011

Next Scheduled EDR Contact: 02/20/2012

Data Release Frequency: Varies DOD: Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that

have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands.

Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006

Date Made Active in Reports: 01/11/2007

Number of Days to Update: 62 Source: USGS Telephone: 888-275-8747

Last EDR Contact: 10/20/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Semi-Annually FUDS: Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers

is actively working or will take necessary cleanup actions.

Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/12/2010

Date Made Active in Reports: 12/02/2010

Number of Days to Update: 112 Source: U.S. Army Corps of Engineers Telephone: 202-528-4285

Last EDR Contact: 09/12/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Varies CONSENT: Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released

periodically by United States District Courts after settlement by parties to litigation matters.

Date of Government Version: 06/01/2011 Date Data Arrived at EDR: 08/19/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 41 Source: Department of Justice, Consent Decree Library Telephone: Varies

Last EDR Contact: 10/03/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Varies ROD: Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical

and health information to aid in the cleanup.

Date of Government Version: 07/31/2011 Date Data Arrived at EDR: 09/14/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 15 Source: EPA Telephone: 703-416-0223

Last EDR Contact: 09/14/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Annually UMTRA: Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills

shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings

were used as construction materials before the potential health hazards of the tailings were recognized.

Date of Government Version: 09/14/2010 Date Data Arrived at EDR: 10/21/2010

Date Made Active in Reports: 01/28/2011

Number of Days to Update: 99 Source: Department of Energy Telephone: 505-845-0011

Last EDR Contact: 11/29/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Varies TC3220399.2s Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT MINES: Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes

violation information.

Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 09/08/2011

Date Made Active in Reports: 09/29/2011

Number of Days to Update: 21 Source: Department of Labor, Mine Safety and Health Administration Telephone: 303-231-5959

Last EDR Contact: 12/07/2011

Next Scheduled EDR Contact: 03/19/2012

Data Release Frequency: Semi-Annually TRIS: Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and

land in reportable quantities under SARA Title III Section 313.

Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/17/2010

Date Made Active in Reports: 03/21/2011

Number of Days to Update: 94 Source: EPA Telephone: 202-566-0250

Last EDR Contact: 12/02/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Annually TSCA: Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the

TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant

site.Date of Government Version: 12/31/2006 Date Data Arrived at EDR: 09/29/2010

Date Made Active in Reports: 12/02/2010

Number of Days to Update: 64 Source: EPA Telephone: 202-260-5521

Last EDR Contact: 09/27/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Every 4 Years FTTS: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control A ct)FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA,

TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the

Agency on a quarterly basis.

Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009

Date Made Active in Reports: 05/11/2009

Number of Days to Update: 25 Source: EPA/Office of Prevention, Pesticides and Toxic Substances Telephone: 202-566-1667

Last EDR Contact: 11/28/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Quarterly FTTS INSP: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Cont rol Act)A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements.

Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009

Date Made Active in Reports: 05/11/2009

Number of Days to Update: 25 Source: EPA Telephone: 202-566-1667

Last EDR Contact: 11/28/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Quarterly HIST FTTS: FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The

information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA

(Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions

are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters

with updated records, it was decided to create a HIST FTTS database. It included records that may not be included

in the newer FTTS database updates. This database is no longer updated.

TC3220399.2s Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007

Date Made Active in Reports: 04/10/2007

Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501

Last EDR Contact: 12/17/2007

Next Scheduled EDR Contact: 03/17/2008

Data Release Frequency: No Update Planned HIST FTTS INSP: FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA

regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation

of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some

EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing

EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that

may not be included in the newer FTTS database updates. This database is no longer updated.

Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007

Date Made Active in Reports: 04/10/2007

Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501

Last EDR Contact: 12/17/2008

Next Scheduled EDR Contact: 03/17/2008

Data Release Frequency: No Update Planned SSTS: Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all

registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March

1st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices

being produced, and those having been produced and sold or distributed in the past year.

Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010

Date Made Active in Reports: 02/25/2011

Number of Days to Update: 77 Source: EPA Telephone: 202-564-4203

Last EDR Contact: 10/31/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Annually ICIS: Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement

and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES)

program.Date of Government Version: 01/07/2011 Date Data Arrived at EDR: 01/21/2011

Date Made Active in Reports: 03/21/2011

Number of Days to Update: 59 Source: Environmental Protection Agency Telephone: 202-564-5088

Last EDR Contact: 09/26/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Quarterly PADS: PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers

of PCB's who are required to notify the EPA of such activities.

Date of Government Version: 11/01/2010 Date Data Arrived at EDR: 11/10/2010

Date Made Active in Reports: 02/16/2011

Number of Days to Update: 98 Source: EPA Telephone: 202-566-0500

Last EDR Contact: 10/19/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Annually MLTS: Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which

possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency,

EDR contacts the Agency on a quarterly basis.

Date of Government Version: 06/21/2011 Date Data Arrived at EDR: 07/15/2011

Date Made Active in Reports: 09/13/2011

Number of Days to Update: 60 Source: Nuclear Regulatory Commission Telephone: 301-415-7169

Last EDR Contact: 09/12/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Quarterly TC3220399.2s Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT RADINFO: Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S.

Environmental Protection Agency (EPA) regulations for radiation and radioactivity.

Date of Government Version: 01/11/2011 Date Data Arrived at EDR: 01/13/2011

Date Made Active in Reports: 02/16/2011

Number of Days to Update: 34 Source: Environmental Protection Agency Telephone: 202-343-9775

Last EDR Contact: 10/13/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly FINDS: Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and 'pointers' to other sources that contain more

detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric

Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial

enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal

Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities

Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System).

Date of Government Version: 04/14/2010 Date Data Arrived at EDR: 04/16/2010

Date Made Active in Reports: 05/27/2010

Number of Days to Update: 41 Source: EPA Telephone: (312) 353-2000

Last EDR Contact: 09/13/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Quarterly RAATS: RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA

pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration

actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of

the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources

made it impossible to continue to update the information contained in the database.

Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995

Date Made Active in Reports: 08/07/1995

Number of Days to Update: 35 Source: EPA Telephone: 202-564-4104

Last EDR Contact: 06/02/2008

Next Scheduled EDR Contact: 09/01/2008

Data Release Frequency: No Update Planned BRS: Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation

and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG)

and Treatment, Storage, and Disposal Facilities.

Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 03/01/2011

Date Made Active in Reports: 05/02/2011

Number of Days to Update: 62 Source: EPA/NTIS Telephone: 800-424-9346

Last EDR Contact: 11/30/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Biennially BRRTS: Bureau of Remediation & Redevelopment Tracking System TC3220399.2s Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT BRRTS is a tracking system of contaminated sites. It holds key information for finding out more about a site or an activity. Activity types included are: Abandoned Container - An abandoned container with potentially hazardous

contents recovered from a site. No discharge to the environment occurs. If the container did release a hazardous

substance, a spill would be associated with the site. Superfund - is a federal program created by Congress in

1980 to finance cleanup of the nation's worst hazardous waste sites. VPLE - Voluntary Property Liability Exemptions

apply to sites in which a property owner conducts an environmental investigation and cleanup of an entire property

and then receives limits on their future liability. General Property - Environmental actions which apply to the

property as a whole, rather than a specific source of contamination, such as the LUST or environmental repair

site. Examples would be off-site letters, municipal liability clarification letters, lease letters, voluntary

party liability exemption actions, and general liability clarification letters.

Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011

Date Made Active in Reports: 08/01/2011

Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 11/03/2011

Next Scheduled EDR Contact: 01/23/2012

Data Release Frequency: Quarterly NPDES: NPDES Permit Listing A listing of stormwater permit industrial facilities.

Date of Government Version: 09/01/2011 Date Data Arrived at EDR: 09/01/2011

Date Made Active in Reports: 10/14/2011

Number of Days to Update: 43 Source: Department of Natural Resources Telephone: 608-264-8971

Last EDR Contact: 11/30/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Quarterly WI MANIFEST: Manifest Information Hazardous waste manifest information.

Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/19/2011

Date Made Active in Reports: 09/15/2011

Number of Days to Update: 27 Source: Department of Natural Resources Telephone: N/A

Last EDR Contact: 09/19/2011

Next Scheduled EDR Contact: 01/02/2012

Data Release Frequency: Annually DRYCLEANERS: Five Star Recognition Program Sites Drycleaning facilities enrolled in the Five Star Recognition Program. The primary focus of the Five Star program

is to encourage reductions in the use and emissions of perchloroethylene (perc), a common but potentially hazardous

drycleaning solvent. Participating cleaners pursue recycling opportunities, spill prevention strategies, more

efficient solvent use, and more wet cleaning to reduce their perc consumption.

Date of Government Version: 10/05/2011 Date Data Arrived at EDR: 10/06/2011

Date Made Active in Reports: 10/25/2011

Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-267-3125

Last EDR Contact: 09/23/2011

Next Scheduled EDR Contact: 01/02/2012

Data Release Frequency: Varies WRRSER: Wisconsin Remedial Response Site Evaluation Report The WRRSER provides information about location, status, and priority of sites or facilities in the state which

are known to cause or have a high potential to cause environmental pollution.

Date of Government Version: 10/01/1995 Date Data Arrived at EDR: 01/02/1996

Date Made Active in Reports: 02/01/1996

Number of Days to Update: 30 Source: Department of Natural Resources Telephone: 608-261-6422

Last EDR Contact: 10/03/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: No Update Planned AIRS: Air Permit Program Listing A listing of permits issued by the Air Permit Program.

TC3220399.2s Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/05/2011

Date Made Active in Reports: 09/15/2011

Number of Days to Update: 41 Source: Department of Natural Resources Telephone: 608-266-2621

Last EDR Contact: 10/24/2011

Next Scheduled EDR Contact: 02/06/2012

Data Release Frequency: Annually TIER 2: Tier 2 Facility Listing A listing of facilities which store or manufacture hazardous materials that submit a chemical inventory report.

Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/17/2010

Date Made Active in Reports: 09/29/2010

Number of Days to Update: 43 Source: Department of Natural Resources Telephone: 608-242-3225

Last EDR Contact: 10/24/2011

Next Scheduled EDR Contact: 02/06/2012

Data Release Frequency: Varies LEAD: Lead Inspection Data Lead inspection information.

Date of Government Version: 04/29/2011 Date Data Arrived at EDR: 04/29/2011

Date Made Active in Reports: 06/06/2011

Number of Days to Update: 38 Source: Department of Health & Family Services Telephone: 608-267-0473

Last EDR Contact: 10/25/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Annually INDIAN RESERV: Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater

than 640 acres.

Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 12/08/2006

Date Made Active in Reports: 01/11/2007

Number of Days to Update: 34 Source: USGS Telephone: 202-208-3710

Last EDR Contact: 10/20/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Semi-Annually SCRD DRYCLEANERS: State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office

of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established

drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas,

Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin.

Date of Government Version: 03/07/2011 Date Data Arrived at EDR: 03/09/2011

Date Made Active in Reports: 05/02/2011

Number of Days to Update: 54 Source: Environmental Protection Agency Telephone: 615-532-8599

Last EDR Contact: 10/24/2011

Next Scheduled EDR Contact: 02/06/2012

Data Release Frequency: Varies FEDLAND: Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps

of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land,

Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management,

Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service.

Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006

Date Made Active in Reports: 01/11/2007

Number of Days to Update: 339 Source: U.S. Geological Survey Telephone: 888-275-8747

Last EDR Contact: 10/20/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: N/A COAL ASH EPA: Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings.

TC3220399.2s Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/17/2010 Date Data Arrived at EDR: 01/03/2011

Date Made Active in Reports: 03/21/2011

Number of Days to Update: 77 Source: Environmental Protection Agency Telephone: N/A

Last EDR Contact: 09/16/2011

Next Scheduled EDR Contact: 12/26/2011

Data Release Frequency: Varies FINANCIAL ASSURANCE 1: Financial Assurance Information Listing Financial Assurance information.

Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 09/27/2011

Date Made Active in Reports: 10/14/2011

Number of Days to Update: 17 Source: Department of Natural Resources Telephone: 608-266-6965

Last EDR Contact: 09/26/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Varies COAL ASH: Coal Ash Disposal Site Listing A listing of coal combusion monofills.

Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/18/2011

Date Made Active in Reports: 04/12/2011

Number of Days to Update: 25 Source: Deaprtment of Natural Resources Telephone: 608-267-3538

Last EDR Contact: 10/03/2011

Next Scheduled EDR Contact: 01/16/2012

Data Release Frequency: Varies PCB TRANSFORMER: PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals.

Date of Government Version: 01/01/2008 Date Data Arrived at EDR: 02/18/2009

Date Made Active in Reports: 05/29/2009

Number of Days to Update: 100 Source: Environmental Protection Agency Telephone: 202-566-0517

Last EDR Contact: 11/04/2011

Next Scheduled EDR Contact: 02/13/2012

Data Release Frequency: Varies COAL ASH DOE: Sleam-Electric Plan Operation Data A listing of power plants that store ash in surface ponds.

Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009

Date Made Active in Reports: 10/22/2009

Number of Days to Update: 76 Source: Department of Energy Telephone: 202-586-8719

Last EDR Contact: 10/18/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Varies FINANCIAL ASSURANCE 2: Financial Assurance Information Listing Information for underground storage tanks. Financial assurance is intended to ensure that resources are available

to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated

facility is unable or unwilling to pay.

Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 10/19/2011

Date Made Active in Reports: 11/22/2011

Number of Days to Update: 34 Source: Department of Commerce Telephone: 608-266-0956

Last EDR Contact: 09/26/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Varies EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas Plants: EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants)

compiled by EDR's researchers. Manufactured gas sites were used in the United States from the 1800's to 1950's

to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture

of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production,

such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds

are potentially hazardous to human health and the environment. The byproduct from this process was frequently

disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil

and groundwater contamination.

TC3220399.2s Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: N/A Date Data Arrived at EDR: N/A

Date Made Active in Reports: N/A

Number of Days to Update: N/A Source: EDR, Inc.

Telephone: N/A

Last EDR Contact: N/A

Next Scheduled EDR Contact: N/A

Data Release Frequency: No Update Planned OTHER DATABASE(S)

Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the

area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily

mean that wetlands do not exist in the area covered by the report.

CT MANIFEST: Hazardous Waste Manifest Data Facility and manifest data. Manifest is a document that lists and tracks hazardous waste from the generator through

transporters to a tsd facility.

Date of Government Version: 12/31/2007 Date Data Arrived at EDR: 08/26/2009

Date Made Active in Reports: 09/11/2009

Number of Days to Update: 16 Source: Department of Environmental Protection Telephone: 860-424-3375

Last EDR Contact: 11/22/2011

Next Scheduled EDR Contact: 03/05/2012

Data Release Frequency: Annually NJ MANIFEST: Manifest Information Hazardous waste manifest information.

Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 07/20/2011

Date Made Active in Reports: 08/11/2011

Number of Days to Update: 22 Source: Department of Environmental Protection Telephone: N/A

Last EDR Contact: 10/18/2011

Next Scheduled EDR Contact: 01/30/2012

Data Release Frequency: Annually NY MANIFEST: Facility and Manifest Data Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a TSD

facility.

Date of Government Version: 08/01/2011 Date Data Arrived at EDR: 08/09/2011

Date Made Active in Reports: 09/16/2011

Number of Days to Update: 38 Source: Department of Environmental Conservation Telephone: 518-402-8651

Last EDR Contact: 11/08/2011

Next Scheduled EDR Contact: 02/20/2012

Data Release Frequency: Annually PA MANIFEST: Manifest Information Hazardous waste manifest information.

Date of Government Version: 12/31/2008 Date Data Arrived at EDR: 12/01/2009

Date Made Active in Reports: 12/14/2009

Number of Days to Update: 13 Source: Department of Environmental Protection Telephone: 717-783-8990

Last EDR Contact: 09/26/2011

Next Scheduled EDR Contact: 01/09/2012

Data Release Frequency: Annually RI MANIFEST: Manifest information Hazardous waste manifest information Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 06/24/2011

Date Made Active in Reports: 06/30/2011

Number of Days to Update: 6 Source: Department of Environmental Management Telephone: 401-222-2797

Last EDR Contact: 11/28/2011

Next Scheduled EDR Contact: 03/12/2012

Data Release Frequency: Annually TC3220399.2s Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT VT MANIFEST: Hazardous Waste Manifest Data Hazardous waste manifest information.

Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/26/2011

Date Made Active in Reports: 09/14/2011

Number of Days to Update: 19 Source: Department of Environmental Conservation Telephone: 802-241-3443

Last EDR Contact: 10/24/2011

Next Scheduled EDR Contact: 02/06/2012

Data Release Frequency: AnnuallyOil/Gas Pipelines:This data was obtained by EDR from the USGS in 1994. It is referred to by USGS as GeoData Digital Line Graphs from 1:100,000-Scale Maps. It was extracted from the transportation category including some oil, but primarily

gas pipelines.

Electric Power Transmission Line Data Source: Rextag Strategies Corp.

Telephone: (281) 769-2247

U.S. Electric Transmission and Power Plants Systems Digital GIS DataSensitive Receptors:There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivit yto environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the locat ion of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers,and nursing homes - where individuals who are sensitive receptors are likely to be located.

AHA Hospitals:

Source: American Hospital Association, Inc.

Telephone: 312-280-5991

The database includes a listing of hospitals based on the American Hospital Association's annual survey of hospitals.

Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services

Telephone: 410-786-3000

A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services,

a federal agency within the U.S. Department of Health and Human Services.

Nursing Homes Source: National Institutes of Health

Telephone: 301-594-6248

Information on Medicare and Medicaid certified nursing homes in the United States.

Public Schools Source: National Center for Education Statistics

Telephone: 202-502-7300

The National Center for Education Statistics' primary database on elementary

and secondary public education in the United States. It is a comprehensive, annual, national statistical

database of all public elementary and secondary schools and school districts, which contains data that are

comparable across all states.

Private Schools Source: National Center for Education Statistics

Telephone: 202-502-7300

The National Center for Education Statistics' primary database on private school locations in the United States.

Daycare Centers: Day Care Directory Source: Department of Health & Family Services

Telephone: 608-266-9314Flood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.

Scanned Digital USGS 7.5' Topographic Map (DRG)

Source: United States Geologic Survey

A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images

are made by scanning published paper maps on high-resolution scanners. The raster image

is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.

TC3220399.2s Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT STREET AND ADDRESS INFORMATION

© 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.

TC3220399.2s Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT TC3220399.2s Page A-1 geologic strata.

of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the

Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics

2. Groundwater flow velocity.
1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components:

forming an opinion about the impact of potential contaminant migration.

EDR's GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1991Most Recent Revision:

44089-E5 STEVENS POINT, WI West Map:

1976Most Recent Revision:

44089-D5 WHITING, WI Southwest Map:

1969Most Recent Revision:

44089-D4 ARNOTT, WI South Map:

1986Most Recent Revision:

44089-E4 POLONIA, WI Target Property Map:

USGS TOPOGRAPHIC MAP 1113 ft. above sea level Elevation:

4931000.0 UTM Y (Meters):

301598.3UTM X (Meters):

Zone 16Universal Tranverse Mercator:

89.4959 - 89 29' 45.3

Longitude (West):

44.50700 - 44 30' 25.2

Latitude (North):

TARGET PROPERTY COORDINATES STEVENS POINT, WI 54482 LANDS END WAY,

SHINE MEDICAL STEVENS POINT, WI TARGET PROPERTY ADDRESSGEOCHECK - PHYSICAL SETTING SOURCE ADDENDUMDRAFT TC3220399.2s Page A-2 should be field verified.

on a relative (not an absolute) basis. Relative elevation information between sites of close proximity

Source: Topography has been determined from the USGS 7.5' Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)

Elevation (ft)

TPTP01/21 MilesTarget Property Elevation: 1113 ft.NorthSouthWestEast1106110711081110 111011111111 111111111113 111311141115111411131113 1113111211121105110511071108110911101111 111111111113 111311141115111611181120112111241125General SW General Topographic Gradient:

TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted.

assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or,

Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).

sources of information, such as surface topographic information, hydrologic information, hydrogeologic data

using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other

Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATIONGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s Page A-3 Not Reported GENERAL DIRECTION LOCATIONGROUNDWATER FLOW FROM TPMAP IDhydrogeologically, and the depth to water table.

authorities at select sites and has extracted the date of the report, groundwater flow direction as determined

flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory

EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW Search Radius: 1.000 Mile.

Not found Status:

1.25 miles Search Radius:

Site-Specific Hydrogeological Data*:

  • ©1996 Sitespecific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the inform ation and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation.

contamination exist on the target property, what downgradient sites might be impacted.

environmental professional in forming an opinion about the impact of nearby contaminated properties or, should

of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the

Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail Map NOT AVAILABLE NATIONAL WETLAND INVENTORY NWI Electronic Data Coverage NWI Quad at Target Property Not Reported Additional Panels in search area:

55097C - FEMA DFIRM Flood data Flood Plain Panel at Target Property:

YES - refer to the Overview Map and Detail Map PORTAGE, WI FEMA FLOOD ZONE FEMA Flood Electronic Data Target Property County and bodies of water).

Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted.

the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should

Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATIONGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s Page A-4 Map, USGS Digital Data Series DDS - 11 (1994).

of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman

Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, GeologyROCK STRATIGRAPHIC UNITGEOLOGIC AGE IDENTIFICATION Stratified Sequence Category:

Paleozoic Era:CambrianSystem:CambrianSeries:CCode: (decoded above as Era, System & Series) at which contaminant migration may be occurring.

Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils.

characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes

to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil

using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary

Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATIONGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT EDR Inc.EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.

EDR Inc.1230 1/16 1/8 1/4 Miles DRAFT TC3220399.2s Page A-6 Well drained Soil Drainage Class:

textures.

moderately well and well drained soils with moderately coarse

Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:

sandy loam Soil Surface Texture:

BillettSoil Component Name:

Soil Map ID: 2 Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sand59 inches 40 inches 5Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 40 inches 33 inches 4Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sandy loam 33 inches 27 inches 3Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 27 inches 7 inches 2Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic

conductivity

micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

LowCorrosion Potential - Uncoated Steel:

Hydric Status: Not hydric Somewhat excessively drained Soil Drainage Class:

excessively drained sands and gravels.

Class A - High infiltration rates. Soils are deep, well drained to Hydrologic Group:

loamy sand Soil Surface Texture:

RichfordSoil Component Name:

Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data.

for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns

Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information

The U.S. Department of Agriculture's (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTYGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s Page A-7 Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported loam 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic

conductivity

micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

LowCorrosion Potential - Uncoated Steel:

Hydric Status: Not hydric Well drained Soil Drainage Class:

textures.

moderately well and well drained soils with moderately coarse

Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:

loamSoil Surface Texture:

RosholtSoil Component Name:

Soil Map ID: 3 Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 59 inches 33 inches 4Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 33 inches 27 inches 3Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 27 inches 9 inches 2Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 9 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic

conductivity

micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

LowCorrosion Potential - Uncoated Steel:

Hydric Status: Not hydricGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s Page A-8 1/2 - 1 Mile SSW USGS2429210 161/2 - 1 Mile South USGS2429203 151/2 - 1 Mile WSW USGS2429044 141/2 - 1 Mile South USGS2429204 131/2 - 1 Mile NE USGS2429102 121/2 - 1 Mile WNW USGS2429076 111/2 - 1 Mile West USGS2429070 101/2 - 1 Mile West USGS2429067 91/2 - 1 Mile SSE USGS2429032 A71/2 - 1 Mile SSE USGS2429033 A61/2 - 1 Mile SE USGS2429047 51/2 - 1 Mile North USGS2429094 41/2 - 1 Mile ENE USGS2429073 31/2 - 1 Mile West USGS2429066 21/4 - 1/2 Mile SSW USGS2429048 1FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP ID1.000State Database Nearest PWS within 1 mile Federal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)

DATABASEopinion about the impact of contaminant migration on nearby drinking water wells.

professional in assessing sources that may impact ground water flow direction, and in forming an

EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported to gravel stratified sand 59 inches 33 inches 5Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandgravelly loamy 33 inches 27 inches 4Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandy loam gravelly fine 27 inches 12 inches 3Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported fine sandy loam 12 inches 7 inches 2Soil Layer InformationBoundaryClassification Saturated hydraulic

conductivity

micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)GEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s Page A-9 1/2 - 1 Mile WSW WI3000000008386 8STATE DATABASE WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDNote: PWS System location is not always the same as well location.

No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATIONFROM TPWELL IDMAP ID1/2 - 1 Mile SSW USGS2429138 201/2 - 1 Mile ENE USGS2429081 B191/2 - 1 Mile ENE USGS2429083 B181/2 - 1 Mile ENE USGS2429082 B17FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDGEOCHECK - PHYSICAL SETTING SOURCE SUMMARYDRAFT PHYSICAL SETTING SOURCE MAP-3220399.2s N County Boundary N Major Roads N Contour Lines @ Earthquake epicenter, Richw 5 or greater Wa1BI'Wells Public Water Supply W*lls Cluster of Multiple Icons SITE NAME: SHINE Medical Stevens Point, WI ADDRESS: Lands End Way, Stevens Point WI 54482 LAT/LONG: 44.5070/89.4959 0 1/4 112 + Groundwater Flow Direction

@I) lndetarrninata Groundwa1ar Flow at Location (ill Grol.ndwatlr Flow Varies at Location

<HID Closest Hydrogeological Data ' i:l : Golder Associates CONTACT:

INQUIRY II: 3220399.2s DATE: December 07, 2011 11:47 am TC3220399.2s Page A-11 2West 1/2 - 1 Mile

LowerUSGS2429066 FED USGS1964-06-0712.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1964-06-07 Ground water data end date:

Ground water data begin date: 1964-06-07 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

80.0Hole depth:

80.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00Altitude:

24000Map scale:

POLONIALocation map:

NESWS01 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.49872787 Dec lon:44.50135807 Dec lat:0892955Longitude:

USGS2429048 EDR Site id:

443005Latitude:

PT-23/08E/01-0511 Site name:

443005089295501 Site no:USGSAgency cd:

1SSW 1/4 - 1/2 Mile

LowerUSGS2429048 FED USGSMap IDDirection

Distance Elevation EDR ID Number DatabaseGEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-12 CSTMean greenwich time offset:

19870429Date inventoried:

19850618Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1120Altitude:

24000Map scale:

POLONIALocation map:

NWNWS06 T23N R09E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.48650552 Dec lon:44.51052505 Dec lat:0892911Longitude:

USGS2429073 EDR Site id:

443038Latitude:

PT-23/09E/06-1157 Site name:

443038089291101 Site no:USGSAgency cd:

3ENE 1/2 - 1 Mile

HigherUSGS2429073 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

MCoor accr:

MCoor meth:

-89.50622809 Dec lon:44.50746908 Dec lat:0893022Longitude:

USGS2429066 EDR Site id:

443027Latitude:

PERM 24126 Site name:

443027089302201 Site no:WI001Agency cd:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-13 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

MCoor accr:

MCoor meth:

-89.49733911 Dec lon:44.51469148 Dec lat:0892950Longitude:

USGS2429094 EDR Site id:

443053Latitude:

PERM 24279 Site name:

443053089295001 Site no:WI001Agency cd:

4North 1/2 - 1 Mile

HigherUSGS2429094 FED USGS1985-06-186.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1985-06-18 Ground water data end date:

Ground water data begin date: 1985-06-18 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

71.0Hole depth:

71.0Well depth:

SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-14 A6SSE 1/2 - 1 Mile

HigherUSGS2429033 FED USGS1963-04-0121.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1963-04-01 Ground water data end date:

Ground water data begin date: 1963-04-01 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

116Hole depth:

116Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1130.00Altitude:

24000Map scale:

POLONIALocation map:

S06 T023N R009E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

TCoor accr:

MCoor meth:

-89.48733876 Dec lon:44.50108056 Dec lat:0892914Longitude:

USGS2429047 EDR Site id:

443004Latitude:

PT-23/09E/06-0486 Site name:

443004089291401 Site no:USGSAgency cd:

5SE 1/2 - 1 Mile

HigherUSGS2429047 FED USGSMap IDDirection

Distance Elevation EDR ID Number DatabaseGEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-15 CSTMean greenwich time offset:

Not Reported Date inventoried:

19591113Date construction:

Ground-water other than Spring Site type:

Flat surface Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

.1Altitude accuracy:

Level or other surveying method Altitude method:

1115.32Altitude:

24000Map scale:

ARNOTTLocation map:

NENENES12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:

USGS2429032 EDR Site id:

442954Latitude:

PT-23/08E/12-0361 Site name:

442954089292101 Site no:USGSAgency cd:

A7SSE 1/2 - 1 Mile

HigherUSGS2429032 FED USGS1959-10-1613.83 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1959-10-16 Ground water data end date:

Ground water data begin date: 1959-10-16 2Water quality data count:

1974-07-12 Water quality data end date:

1965-06-10 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

drillerSource of depth data:

92.0Hole depth:

87.4Well depth:

QUATERNARY Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

19591016Date construction:

Ground-water other than Spring Site type:

Flat surface Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1113.00Altitude:

24000Map scale:

ARNOTTLocation map:

NENENES12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:

USGS2429033 EDR Site id:

442954Latitude:

PT-23/08E/12-0360 Site name:

442954089292102 Site no:USGSAgency cd:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-16 Not Reported Block no:

Not Reported Lot no:Not Reported Subdivisio:

Not Reported Well stree:

Not Reported Fire:STEVENS POINT Municipal1:

CMunicipal:

0490Construc 6:

54467Construc 5:

WIConstruc 4:

PLOVERConstruc 3:

PO BOX 490 Construc 2:

3262Construc 1:

ROBERTS IRRIGATION CO INC Constructo:

01/03/2008 Dnr rece 2:

01/03/2008 Dnr rece 1:

10/18/2007 Dnr receiv:

06/21/2007 Complete d:

Not Reported Owner ph 1:

Not Reported Owner phon:

Not Reported Owner are:

Not Reported Owner zip2:

54481Owner zip1:

WIOwner stat:

STEVENS POINT Owner city:

3217 JOHN JOANIS DR Owner mail:

ADVENTURE 2120 Owner name:

Not Reported Tax parcel:

6District c:

5.0E+001County cod:

Not Reported County wel:

TY626Wi unique:

8WSW 1/2 - 1 Mile

LowerWI3000000008386 WI WELLS1959-11-139.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1959-11-13 Ground water data end date:

Ground water data begin date: 1959-11-13 1Water quality data count:

1965-06-10 Water quality data end date:

1965-06-10 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

drillerSource of depth data:

31.3Hole depth:

31.3Well depth:

QUATERNARY Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-17 Not Reported Animal yar:

0Pav anim 1:

Not Reported Pav animal:

0Wastewtr a:

Not Reported Wastewtr s:

0Clewtr amt:

Not Reported Clewtr sum:

0Coll sew 1:

Not Reported Coll sewer:

Not Reported Build se 3:

Not Reported Build se 2:

0Build se 1:

Not Reported Build sewe:

Not Reported Build dr 2:

0Build dr 1:

Not Reported Build drai:

0Found dr 1:

Not Reported Found drai:

0Found cl 1:

Not Reported Found clwt:

0Privy amt:

Not Reported Privy code:

0Dwnspot 1:

Not Reported Dwnspot hy:

0Shorline p:

Not Reported Shoreline:

0Buried p 1:

Not Reported Buried pet:

0Buried o 1:

Not Reported Buried oil:

0Nonconfo 1:

Not Reported Nonconform:

0Sew abso 1:

Not Reported Sew absorb:

0Septic t 1:

Not Reported Septic tan:

1.4E+001Build oh a:

Not Reported Build over:

0Landfill a:

Not Reported Landfill q:

NFlood plai:

Not Reported Highest po:

NHicap prop:

NHicap well:

IRRIGATION Facility t:

Not Reported Service co:

XWell categ:

Not Reported Other expl:

1Well type:

Not Reported New well i:

Not Reported Prev well:

Not Reported Replace re:

Not Reported Orig year:

1Well statu:

EE w:8.0E+000Range no:

2.3E+001Township n:

2.0E+000Section:NEQuar:SEQuar quar:

Not Reported Govt lot:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-18 BStatic w 1:

2.7E+001Static wtr:

Not Reported Depth:SSacks ya 1:

Not Reported Seal num 1:

5.3E+001Seal to 1:

3.1E+001Seal from1:

  1. 20 RED FLINT Seal kind1:

SSacks yard:

Not Reported Seal numbe:

3.1E+001Seal to am:

0Seal from:

DRILL CUTTINGS Seal kind:

Not Reported Seal metho:

5.3E+001Screen to:

4.3E+001Screen fro:

JOHNSON #20 GALV Screen Type:

6.0E+000Screen dia:

0Cls to a 3:

0Cls to a 2:

0Cls to a 1:

4.3E+001Cls to amt:

0Cls from 3:

0Cls from 2:

0Cls from 1:

0Cls from a:

Not Reported Cls desc 3:

Not Reported Cls desc 2:

Not Reported Cls desc 1:

A53 BLACK NORTHWEST PIPE .280 WELDED Cls desc t:

0Cls dia 3:

0Cls dia 2:

0Cls dia 1:

6.0E+000Cls dia am:

Not Reported Other ex 1:

Not Reported Other dril:

Not Reported Remove exp:

Not Reported Temp otr r:

0Dia temp a:

Not Reported Tem otr ca:

0Cable bit1:

Not Reported Cable bit:

Not Reported Rev rot co:

Not Reported Rot foam c:

Not Reported Rot air co:

XRot mud co:

0Dr4 to amt:

0Dr4 from a:

0Dr4 dia am:

0Dr3 to amt:

0Dr3 from a:

0Dr3 dia am:

0Dr2 to amt:

0Dr2 from a:

0Dr2 dia am:

5.3E+001Dr1 to amt:

0Dr1 from a:

9.0E+000Dr1 dia am:

Not Reported Nr112 text:

0Nr 112 a 1:

Not Reported Nr 112 amt:

Not Reported Manure s 2:

0Manure s 1:

Not Reported Manure sto:

Not Reported Manure t 1:

Not Reported Manure typ:

0Manure p 1:

Not Reported Manure pip:

0Barn gut 1:

Not Reported Barn gutte:

Not Reported Silo type:

0Silo amt:

Not Reported Silo:0Animal y 1:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-19 9West 1/2 - 1 Mile

LowerUSGS2429067 FED USGSWI3000000008386 Site id:Not Reported Empty gy:

26915464Notificati:

WELL CONSTRUCTION Record sou:

1117Batch:4Spec capac:

09/07/2006 Approval d:

Not Reported Approval n:

Not Reported Fid 1:Not Reported Common wel:

Not Reported Hicap no:

0Collet sew:

Not Reported Collect se:

Not Reported Varince is:

Not Reported Temp outer:

Not Reported Lower cabl:

Not Reported Lower ro 2:

Not Reported Lower ro 1:

Not Reported Lower rota:

Not Reported Drill casi:

GPS008Lat long m:

30.555Long minut:

89Long degre:

30.192Lat minute:

44Lat degree:

PORTAGECounty tex:

5.3E+001Bottom:05/22/2008 File creat:

Not Reported Shoreline1:

Not Reported Septic typ:

0Ditch amt:

YLabel sent:

Not Reported Comment fl:

10/15/2007 Ro sign da:

PRRig op ini:

10/15/2007 Wc sign da:

JPWell cont:

Not Reported Proper s 1:

Not Reported Proper sea:

YWell cappe:

YWell disin:

YWell dev c:

AWell abvbe:

1.3E+001Well depth:

1.0E+000Pump hrs t:

MPump by co:

3.0E+001Pump gals:

3.4E+001Pump wtr b:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-20 CSTMean greenwich time offset:

19870422Date inventoried:

19830603Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1112Altitude:

24000Map scale:

STEVENS POINT Location map:

NENWS01 T23N R08E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.51122822 Dec lon:44.50913568 Dec lat:0893040Longitude:

USGS2429070 EDR Site id:

443033Latitude:

PT-23/08E/01-1125 Site name:

443033089304001 Site no:USGSAgency cd:

10West 1/2 - 1 Mile

LowerUSGS2429070 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

78.0Hole depth:

78.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

10Altitude accuracy:

Interpolated from topographic map Altitude method:

1105.00Altitude:

24000Map scale:

STEVENS POINT Location map:

NWSENES02 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.51095042 Dec lon:44.50746901 Dec lat:0893039Longitude:

USGS2429067 EDR Site id:

443027Latitude:

PT-23/08E/02-0895 Site name:

443027089303901 Site no:USGSAgency cd:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-21 1Ground water data count:

1975-05-05 Ground water data end date:

Ground water data begin date: 1975-05-05 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

45.0Hole depth:

45.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1106.00Altitude:

24000Map scale:

STEVENS POINT Location map:

NENES02 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.51095046 Dec lon:44.51108014 Dec lat:0893039Longitude:

USGS2429076 EDR Site id:

443040Latitude:

PT-23/08E/02-0875 Site name:

443040089303901 Site no:USGSAgency cd:

11WNW1/2 - 1 Mile

LowerUSGS2429076 FED USGS1983-06-037.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1983-06-03 Ground water data end date:

Ground water data begin date: 1983-06-03 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

54.0Hole depth:

54.0Well depth:

SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-22 13South 1/2 - 1 Mile

LowerUSGS2429204 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

76Hole depth:

76Well depth:

SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

19870203Date inventoried:

19820512Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1117Altitude:

24000Map scale:

POLONIALocation map:

NWSWS31 T024N R009E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

TCoor accr:

MCoor meth:

-89.48678338 Dec lon:44.51663617 Dec lat:0892912Longitude:

USGS2429102 EDR Site id:

443100Latitude:

PT-24/09E/31-1076 Site name:

443100089291201 Site no:USGSAgency cd:

12NE1/2 - 1 Mile

HigherUSGS2429102 FED USGS1975-05-0523.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-23 CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

2.5Altitude accuracy:

Interpolated from topographic map Altitude method:

1100.00Altitude:

24000Map scale:

WHITINGLocation map:

SESES02 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.51122811 Dec lon:44.49996898 Dec lat:0893040Longitude:

USGS2429044 EDR Site id:

443000Latitude:

PT-23/08E/02-0593 Site name:

443000089304001 Site no:USGSAgency cd:

14WSW 1/2 - 1 Mile

LowerUSGS2429044 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

78.0Hole depth:

78.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00Altitude:

24000Map scale:

ARNOTTLocation map:

NES12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.49345004 Dec lon:44.49413604 Dec lat:0892936Longitude:

USGS2429204 EDR Site id:

442939Latitude:

PT-23/08E/12-1054 Site name:

442939089293601 Site no:USGSAgency cd:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-24 4Ground water data count:

1953-10-14 Ground water data end date:

Ground water data begin date: 1950-07-20 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

30.0Hole depth:

29.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1100.00Altitude:

24000Map scale:

ARNOTTLocation map:

SWNES12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

SCoor accr:

MCoor meth:

-89.49706122 Dec lon:44.49385818 Dec lat:0892949Longitude:

USGS2429203 EDR Site id:

442938Latitude:

PT-23/08E/12-0002 Site name:

442938089294901 Site no:USGSAgency cd:

15South1/2 - 1 Mile

LowerUSGS2429203 FED USGS1967-05-0421.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 1 1Ground water data count:

1967-05-04 Ground water data end date:

Ground water data begin date: 1967-05-04 0Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

86.0Hole depth:

86.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-25 B17ENE 1/2 - 1 Mile

HigherUSGS2429082 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

90.0Hole depth:

90.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1105.00Altitude:

24000Map scale:

WHITINGLocation map:

NWNWS12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

SCoor accr:

MCoor meth:

-89.50567249 Dec lon:44.49580245 Dec lat:0893020Longitude:

USGS2429210 EDR Site id:

442945Latitude:

PT-23/08E/12-0894 Site name:

442945089302001 Site no:USGSAgency cd:

16SSW1/2 - 1 Mile

LowerUSGS2429210 FED USGS1950-10-1710.421950-07-2010.031953-10-149.201950-11-2510.91 DateFeet below SurfaceFeet toSealevel-------------------------------------------------

DateFeet below SurfaceFeet toSealevel-------------------------------------------------

Ground-water levels, Number of Measurements: 4GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-26 CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

MCoor accr:

MCoor meth:

-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:

USGS2429083 EDR Site id:

443043Latitude:

PERM 24110 Site name:

443043089284103 Site no:WI001Agency cd:

B18ENE 1/2 - 1 Mile

HigherUSGS2429083 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

MCoor accr:

MCoor meth:

-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:

USGS2429082 EDR Site id:

443043Latitude:

PERM 23908 Site name:

443043089284102 Site no:WI001Agency cd:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-27 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

96.0Hole depth:

96.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1132.00Altitude:

24000Map scale:

POLONIALocation map:

SESWS31 T024N R009E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

FCoor accr:

MCoor meth:

-89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:

USGS2429081 EDR Site id:

443043Latitude:

PT-24/09E/31-0828 Site name:

443043089284101 Site no:USGSAgency cd:

B19ENE 1/2 - 1 Mile

HigherUSGS2429081 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-28 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

drillerSource of depth data:

80.0Hole depth:

80.0Well depth:

Not Reported Aquifer:Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

YLocal standard time flag:

CSTMean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00Altitude:

24000Map scale:

WHITINGLocation map:

NWSENWS12 T023N R008E 4 Land net:

USCountry:097County:55State:55District:

NAD83Dec latlong datum:

NAD27Latlong datum:

SCoor accr:

MCoor meth:

-89.50372802 Dec lon:44.49385806 Dec lat:0893013Longitude:

USGS2429138 EDR Site id:

442938Latitude:

PT-23/08E/12-0512 Site name:

442838089301301 Site no:USGSAgency cd:

20SSW 1/2 - 1 Mile

LowerUSGS2429138 FED USGSMap IDDirection

Distance Elevation EDR ID Number DatabaseGEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s Page A-29 0%33%67%4.258 pCi/L BasementNot Reported Not Reported Not Reported Not Reported Living Area - 2nd Floor 0%0%100%1.150 pCi/L Living Area - 1st Floor

% >20 pCi/L

% 4-20 pCi/L

% <4 pCi/L Average Activity AreaNumber of sites tested: 24

Federal Area Radon Information for PORTAGE COUNTY, WI

Zone 3 indoor average level < 2 pCi/L.
Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L.

Note: Zone 1 indoor average level > 4 pCi/L.

Federal EPA Radon Zone for PORTAGE County: 1 AREA RADON INFORMATIONGEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADONDRAFT TOPOGRAPHIC INFORMATION USGS 7.5' Digital Elevation Model (DEM)

Source: United States Geologic Survey

EDR acquired the USGS 7.5' Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds

to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data

with consistent elevation units and projection.

Scanned Digital USGS 7.5' Topographic Map (DRG)

Source: United States Geologic Survey

A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images

are made by scanning published paper maps on high-resolution scanners. The raster image

is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.

HYDROLOGIC INFORMATIONFlood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.

HYDROGEOLOGIC INFORMATION AQUIFLOW Information System RSource: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has

extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table

information.

GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital

representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994).STATSGO:State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services

The U.S. Department of Agriculture's (USDA) Natural Resources Conservation Service (NRCS) leads the national

Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil

survey information for privately owned lands in the United States. A soil map in a soil survey is a representation

of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO)

soil survey maps.

SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services (NRCS)

Telephone: 800-672-5559

SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping

scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to

construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the

original soil survey maps. This level of mapping is designed for use by landowners, townships and county

natural resource planning and management.

TC3220399.2s Page A-30 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLSPWS:Public Water Systems Source: EPA/Office of Drinking Water

Telephone: 202-564-3750

Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources.PWS ENF:Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water

Telephone: 202-564-3750

Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS).USGS Water Wells: USGS National Water Inventory System (NWIS)

This database contains descriptive information on sites where the USGS collects or has collected data on surface

water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater.

STATE RECORDS

Wisconsin Well Construction Report File Source: Department of Natural Resources

Telephone: 608-266-0153

In the past, not all latitude/longitudes were accurate. Many were protracted from centroid (center of the quarter sections given in PLSS). The ones that were not accurate were removed from the well database.

OTHER STATE DATABASE INFORMATION RADONState Database: WI Radon Source: Department of Health & Family Services

Telephone: 608-266-1865

Wisconsin Measurement Summary Area Radon Information Source: USGS

Telephone: 703-356-4020

The National Radon Database has been developed by the U.S. Environmental Protection Agency

(USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey.

The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at

private sources such as universities and research institutions.

EPA Radon Zones Source: EPA

Telephone: 703-356-4020

Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor

radon levels.

OTHERAirport Landing Facilities:Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656Epicenters:World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration TC3220399.2s Page A-31 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT STREET AND ADDRESS INFORMATION

© 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.

TC3220399.2s Page A-32 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT