Latest revision as of 03:42, 11 January 2025

Text

Shine Medical Technologies, Inc., Application for Construction Permit Response to Environmental Requests for Additional Information, Enclosure 2 Attachment 19 - Draft Phase I Environmental Site Assessment (Stevens Point, Wi) (Part 1 of 9)
	ML13309B013
Person / Time
Site:	SHINE Medical Technologies
Issue date:	02/10/2012
From:	; SHINE Medical Technologies
To:	; Office of Nuclear Reactor Regulation
Shared Package
ML13303A887	List: ML13302C044; ML13309A984; ML13309A987; ML13309A988; ML13309A989; ML13309A990; ML13309A991; ML13309A992; ML13309A993; ML13309A994; ML13309A995; ML13309A996; ML13309B005; ML13309B006; ML13309B007; ML13309B008; ML13309B009; ML13309B010; ML13309B012; ML13309B013; ML13309B014; ML13309B016; ML13309B032; ML13309B033; ML13309B034; ML13309B035; ML13309B036; ML13309B037; ML13309B038; ML13309B039; ML13309B040; ML13309B041; ML13309B618; ML13309B619; ML13309B621; ML13309B622; ML13309B623; ML13309B624; ML13309B625; ML13309B626; ML13309B627; ML13309B628; ML13309B629; ML13309B630; ML13309B631; ML13309B632; ML13309B633; ML13309B634;
References
	113-81093, SMT-2013-034
	Download: ML13309B013 (111)
	v • d • e

156 pages follow ENCLOSURE 2 ATTACHMENT 19 SHINE MEDICAL TECHNOLOGIES, INC.

SHINE MEDICAL TECHNOLOGIES, INC. APPLICATION FOR CONSTRUCTION PERMIT RESPONSE TO ENVIRONMENTAL REQUESTS FOR ADDITIONAL INFORMATION DRAFT PHASE I ENVIRONMENTAL SITE ASSESSMENT STEVENS POINT, WISCONSIN FEBRUARY 10, 2012

ROGHU*ROGHU$VVRFLDWHVDQGWKH*$JOREHGHVLJQDUHWUDGHPDUNVRI*ROGHU$VVRFLDWHV&RUSRUDWLRQ

A world RI capabilities GHOLYHUHG locally

REPORT

PHASE I ENVIRONMENTAL SITE ASSESSMENT SHINE MEDICAL STEVENS POINT, WI T23N R8W, SECTION 1 STEVENS POINT, WI 54481 Submitted To: SHINE Medical Technologies 8123 Forsythia St. Suite 140 Middleton, WI 53562 Submitted By: Golder Associates Inc.

4438 Haines Road Duluth, MN 55811 February 10, 2012 Project No. 113-81093 DRAFT

Golder Associates 4438 Haines Road Duluth, MN 55811 Ph. 218-724-0088 Fax 218-724-0089 February 10, 2012 Dr. Gregory Piefer/CEO SHINE Medical Technologies 8123 Forsythia St. Suite 140 Middleton, WI 53562 Our Ref: 113-81093 RE: Phase I Environmental Site Assessment P113-81093 SHINE Medical - Stevens Point, WI Lands End Way Stevens Point, WI

Dear Dr. Piefer:

Golder Associates (Golder) is pleased to present to SHINE Medical Technolgies this Phase I Environmental Site Assessment Report for the Subject Property. Information presented in this Report is subject to the general limitations presented in the Report and Golders Proposal dated December 7, 2011.

Golder appreciates this opportunity to assist you with your environmental needs. If you have any questions or comments regarding the information presented in this report, please call our office.

Sincerely, GOLDER ASSOCIATES INC.

Kathryn R Larson Kathryn R Larson Senior Project Geologist Golder Associates DRAFT

2/10/2012 Table of Contents Project No. 113-81093

SUMMARY

1

1.0 INTRODUCTION

2 1.1 Purpose 2

1.2 Scope of Services 2

1.3 Limitations and Exceptions 3

1.4 Special Terms and Conditions 4

1.5 User Reliance 4

2.0 PROPERTY DESCRIPTION 5

2.1 Location and Legal Description 5

2.2 Site and Vicinity General Characteristics 5

2.3 Current Use of the Subject Property 5

2.4 Description of Structures, Roads, and Other Improvements on the Subject Property 5

2.5 Current Use of Adjoining Properties 6

3.0 USER PROVIDED INFORMATION 7

3.1 Environmental Cleanup Liens 7

3.2 Activity and Use Limitations 7

3.3 Relationship of the Purchase Price to the Fair Market Value 7

3.4 Commonly Known or Reasonably Ascertainable Information 7

3.5 The Degree of Obviousness or the Presence of Contamination 8

3.6 Reason for Conducting ESA 8

4.0 RECORDS REVIEW 9

4.1 Standard Environmental Records Sources, Federal and State 9

4.1.1 Subject Property Database Listing 9

4.1.2 Off-Site Properties Database Listings 10 4.1.3 Orphans Summary 10 4.1.4 Other Agency Records 10 4.2 Additional Environmental Record Sources 10 4.3 Physical Setting Sources 10 4.3.1 Sources Reviewed 10 4.3.2 General Topographic Setting of the Area 10 4.3.3 Geologic and Hydrogeologic Setting 10 4.3.4 Surface Water and Hydrologic Setting 11 4.4 Historical Use Information on the Subject Property 11 4.4.1 Subject Property Historical Use Summary 11 4.4.2 Standard Historical Records 11 4.5 Historical Use Information on Adjoining Properties 13 5.0 SITE RECONNAISSANCE 14 5.1 Methodology and Limiting Conditions 14 5.2 General Site Setting 14 5.2.1 Current Use of the Subject Property 14 5.2.2 Past Use of the Subject Property 14 5.2.3 General Description of Structures 14 5.2.4 Roads 14 5.2.5 Potable Water Supply 14 5.2.6 Sewage Disposal System 14 DRAFT

2/10/2012 Table of Contents Project No. 113-81093 5.3 Interior and Exterior Observations 15 5.3.1 Storage Tanks 15 5.3.2 Odors 15 5.3.3 Pools of Liquid 15 5.3.4 Drums 15 5.3.5 Hazardous Substance and Petroleum Product Containers 15 5.3.6 Unidenti¿ed Substance Containers 15 5.3.7 Evidence of Polychlorinated Biphenyls 15 5.3.8 Heating/Conditioning 15 5.3.9 Stains or Corrosion 15 5.3.10 Drains and Sumps 15 5.3.11 Pits, Ponds, or Lagoons 16 5.3.12 Stained Soil or Pavements 16 5.3.13 Stressed Vegetation 16 5.3.14 Solid Waste Disposal 16 5.3.15 Waste Water 16 5.3.16 Wells 16 5.3.17 Septic Systems 16 5.3.18 Other Interior and Exterior Observations 16 5.4 Off-Site Conditions 16 5.4.1 Adjoining Properties 16 5.4.2 Other Surrounding Properties 16 6.0 INTERVIEWS 17 6.1 Overview 17 6.2 Interview with Owners, Past Owners, Past Operators and Past Occupants 17 6.3 Interview with Site Manager 17 6.4 Interview with Occupants 17 6.5 Interview with Local Government Of¿cials 18 6.6 Interviews with Others 18 7.0 DISCUSSION 19 7.1 Findings and Opinions 19 7.1.1 Recognized Environmental Conditions 19 7.1.2 Historical Recognized Environmental Conditions 19 7.1.3 De Minimis Conditions 19 7.2 Additional Investigation 19 7.3 Data Gaps 19

8.0 CONCLUSION

S 20 9.0 QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS 21

10.0REFERENCES

22 LIST OF FIGURES FIGURE 1 VICINITY MAP FIGURE 2 SITE MAP LIST OF APPENDICES Appendix A Legal Description of the Subject Property/Chain of Title Report Appendix B Federal and State Regulatory Database Search DRAFT

2/10/2012 Table of Contents Project No. 113-81093 Appendix C Historical Documentation Appendix D Photographs Recorded During the Subject Property Inspection Appendix E User Questionnaire Appendix F Resumes of Environmental Professionals DRAFT

2/10/2012 1

Project No. 113-81093

SUMMARY

SHINE Medical retained Golder Associates Inc. (Golder) to perform a Phase I Environmental Site Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December 15th, 2011 (the Proposal), and Golder's professional judgment.

This Summary is to be used only in conjunction with the attached Phase I ESA for SHINE Medical, Stevens Point, Wisconsin dated February 2, 2012 (the Report). All definitions used in this Summary have the same meanings as in the Report, and the use of this Summary is subject to the limitations and conditions contained in the Report. The Report shall govern in the event of any inconsistency between this Summary and the Report.

This assessment has revealed no evidence of RECs in connection with the Subject Property except for the following:

Golder identified the following de minimis conditions, at the Subject Property:

FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.

OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.

De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.

DRAFT

2/10/2012 2

Project No. 113-81093

1.0 INTRODUCTION

1.1 Purpose SHINE Medical (the User) retained Golder Associates Inc. (Golder) to perform a Phase I Environmental Site Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December 7, 2011, and Golder's professional judgment. Golder representatives performed the Phase I ESA in conformance with these criteria.

The AAI Rule states that the ASTM Standard may be used to comply with the requirements of the AAI Rule, so whenever reference is made in this Report to the ASTM Standard, it shall include the AAI Rule.

The ASTM Standard defines RECs as "the presence or likely presence of any hazardous substances or petroleum products on a property under conditions that indicate an existing release, a past release, or a material threat of a release of any hazardous substances or petroleum products into structures on the property or into the ground, groundwater, or surface water of the property. The term includes hazardous substances or petroleum products even under conditions in compliance with laws."

1.2 Scope of Services The scope of services for this ESA consisted of the following tasks:

Records Review Reviewing property information to confirm the legal description and location of the Subject Property.

This information is included in Appendix A; Reviewing environmental record sources including federal and state regulatory databases to identify facilities with past or current regulatory enforcement actions within applicable distances of the Subject Property as defined in the ASTM Standard. The regulatory database search report is presented in Appendix B; Reviewing physical setting information sources to identify information about the geologic, hydrogeologic, hydrologic, and topographic conditions in the area of the Subject Property. The U.S.

Geological Survey (USGS) 7.5-minute topographic map of the area of the Subject Property is shown on Figure 1; Reviewing historical record sources to identify past land use activities at the Subject Property and surrounding properties. Selected historical information obtained during performance of the Phase I ESA investigation is included in Appendix C.

Site Reconnaissance Performing a visual inspection of the Subject Property and surrounding properties to identify potential sources of chemical and petroleum contamination such as aboveground storage tanks (ASTs),

underground storage tanks (USTs), potential sources of polychlorinated biphenyls (PCBs),

chemicals, and hazardous materials. Surficial evidence of potential RECs such as distressed vegetation, stained soils, and/or stained paving was also evaluated. Photographs recorded during the site reconnaissance are included in Appendix D.

DRAFT

2/10/2012 3

Project No. 113-81093 Interviews Interviewing available individuals with knowledge of current or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. User provided information is included in Appendix E.

Report Preparation Preparing a report that documents the findings, opinions, and conclusions of the Phase I ESA investigation conducted at the Subject Property, and provides the supporting documentation and references for those findings, opinions, and conclusions (the Report). Resumes for the environmental professionals that performed the assessment and prepared this Phase I ESA Report are included in Appendix F.

1.3 Limitations and Exceptions Golder performed our services in accordance with the following principles, which are an integral part of the ASTM Standard: (i) No environmental site assessment can wholly eliminate uncertainty regarding the potential for RECs in connection with a property. Performance of this ESA is intended to reduce, but not eliminate, uncertainty regarding the potential for RECs in connection with the Subject Property, and the ASTM Standard recognizes reasonable limits of time and cost; (ii) "all appropriate inquiry" does not mean an exhaustive assessment of a property. Golder performed this ESA in conformance with the ASTM Standard's principle of identifying a balance between the competing goals of limiting the costs and time demands inherent in performing an ESA and the reduction of uncertainty about unknown conditions resulting from additional information; (iii) not every property warrants the same level of assessment - the type of property subject to the assessment, the expertise and risk tolerance of the user, and the information developed in the course of the inquiry guided the appropriate level of assessment for this ESA; and (iv) ESAs must be evaluated based on the reasonableness of judgments made at the time and under the circumstances in which they were made. Subsequent ESAs should not be considered valid standards to judge the appropriateness of any prior assessment based on hindsight, new information, use of developing technology or analytical techniques, or other factors.

Along with all of the limitations set forth in various sections of the ASTM E 1527-00 protocol, the accuracy and completeness of this report may be limited by the following:

Access Limitations - None Physical Obstructions to Observations - Dormant winter vegetation, dense woodland Outstanding Information Requests - None Other - None The information and conclusions contained in this report are based upon work undertaken by trained professional and technical staff in accordance with generally accepted engineering and scientific practices current at the time the work was performed. The conclusions and recommendations presented represent the best judgment of Golder based on the data obtained from the work. Due to the nature of investigation and the limited data available, Golder cannot warrant against undiscovered environmental liabilities. Conclusions and recommendations presented in this report should not be construed as legal advice.

Should additional information become available which differs significantly from our understanding of conditions presented in this report, we request that this information be brought to our attention so that we may reassess the conclusions provided herein.

DRAFT

2/10/2012 4

Project No. 113-81093 1.4 Special Terms and Conditions No special terms and conditions are applicable to this ESA.

1.5 User Reliance Golder has prepared this Report at the request of the User for the purpose identified by the User in Section 3.6. Use of the information contained in this Report by anyone other than User is permissible only with the prior written authorization to do so from Golder, and only under the conditions allowed by the ASTM Standard. Golder is not responsible for independent conclusions, opinions, or recommendations made by others or otherwise based on the findings presented in this Report.

DRAFT

2/10/2012 5

Project No. 113-81093 2.0 PROPERTY DESCRIPTION 2.1 Location and Legal Description The Subject Property is located at T23N, R8W, Section 1, Stevens Point, WI. The parcel is located one quarter-mile north of County Road HH and one half-mile west of Burbank Road and is accessed by a private road that extends west from Burbank Road. The square-shaped parcel is comprised of 88.08 acres of land.

The Subject Property is located in Section 1, T23N, R8W on the United States Geological Survey (USGS) 7.5-minute, Polonia, WI topographic quadrangle map, as shown on Figure 1. The Assessor's Parcel Numbers for the Subject Property are 020-23-0801-01.04, 020-23-0801-02.02, 020-23-0801-02.06, 020-23-0801-03.01, 020-23-0801-03.02, 020-23-0801-04.01, 030-23-0801-13, and 030-23-0801-14. The Subject Property is located at approximately 44 30' 27.45"N and 89 29' 41.70"W.

The site layout is shown on Figure 2.

According to The City of Stevens Point, the legal description for the Subject Property is a parcel of land located in the NE 1/4 of the NE 1/4 of the NE 1/4 of Section 1, T23N, R8W, Town of Hull and Town of Plover, Marathon and Portage Counties, Wisconsin bounded and described in Appendix A. A copy of the description is included in Appendix A.

2.2 Site and Vicinity General Characteristics The Subject Property is located on the eastern edge of Stevens Point, WI. The adjacent properties to the north, south, and east of the Subject Property are rural, consisting of agricultural and forest land and, according to aerial photographs, has been agricultural and forest land since at least 1938. The adjacent properties to the west of the Subject Property are developed as industrial and residential areas.

Development to the west of the Subject Property has occurred recently with the adjacent property being developed after 1998. A rail line exists within one quarter-mile to the north of the Subject Property. The rail line has been north of the Subject Property since at least 1938.

The topographic gradient is low and gently slopes to Portage River and McDill Pond located approximately 2 miles to the southwest.

2.3 Current Use of the Subject Property The Subject Property is used for agriculture and forestry. No buildings exist on the property.

Pesticides and herbicides are applied to the agricultural areas of the Subject Property bi-annually. No hazardous substances or petroleum products are stored, generated, or disposed of on site.

Selective tree harvesting has occurred on the wooded portions of the parcel.

2.4 Description of Structures, Roads, and Other Improvements on the Subject Property No structures exist on the Subject Property.

A private access road extends west from Burbank Road through the subject property.

A private trap shooting range located near the center of the Subject Property is used approximately twice a year.

Residences and businesses in the vicinity of the Subject Property are served by municipal water from the city of Stevens Point Wisconsin. Wastewater in the vicinity of the Subject Property is handled by the City of Stevens Point Wastewater Treatment system.

DRAFT

2/10/2012 6

Project No. 113-81093 2.5 Current Use of Adjoining Properties The adjoining property uses are described below:

North - Agriculture and woodland. A rail line exists just north of these parcels.

East - Agriculture and woodland.

South - Agriculture and woodland.

West - Industrial Park. A Land's End Inlet occupies the adjoining parcel.

DRAFT

2/10/2012 7

Project No. 113-81093 3.0 USER PROVIDED INFORMATION The ASTM Standard defines User as the party seeking to use Practice E 1527 to complete an ESA of the Subject Property. The ASTM Standard requires the User to provide certain information to the environmental professional. Golder has provided a User Questionnaire to SHINE Medial to facilitate the transfer of this information to Golder. Dawn Sovinec of SHINE Medical completed the User Questionnaire and provided it to Golder on December 21st, 2011. A copy of the completed User Questionnaire is included in Appendix E.

3.1 Environmental Cleanup Liens Golder representatives asked the User about their knowledge of environmental cleanup liens against the Subject Property that are filed or recorded under federal, tribal, state or local law. The User replied:

User has no knowledge of environmental cleanup liens on the Subject Property.

3.2 Activity and Use Limitations Golder representatives asked the User about their knowledge of activity and use limitations (AULs),

such as engineering controls, land use restrictions or institutional controls that are in place on the Subject Property or have that been filed or recorded in a registry under federal, tribal, state or local law.

The User replied:

User has no information regarding activity or land use limitations at the Subject Property.

3.3 Relationship of the Purchase Price to the Fair Market Value Golder representatives asked the User if the purchase price being paid for this property reasonably reflects the fair market value of the property. The User replied:

User believes the purchase price being paid for the Subject Property reasonably reflects the fair market value of the property.

3.4 Commonly Known or Reasonably Ascertainable Information Golder representatives asked the User if they were aware of commonly known or reasonably ascertainable information about the Subject Property that would assist the environmental professional in identifying conditions indicative of releases or threatened releases. Golder representatives asked the following questions:

a) Do you know the past uses of the Subject Property? The User replied:

The User knows that the Subject Property has been used as an agricultural field and that selective tree harvesting/logging has occurred on the wooded portions of the parcel, and is being used for such purposes currently.

b) Do you know of specific chemicals that are present or once were present at the Subject Property?

The User replied:

The User has no information regarding specific chemicals that are, or once were, present at the Subject Property.

c) Do you know of spills or other chemical releases that have taken place at the Subject Property? The User replied:

The User knows of no spills or other chemical releases that have taken place at the Subject Property.

DRAFT

2/10/2012 8

Project No. 113-81093 d) Do you know of any environmental cleanups that have taken place at the Subject Property? The User replied:

The User knows of no environmental cleanups that have taken place at the Subject Property.

3.5 The Degree of Obviousness or the Presence of Contamination Golder representatives asked the User if, based on User's knowledge and experience related to the Subject Property, there are any obvious indicators that point to the presence or likely presence of contamination at the Subject Property. The User replied:

The User has no information regarding contamination on the Subject Property.

3.6 Reason for Conducting ESA The User indicated the ESA is being conducted as part of a property transfer and financing, to satisfy one of the conditions required for landowner liability protection (LLP) under CERCLA.

DRAFT

2/10/2012 9

Project No. 113-81093 4.0 RECORDS REVIEW 4.1 Standard Environmental Records Sources, Federal and State Golder retained Environmental Data Resources (EDR) to perform an environmental regulatory database search of the general area of the Subject Property, which is presented in Appendix B. In accordance with the search requirements of ASTM E-1527-05 Standard, Golder representatives reviewed the federal and state regulatory agency records listed below to identify the use, generation, storage, treatment or disposal of hazardous substances or petroleum products, or release incidents of such materials that might impact the Subject Property. A summary of significant listings (Subject Property and adjacent properties with the potential to impact the Subject Property) presented in the environmental regulatory database report is presented below. The following is a listing of databases reviewed during the Phase I ESA.

Federal ASTM Standard Databases Database Approximate Minimum Search Distance Federal NPL (National Priorities List) 1.0 mile Federal delisted NPL site list 0.5 mile Federal Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) site list 0.5 mile Federal CERCLIS-No Further Remedial Action Planned (NFRAP) site list 0.5 mile Federal Resource Conservation and Recovery Act (RCRA) CORRACTS (Corrective Action Report) facilities list 1.0 mile Federal RCRA non-CORRACTS Treatment Storage and Disposal (TSD) facilities list 0.5 mile Federal RCRA Generators list Subject Property and adjoining properties Federal Institutional Control/Engineering Control Registries Subject Property Federal Emergency Response Notification System (ERNS) list Subject Property State and Tribal ASTM Standard Databases Database Approximate Minimum Search Distance State and tribal hazardous waste sites identified for investigation or remediation: NPL - equivalent sites 1.0 mile State and tribal hazardous waste sites identified for investigation or remediation: CERCLIS -

equivalent sites 0.5 mile State and tribal landfill and/or solid waste disposal site list 0.5 mile State and tribal leaking storage tank lists 0.5 mile State and tribal registered storage tank lists Subject Property and adjoining properties State and tribal Institutional Control/Engineering Control Registries Subject Property State and tribal voluntary cleanup sites 0.5 mile State and tribal Brownfield sites 0.5 mile 4.1.1 Subject Property Database Listing The Subject Property is not listed on any of the databases listed in the EDR database report.

DRAFT

2/10/2012 10 Project No. 113-81093 4.1.2 Off-Site Properties Database Listings No off-site facilities were identified in the environmental database report that are considered potential environmental concerns to the Subject Property.

4.1.3 Orphans Summary Thirteen facilities listed in the EDR Report were shown as "orphan sites." These are sites that are listed in environmental databases, but which EDR has been unable to locate with adequate precision to determine whether they are pertinent to the investigation at the Subject Property. Golder was able to determine to a reasonable degree of certainty that these orphan sites were not listed on databases that indicated environmental impairment and/or were not within the specified database search distances.

4.1.4 Other Agency Records No other agency records were reviewed for this Phase I ESA.

4.2 Additional Environmental Record Sources Golder representatives did not review additional environmental record sources as part of this Phase I ESA.

4.3 Physical Setting Sources 4.3.1 Sources Reviewed The USGS 7.5-minute Polonia, WI topographic map was reviewed in order to obtain information regarding the topographic, geologic, hydrogeologic, and hydrologic characteristics of the area of the Subject Property. In the sections below (4.3.2 through 4.3.4), topographic conditions are noted to the extent that they can be determined from review of topographic maps, or were visually and/or physically observed during the Site visit.

4.3.2 General Topographic Setting of the Area Based on the site reconnaissance, the EDR Radius Map with GeoCheck and information provided on the USGS Polonia, Wisconsin, 7.5 Minute Series Topographic Maps, the Subject Property is characterized by low topographic relief, lying approximately 1090 feet above mean sea level.

4.3.3 Geologic and Hydrogeologic Setting Golder installed four groundwater monitoring wells at the Subject Property in December of 2011 (Figure 2). Based on Golder's 2012 Geotechnical and Hydrological Investigation of the site the soil conditions indicated by the boreholes is about one foot of topsoil and crop residue overlying a medium to coarse grained, silty SAND nding to depths of 9 to 14 feet. Below this is a relatively clean, medium to coarse grained, SAND with silt to the borehole termination depth of 31 feet. One borehole was advanced without sampling to a depth of 140 feet adjacent to SM-GW3A. This borehole was intended for a well installation into bedrock and bedrock was not encountered within 140 feet of the urface. Groundwater was encountered in all of the wells at elevations ranging from about 1096 to 1106 (about 8 to 11 feet below grade) as indicated in the table below. Groundwater levels should be expected to fluctuate seasonally and annually with changes in precipitation patterns.

DRAFT

2/10/2012 11 Project No. 113-81093 4.3.4 Surface Water and Hydrologic Setting Surface water runoff in the vicinity of the Subject Property is to the southwest toward the Portage River and McDill Pond. The Portage River flows to the Mississippi River to the Southwest.

4.4 Historical Use Information on the Subject Property 4.4.1 Subject Property Historical Use Summary Land adjacent in to the Subject Property has supported agriculture and forestry since at least 1938.

Sometime between 1998 and 2005, a business park has developed to the west of the Subject Property.

4.4.2 Standard Historical Records 4.4.2.1 Aerial Photographs Review Golder representatives obtained historical aerial photographs from Historical Information Gatherers, Inc.

for the years 2010, 2005, 1998, 1992, 1986, 1978, 1968, 1960, 1953, and 1938. Selected historical aerial photographs are provided in Appendix C. The following table summarizes observations from the review of these aerial photographs.

Year Scale Description 1938 1" = 500' The Subject Property and surrounding area is a mix of woodlands and argicultural land. A railroad appears to run east west approximately 700 feet north of the Subject Property.

1953 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938 photograph.

1960 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938 and 1953 photographs.

1968 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953 and 1960 photographs.

1978 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960 and 1968 photographs.

1986 1" = 800' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968 and 1978 photographs.

1992 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978 and 1986 photographs.

1998 1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978, 1986 and 1992 photographs.

2005 1' = 500' The Subjecr Property and surrounding area appear unchanged from the previous photographs except that the edge of a business park is visible just west of the Subject Property.

2010 1" = 500' The Subject Property and surrounding area appears relatively unchanged from the 2005 photograph.

4.4.2.2 Sanborn Fire Insurance Map Review Golder representatives requested historical Sanborn© Fire Insurance Maps from Environmental Data Resources, Inc. Golder was informed that Sanborn© maps were not developed for the area surrounding the Subject Property. A copy of the "No Coverage" document is included in Appendix C.

DRAFT

2/10/2012 12 Project No. 113-81093 4.4.2.3 Property Tax Files Golder representatives obtained Subject Property Tax records for the County Parcel ID Nos:

Parcel ID Number 020-23-0801-02.06-Owner = Thomas Mocadlo and Margaret Jakusz 020-23-0801-03.01-Owner = Thomas Mocadlo and Margaret Jakusz 020-23-0801-02.02-Owner = Thomas J. and Sandra M. Mocadlo 020-23-0801-01.04-Owner = Bernard Mocadlo 020-23-0801-04.01-Owner = Bernard Mocadlo 020-23-0801-03.02-Owner = Blue Top Farms, Inc.

030-23-0801 Owner = Blue Top Farms, Inc.

030-23-0801 Owner = MS & S Enterprises Limited Partnership Copies and parcel maps are provided in Appendix A.

The property tax records did not indicate records of past ownership, appraisals, maps, sketches, photos, or other information pertaining to the property.

4.4.2.4 Recorded Land Title Records Title documents were not obtained for this Phase I ESA.

4.4.2.5 Historical Topographic Map Review Golder representatives obtained historical USGS topographic quadrangle maps from Environmental Data Resources, Inc. for the years 1955, 1957, 1969, 1970, 1976, 1978, 1980, 1986, and 1991. Copies of the historical topographic maps are provided in Appendix C. The following paragraphs summarize our observations from the review of these historical topographic maps.

Year Scale Description 1955 1:48000 A portion of the Subject Property is visible in the southwest corner of the topographic map. An elecric tranmission line runs near the southern boundary of the Subject Property.

The Minneapolis, St. Paul and Sault Ste Marie Rail Line is visible north of the Subject Property.

1969 1:24000 The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.

1986 1:24000 The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.

4.4.2.6 Local Street Directories Local Street Directories from EDR were requested. The Subject Property address was not included in the city directory listing.

4.4.2.7 Building Department Records No building records pertaining to the Subject Property were available.

4.4.2.8 Zoning and Land Use Records Golder used the Portage County Geographic Information Systems (GIS) Map to review a property profile for the Subject Property. Information indicated that the Subject Property is zoned A1 for agricultural use.

DRAFT

2/10/2012 13 Project No. 113-81093 4.4.2.9 Other Historical Records No additional historical records were reviewed during this assessment.

4.5 Historical Use Information on Adjoining Properties The following is a summary of historical use information for adjacent properties based on information obtained from the Subject Property visit, a review of historical topographic maps and previous ESA reports for the Subject Property:

The adjacent properties were all agricultural and woodland since at least 1938. The rail line present north of the Subject Property was operational since at least 1938 and has been operated by at least two railroads. An electrical transmission line has run near the southern boundary of the Subject Property since at least 1938. A business park was built west of the Subject Property some time between 1998 and 2005.

DRAFT

2/10/2012 14 Project No. 113-81093 5.0 SITE RECONNAISSANCE Golder representative Alexandra A. Prasch performed a visual assessment of the Subject Property on December 15th, 2011 to identify potential sources of chemical and petroleum contamination. The Golder representative assessed surficial evidence of potential impacts such as waste or refuse dumping, distressed vegetation, stained soils, and/or stained paving. Photographs recorded during the site assessment are presented in Appendix D.

5.1 Methodology and Limiting Conditions The site reconnaissance was conducted during the period of December 15th - December 17th, 2011 by Alexandra Prasch, Environmental Technician with Golder Associates. Weather conditions at the time of the site reconnaissance were sunny, partly cloudy, and windy. The visual reconnaissance consisted of observing the boundaries of the property and systematically traversing the site to provide an overlapping field of view, wherever possible. Portions of the property and boundaries were inaccessible due to heavily wooded land and brush. Photographs of pertinent site features identified during the site reconnaissance are included in Appendix D.

5.2 General Site Setting The Subject Property consists of approximately 88.08 acres of farmland and forest with no buildings, utilities, or other developments. The ground surface at the site is level and slopes gently to the southwest. The Subject Property is accessed from a private road extending west from Burbank Road.

5.2.1 Current Use of the Subject Property Information about the current use of the Subject Property is detailed in section 2.3 of this report.

5.2.2 Past Use of the Subject Property The Subject Property has been used for agricultural and forestry purposes since 1938 or before. The use of the Subject Property prior to 1938 is unknown.

5.2.3 General Description of Structures No structures were observed on the Subject Property.

5.2.4 Roads There are no public roads through or leading to the Subject Property. A private access road extends to and through the Subject Property from Burbank Road.

5.2.5 Potable Water Supply Currently the Subject Property has no potable water supply.

5.2.6 Sewage Disposal System There is no sewage disposal system within the Subject Property.

DRAFT

2/10/2012 15 Project No. 113-81093 5.3 Interior and Exterior Observations Golder identified current or past uses likely to involve the use, treatment, storage, disposal or generation of hazardous substances or petroleum products, to the extent they were visually and/or physically observed during the Subject Property visit or identified from the interviews or the records review. The substances and approximate quantities, types of containers (if any) and storage conditions are discussed in the following subsections.

5.3.1 Storage Tanks Golder observed no evidence of underground or aboveground storage tanks at the Subject Property at the time of the site visit.

5.3.2 Odors Golder observed no unusual odors at the Subject Property at the time of the site visit.

5.3.3 Pools of Liquid Golder observed no pools of liquid at the Subject Property at the time of the site visit.

5.3.4 Drums Golder observed no drums at the Subject Property at the time of the site visit.

5.3.5 Hazardous Substance and Petroleum Product Containers Golder observed no hazardous substance or petroleum product containers at the Subject Property at the time of the site visit.

5.3.6 Unidentified Substance Containers Golder observed no unidentified substance containers at the Subject Property at the time of the site visit.

5.3.7 Evidence of Polychlorinated Biphenyls Golder observed no evidence of polychlorinated biphenyls.

5.3.8 Heating/Conditioning The Subject Property is undeveloped. No heating or air conditioning systems were present.

5.3.9 Stains or Corrosion Golder observed no evidence of stains or corrosion at the Subject Property at the time of the site visit.

5.3.10 Drains and Sumps Golder observed no drains or sumps on the Subject Property at the time of the site visit.

DRAFT

2/10/2012 16 Project No. 113-81093 5.3.11 Pits, Ponds, or Lagoons Golder observed no pits, ponds, or lagoons on the Subject Property at the time of the site visit.

5.3.12 Stained Soil or Pavements Golder observed no stained soil or pavements at the Subject Property at the time of the site visit.

5.3.13 Stressed Vegetation Golder observed no stressed vegetation at the Subject Property at the time of the site visit.

5.3.14 Solid Waste Disposal No readily apparent evidence of solid waste dumping, suspect fill material, or landfills was identified on the Subject Property during the site reconnaissance.

5.3.15 Waste Water Golder observed no evidence that industrial waste water is generated or discharged from the Subject Property at the time of the site visit.

5.3.16 Wells Golder observed no evidence of wells at the Subject Property at the time of the site visit.

5.3.17 Septic Systems Golder observed no evidence of septic systems at the Subject Property at the time of the site visit.

5.3.18 Other Interior and Exterior Observations Golder made no other interior or exterior observations of the Subject Property during the site visit.

5.4 Off-Site Conditions The following two sections discuss the off-site observations, to the extent that the current uses of the adjoining properties were observable during the Subject Property reconnaissance, and were likely to indicate an REC in connection with the adjoining properties or the Subject Property.

5.4.1 Adjoining Properties Golder did not observe any evidence of RECs on adjoining properties from the Subject Property during the site visit.

5.4.2 Other Surrounding Properties The adjacent properties were observed to be a business park, forested land and agricultural land during the site visit. There were no indications of RECs noted on other surrounding properties during the site visit.

DRAFT

2/10/2012 17 Project No. 113-81093 6.0 INTERVIEWS 6.1 Overview During the completion of this Phase I ESA, available individuals were interviewed with knowledge of current or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. Information provided is summarized throughout the text of the report and in the following sections.

6.2 Interview with Owners, Past Owners, Past Operators and Past Occupants Golder interviewed the owners identified in section 4.4.2.3 of the report. Interviews were conducted via telephone call. Phase I ESA Interview forms summarizing the interviews are available for review in the Golder file.

Thomas Mocadlo, owner of parcels 020-23-081-02.02, 020-23-081-02.06 and 020-23-801-03.01, indicated that he purchased the property around 1985 for the purpose of hunting and gathering firewood. His brother Bernard owns other parcels that are part of the Subject Property. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.

Bernard Mocadlo, owner of parcels 020-23-0801-04.01 and 020-23-1.04, indicated that he has owned the property for 54 years and farmed the property for 30 years. The land has been used for potato, sweet corn, pea and vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.

Curt Soik, owner of parcel 030-230-0801-1.13, indicated that he purchased his parcel in 1962 from a farmer. His parcel has been used for growing of corn and other vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.

Peter Zakrzewski, President of Blue Top Farms and owner of parcels 030-230-801.14 and 020-230-801-03.02, indicated that he is the son of the original owner (J. James Zakrzewski). His father purchased the property 30 years ago. Peter has been the Vice President of Blue Top Farms for the last 10 years. The property has been used for corn, green bean, soy bean and potato crops. He rented a portion of the parcels he owns to a potato farmer in the past. He believed liquid manure was handled in the southwest corner of the parcels he owns in the past, but has not been used in the last two years. He indicated that pesticides and herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. He does maintain a private shooting range on the parcels that he owns. He uses the shooting range no more than a few times a year.

6.3 Interview with Site Manager Golder did not interview a Site Manager for the Phase I ESA.

6.4 Interview with Occupants Golder did not interview Occupants for the Phase I ESA.

DRAFT

2/10/2012 18 Project No. 113-81093 6.5 Interview with Local Government Officials Golder did not interview Local Government Officials for the Phase I ESA.

6.6 Interviews with Others Golder did not interview Others for the Phase I ESA.

DRAFT

2/10/2012 19 Project No. 113-81093 7.0 DISCUSSION This section identifies the known or suspect RECs, historical RECs, and de minimis conditions identified during the assessment.

7.1 Findings and Opinions 7.1.1 Recognized Environmental Conditions No Recognized Environmental Conditions were identified during this assessment.

7.1.2 Historical Recognized Environmental Conditions An HREC is an environmental condition which, in the past, would have been considered a REC, but which may or may not be considered a REC currently. Golder's rationale for considering these environmental conditions as HRECs is based solely on the information stated herein. Designation as an HREC however, does not preclude the potential for the condition to affect the Subject Property.

No Historical Recognized Environmental Conditions were identified during this assessment.

7.1.3 De Minimis Conditions De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.

FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.

OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.

7.2 Additional Investigation No additional investigation is indicated based on the information gathered during this assessment.

7.3 Data Gaps A Data Failure occurs when all of the standard historical sources that are reasonably ascertainable and likely to be useful have been reviewed and yet the objectives have not been met. Some Data Failures may comprise Data Gaps. A Data Gap is defined as the lack of or inability to obtain information required by the ASTM Standard despite good faith efforts by the EP to gather such information. A significant data gap occurs when a data gap impacts the ability of the EP to identify RECs.

Golder representatives did not identify significant data gaps during this assessment.

DRAFT

2/10/2012 20 Project No. 113-81093

8.0 CONCLUSION

S Golder performed a Phase I ESA of the property located at T23N, R8W, Section 1, Stevens Point, WI in conformance with the scope and limitations of the ASTM Standard. Any exceptions to, or deletions from, the ASTM Standard are described in the appropriate sections of this Report. This assessment has revealed no evidence of RECs in connection with the Subject Property except:

Golder identified the following de minimis conditions, at the Subject Property:

FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.

OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.

De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.

DRAFT

2/10/2012 21 Project No. 113-81093 9.0 QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS Alexandra Prasch, Geologist in Training, Level 1 Environmental Technician with 2 years of professional experience, conducted the site visit. Kathryn Larson, Senior Project Geologist with 15 years of experience, prepared this Report, and Amy Thorson, Senior Engineer with 20 years of professional experience, served as the senior reviewer of the Report. Resumes for members of the project team are included in Appendix F.

"We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental Professional as defined in Section 312.10 of 40 CFR Part 312.

We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject Property. We have developed and performed the all appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312."

GOLDER ASSOCIATES INC.

DRAFT

2/10/2012 22 Project No. 113-81093

10.0 REFERENCES

The Report's author annotated the reference sources relied upon in preparing the Phase I ESA in the relevant sections of this Report.

DRAFT

List of Figures DRAFT

SCALE 0

1 1

MILES CHECK REVIEW DESIGN CADD SCALE FILE No.

PROJECT No.

TITLE AS SHOWN REV.

J:\\2011 Jobs\\113-81093 SHINE Steven's Point WI\\CAD\\VICINITY_MAP_WI.dwg l 1/11/2012 10:58 AM l AGarrigus l STEVENS POINT 1

APG 1/11/12 MTK 1/11/12 AT 1/11/12 0

FIG.

113-81051 VICINITY_MAP_WI.dwg SMT / STEVENS POINT / AK VICINITY MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN REFERENCE TOPOGRAPHIC MAP PROVIDED BY WISCONSIN DNR.

PROJECT LOCATION PROJECT LOCATION DRAFT

100' 162' 66' 100' 60' 66' 66' 66' 2308-01-2101-01 2308-01-2201-01 4.26 AC.

13 AC.

80 AC.

2.4 AC.

18.61 AC.

S88°58'06"E 1,868' 1,868' N01°01'45"W 1,868' 1,868' TRANSMISSION LINE 1,000'R 1,000'R 80' FUTURE STREET 100' FUTURE STREET S88°58'06"E TRANSIT FACILITY 21 AC.

3 AC.

21 AC.

2.2 AC.

5 AC.

2.4 AC.

5.1 AC.

17.52 AC.

19.93 AC.

3.7 AC.

25.23 AC.

10.33 AC.

23.34 AC.

1.5 AC.

34.23 AC.

35.69 AC.

700' 700' 700' 0.4 AC.

10.43 AC.

5.1 AC.

1.5 AC.

316'-3" 316'-3" SM-GW1A SM-GW2A SM-GW3A SM-GW4A 1.) LOCATION OF POTENTIAL LOCATION FOR SHINE MEDICAL FACILITY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.

2.) AERIAL IMAGERY PROVIDED BY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.

REFERENCES

\\\\anc1-s-fs2-vm\\Jobs_In_Progress\\2011 Jobs\\113-81093 SHINE Steven's Point WI\\CAD\\Proposed_building_layout_SP.dwg l 1/11/2012 11:01 AM l AGarrigus l STEVENS POINT SCALE 0

FEET 100O 100O 2

APG 1/11/12 MTK 1/11/12 AT 1/11/12 1

FIG.

113-81051 Proposed_building_layout_SP.dwg SMT / STEVENS POINT / AK SITE MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN CHECK REVIEW DESIGN CADD SCALE FILE No.

PROJECT No.

TITLE AS SHOWN REV.

PROPOSED BUILDING OUTLINE PROPOSED BUILDING AREA INTERSTATE HIGHWAY 39 PROPOSED PROPERTY BOUNDARY 1.) NORTHINGS AND EASTINGS PROVIDED IN NAD_1983_HARN_WISCRS_PORTAGE_COUNTY_FEET NOTES DRAFT

Appendix A Legal Description of the Subject Property/

Chain of Title Report DRAFT

DRAFT RFI RESPONSE FORM PM-001, Revision 2 RFI NO.: GOLDER-2011-RFI Revision: 0 0051 Due Date: 12/16/2011 Sheet 1 of 3 RFI RESPONSE:

The following table is the legal parcels description for the Stevens Point property:

Parcel Township Owner(s)

Approximate Identification Acreage Number 020-23-0801-02.06 Town of Hull 7.2 020-23-0801-03.01 Town of Hull 19.92

. 020-23-0801-02.02 Town of Hull 6.6 020-23-0801-01.04 Town of Hull 25.23 020-23-0801-04.01 020-23-0801-03.02 Town of Hull 19.93 030-23-0801-1 4 Town of Plover 5.5 030-23-0801-13 Town of Plover 3.7 Total Combined 88.08 Parcel Acreage Please also find Phase 1 ESA User Questionnaire responses on pages 2 and 3 of the RFI response.

Responder: ______________ _

Company: SHINE Medical Independent Reviewer (for Design Input)---------------

Responder's Management:

SHINE Licensing:

Originator Acceptance:

12/28/2011 X

~------------

Date: 12.21.11 Phone No.: ----------1 Date:

~

Date: ------------------1

My Map 020230801-01.04 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:26:25 PM.

DRAFT Bernard J Mocadlo 5823 Old Highway 18 Stevens Point, WI 54482

My Map 020230801-02.02 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:40:03 PM.

DRAFT

My Map 020230801-02.06 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:42:58 PM.

DRAFT

My Map 020230801-03.01 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:15:59 PM.

DRAFT Jakusz Margaret A Etal Mocadlo Thomas, J 5931 Old Highway 18 Stevens Point, WI

My Map 020-23-0801-03.02 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:30:47 PM.

DRAFT Emmerich Hakrzewski Bluetop Farms Inc 5613 County Road HH Stevens Point, WI

My Map 020230801-04.01 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:28:50 PM.

DRAFT Bernard J Mocadlo 5823 Old Highway 18 Stevens Point, WI 54482

My Map 030-23-0801-13 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:34:11 PM.

DRAFT M S & S Enterprises 6213 County Road HH Stevens Point, WI 54482

My Map 030-23-0801-14 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:32:31 PM.

DRAFT Blue Top Farms Inc.

5613 County Road HH Stevens Point, WI 54482

Appendix B Federal and State Regulatory Database Search DRAFT

FORM-BPK-SPM

k c

e h

C o

e G

h ti w

tr o

p e

R p

a M

s u

i d

a R

R D

E e

h T

440 Wheelers Farms Road Milford, CT 06461 Toll Free: 800.352.0050 www.edrnet.com SHINE Medical Stevens Point, WI Lands End Way, Stevens Point, WI 54482 Inquiry Number: 3220399.2s December 07, 2011 DRAFT

SECTION PAGE Executive Summary ES1 Overview Map 2

Detail Map 3

Map Findings Summary 4

Map Findings 7

Orphan Summary 8

Government Records Searched/Data Currency Tracking GR-1 GEOCHECK ADDENDUM Physical Setting Source Addendum A-1 Physical Setting Source Summary A-2 Physical Setting SSURGO Soil Map A-5 Physical Setting Source Map A-9 Physical Setting Source Map Findings A-11 Physical Setting Source Records Searched A-30 TC3220399.2s Page 1 Thank you for your business.

Please contact EDR at 1-800-352-0050 with any questions or comments.

Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice.

Copyright 2011 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission.

EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners.

TABLE OF CONTENTS DRAFT

EXECUTIVE

SUMMARY

TC3220399.2s EXECUTIVE

SUMMARY

1 A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).

The report was designed to assist parties seeking to meet the search requirements of EPAs Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-05) or custom requirements developed for the evaluation of environmental risk associated with a parcel of real estate.

TARGET PROPERTY INFORMATION ADDRESS LANDS END WAY, STEVENS POINT, WI 54482 COORDINATES 44.507000 - 44 30 25.2 Latitude (North):

89.495900 - 89 29 45.2 Longitude (West):

Zone 16 Universal Tranverse Mercator:

301598.3 UTM X (Meters):

4931000.0 UTM Y (Meters):

1113 ft. above sea level Elevation:

USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 44089-E4 POLONIA, WI Target Property Map:

1986 Most Recent Revision:

44089-D4 ARNOTT, WI South Map:

1969 Most Recent Revision:

44089-D5 WHITING, WI Southwest Map:

1976 Most Recent Revision:

44089-E5 STEVENS POINT, WI West Map:

1991 Most Recent Revision:

AERIAL PHOTOGRAPHY IN THIS REPORT 2010 Photo Year:

USDA Source:

TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR.

DRAFT

EXECUTIVE

SUMMARY

TC3220399.2s EXECUTIVE

SUMMARY

6 Due to poor or inadequate address information, the following sites were not mapped. Count: 13 records.

Site Name Database(s)

STEVENS POINT MUNICIPAL AIRPORT NPDES STEVENS POINT MUNI FINDS FROM STEVENS POINT CTY LIMITS TO C SPILLS JUNCTION CITY TO STEVENS POINT SPILLS WI RIVER & WISCONSIN ST SPILLS UW STEVENS POINT BALDWIN HALL SPILLS WISCONSIN RIVER BELOW POINT PAPER SPILLS STEVENS POINT AIRPORT #2 WI WRRSER KWIK TRIP - STEVENS POINT WI WRRSER STEVENS POINT BRRTS WI RIVER BOAT LANDING BRRTS STEVENS POINT BRRTS STEVENS POINT WATER DEPARTMENT - W TIER 2 DRAFT

EDR Inc.

1120 DRAFT

N Target Property Sillls at eleva1ions higher than or equal to the target property Sbs at eleva11ons lower 1han 1he target property

.1 Manufactured Gas Plants

~ &enslave AecepiDra E;:J Nallonal Priarlly Ust Silltl ITIJ Dept. Delenaa SIIBS SITE NAME: SHINE Mec:lcal Stevena Point, WI ADDRESS:

Lands End Way, Stevens Poln: WI 64482 LA TILONG: 44.5070 /89.4959 It

~

Indian Raaarvatlons BIA N Oil & Gas pipelines from USGS

~

100-year flood zone

~

600-yaar flood Z(lne ThiS report includes lntBratliYe Map ~to display and/or hide map information. 11le legend includes only thOse icons for 1he dtlfault map view.

D R i::l NT:

Golder Associates CONTACT:

INQUIRY 1: 3220399.2&

DATE:

Dece~R)er07, 2011 11:47 am

MAP FINDINGS

SUMMARY

Search Target Distance Total Database Property (Miles)

< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1

> 1 Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0

NR 0

0 0

0 1.000 NPL 0

NR 0

0 0

0 1.000 Proposed NPL 0

NR NR NR NR NR TP NPL LIENS Federal Delisted NPL site list 0

NR 0

0 0

0 1.000 Delisted NPL Federal CERCLIS list 0

NR NR 0

0 0

0.500 CERCLIS 0

NR 0

0 0

0 1.000 FEDERAL FACILITY Federal CERCLIS NFRAP site List 0

NR NR 0

0 0

0.500 CERC-NFRAP Federal RCRA CORRACTS facilities list 0

NR 0

0 0

0 1.000 CORRACTS Federal RCRA non-CORRACTS TSD facilities list 0

NR NR 0

0 0

0.500 RCRA-TSDF Federal RCRA generators list 0

NR NR NR 0

0 0.250 RCRA-LQG 0

NR NR NR 0

0 0.250 RCRA-SQG 0

NR NR NR 0

0 0.250 RCRA-CESQG Federal institutional controls /

engineering controls registries 0

NR NR 0

0 0

0.500 US ENG CONTROLS 0

NR NR 0

0 0

0.500 US INST CONTROL Federal ERNS list 0

NR NR NR NR NR TP ERNS State-and tribal - equivalent CERCLIS 0

NR 0

0 0

0 1.000 SHWS State and tribal landfill and/or solid waste disposal site lists 0

NR NR 0

0 0

0.500 SWF/LF 0

NR NR 0

0 0

0.500 WDS 0

NR NR NR NR NR TP SHWIMS State and tribal leaking storage tank lists 0

NR NR 0

0 0

0.500 LUST 0

NR NR 0

0 0

0.500 LAST 0

NR NR 0

0 0

0.500 INDIAN LUST TC3220399.2s Page 4 DRAFT

MAP FINDINGS

SUMMARY

Search Target Distance Total Database Property (Miles)

< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1

> 1 Plotted State and tribal registered storage tank lists 0

NR NR NR 0

0 0.250 UST 0

NR NR NR 0

0 0.250 AST 0

NR NR NR 0

0 0.250 INDIAN UST 0

NR NR NR 0

0 0.250 FEMA UST State and tribal institutional control / engineering control registries 0

NR NR NR NR NR TP CRS 0

NR NR 0

0 0

0.500 AUL State and tribal voluntary cleanup sites 0

NR NR 0

0 0

0.500 VCP 0

NR NR 0

0 0

0.500 INDIAN VCP State and tribal Brownfields sites 0

NR NR 0

0 0

0.500 BEAP 0

NR NR 0

0 0

0.500 BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0

NR NR 0

0 0

0.500 US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0

NR NR 0

0 0

0.500 DEBRIS REGION 9 0

NR NR 0

0 0

0.500 ODI 0

NR NR 0

0 0

0.500 SWRCY 0

NR NR 0

0 0

0.500 INDIAN ODI Local Lists of Hazardous waste /

Contaminated Sites 0

NR NR NR NR NR TP US CDL 0

NR NR 0

0 0

0.500 WI ERP 0

NR NR NR NR NR TP CDL 0

NR NR NR NR NR TP US HIST CDL Local Land Records 0

NR NR NR NR NR TP LIENS 2 0

NR NR 0

0 0

0.500 LUCIS Records of Emergency Release Reports 0

NR NR NR NR NR TP HMIRS 0

NR NR NR NR NR TP SPILLS 0

NR NR NR NR NR TP AGSPILLS Other Ascertainable Records 0

NR NR NR 0

0 0.250 RCRA-NonGen TC3220399.2s Page 5 DRAFT

MAP FINDINGS

SUMMARY

Search Target Distance Total Database Property (Miles)

< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1

> 1 Plotted 0

NR NR NR NR NR TP DOT OPS 0

NR 0

0 0

0 1.000 DOD 0

NR 0

0 0

0 1.000 FUDS 0

NR 0

0 0

0 1.000 CONSENT 0

NR 0

0 0

0 1.000 ROD 0

NR NR 0

0 0

0.500 UMTRA 0

NR NR NR 0

0 0.250 MINES 0

NR NR NR NR NR TP TRIS 0

NR NR NR NR NR TP TSCA 0

NR NR NR NR NR TP FTTS 0

NR NR NR NR NR TP HIST FTTS 0

NR NR NR NR NR TP SSTS 0

NR NR NR NR NR TP ICIS 0

NR NR NR NR NR TP PADS 0

NR NR NR NR NR TP MLTS 0

NR NR NR NR NR TP RADINFO 0

NR NR NR NR NR TP FINDS 0

NR NR NR NR NR TP RAATS 0

NR NR NR NR NR TP BRRTS 0

NR NR NR NR NR TP NPDES 0

NR NR NR 0

0 0.250 MANIFEST 0

NR NR NR 0

0 0.250 DRYCLEANERS 0

NR NR NR NR NR TP WI WRRSER 0

NR NR NR NR NR TP AIRS 0

NR NR NR NR NR TP TIER 2 0

NR NR NR NR NR TP LEAD 0

NR 0

0 0

0 1.000 INDIAN RESERV 0

NR NR 0

0 0

0.500 SCRD DRYCLEANERS 0

NR NR 0

0 0

0.500 COAL ASH EPA 0

NR NR NR NR NR TP FINANCIAL ASSURANCE 0

NR NR 0

0 0

0.500 COAL ASH 0

NR NR NR NR NR TP PCB TRANSFORMER 0

NR NR NR NR NR TP COAL ASH DOE EDR PROPRIETARY RECORDS EDR Proprietary Records 0

NR 0

0 0

0 1.000 Manufactured Gas Plants NOTES:

TP = Target Property NR = Not Requested at this Search Distance Sites may be listed in more than one database TC3220399.2s Page 6 DRAFT

MAP FINDINGS Map ID Direction EDR ID Number Distance EPA ID Number Database(s)

Site Elevation NO SITES FOUND TC3220399.2s Page 7 DRAFT

ORPHAN

SUMMARY

City EDR ID Site Name Site Address Zip Database(s)

Count: 13 records.

STEVENS POINT S109260948 STEVENS POINT AIRPORT #2 HWY 66 WI WRRSER STEVENS POINT S110356483 STEVENS POINT MUNICIPAL AIRPORT HWY 66 OF POINT E NPDES STEVENS POINT S106975782 STEVENS POINT ADDRESS UNKNOWN BRRTS STEVENS POINT S107426958 FROM STEVENS POINT CTY LIMITS TO C FROM STEVENS PT SPILLS STEVENS POINT S100670543 KWIK TRIP - STEVENS POINT 3533 E HWY 66 WI WRRSER STEVENS POINT S107429234 JUNCTION CITY TO STEVENS POINT JUNCTION CITY TO STEVENS PT SPILLS STEVENS POINT S109326408 WI RIVER & WISCONSIN ST WI RIV S SPILLS STEVENS POINT S110674654 WI RIVER BOAT LANDING RIVER RD BRRTS STEVENS POINT S107432651 UW STEVENS POINT BALDWIN HALL UW STEVENS PT SPILLS STEVENS POINT S110357602 STEVENS POINT STEVENS PT BRRTS STEVENS POINT 1011985398 STEVENS POINT MUNI UNKNOWN FINDS STEVENS POINT S107685149 STEVENS POINT WATER DEPARTMENT - W 100 WELL FIELD RD TIER 2 STEVENS POINT S107433219 WISCONSIN RIVER BELOW POINT PAPER WISCONSIN RIVER BELOW PT SPILLS TC3220399.2s Page 8 DRAFT

To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required.

Number of Days to Update: Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public.

STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL: National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon coverage for over 1,000 NPL site boundaries produced by EPAs Environmental Photographic Interpretation Center (EPIC) and regional EPA offices.

Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 79 Source: EPA Telephone: N/A Last EDR

Contact:

10/12/2011 Next Scheduled EDR

Contact:

01/23/2012 Data Release Frequency: Quarterly NPL Site Boundaries Sources:

EPAs Environmental Photographic Interpretation Center (EPIC)

Telephone: 202-564-7333 EPA Region 1 EPA Region 6 Telephone 617-918-1143 Telephone: 214-655-6659 EPA Region 3 EPA Region 7 Telephone 215-814-5418 Telephone: 913-551-7247 EPA Region 4 EPA Region 8 Telephone 404-562-8033 Telephone: 303-312-6774 EPA Region 5 EPA Region 9 Telephone 312-886-6686 Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL: Proposed National Priority List Sites A site that has been proposed for listing on the National Priorities List through the issuance of a proposed rule in the Federal Register. EPA then accepts public comments on the site, responds to the comments, and places on the NPL those sites that continue to meet the requirements for listing.

Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 79 Source: EPA Telephone: N/A Last EDR

Contact:

10/12/2011 Next Scheduled EDR

Contact:

01/23/2012 Data Release Frequency: Quarterly NPL LIENS: Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority to file liens against real property in order to recover remedial action expenditures or when the property owner received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens.

Contact:

11/29/2011 Next Scheduled EDR

Contact:

03/12/2012 Data Release Frequency: Quarterly FEDERAL FACILITY: Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities Restoration and Reuse Office is involved in cleanup activities.

01/16/2012 Data Release Frequency: Varies TC3220399.2s Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT

Contact:

10/06/2011 Next Scheduled EDR

01/23/2012 Data Release Frequency: Varies INDIAN LUST R9: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 01/31/2011 Date Data Arrived at EDR: 02/01/2011 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 48 Source: Environmental Protection Agency Telephone: 415-972-3372 Last EDR

Contact:

10/31/2011 Next Scheduled EDR

Contact:

02/13/2012 Data Release Frequency: Quarterly INDIAN LUST R4: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina.

Contact:

11/01/2011 Next Scheduled EDR

Contact:

02/13/2012 Data Release Frequency: Varies INDIAN LUST R6: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma.

Date of Government Version: 09/12/2011 Date Data Arrived at EDR: 09/13/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 59 Source: EPA Region 6 Telephone: 214-665-6597 Last EDR

Contact:

10/31/2011 Next Scheduled EDR

01/02/2012 Data Release Frequency: Quarterly AST: Tanks Database Aboveground storage tank site locations.

02/13/2012 Data Release Frequency: Varies INDIAN UST R4: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee and Tribal Nations)

Contact:

11/03/2011 Next Scheduled EDR

Contact:

01/23/2012 Data Release Frequency: Varies INDIAN VCP R7: Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7.

Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008 Date Made Active in Reports: 05/19/2008 Number of Days to Update: 27 Source: EPA, Region 7 Telephone: 913-551-7365 Last EDR

Contact:

04/20/2009 Next Scheduled EDR

Contact:

07/20/2009 Data Release Frequency: Varies State and tribal Brownfields sites BEAP: Brownfields Environmental Assessment Program The Brownfields Environmental Assessment Program (BEAP) was a federal program that assisted municipalities with Environmental Site Assessments (ESAs) for tax delinquent or bankrupt properties, or properties a local government acquired for redevelopment. Using federal dollars, site assessments were conducted by Department of Natural Resources (DNR) staff to determine if the properties were contaminated.

Contact:

11/14/2011 Next Scheduled EDR

Contact:

02/27/2012 Data Release Frequency: Varies Other Ascertainable Records RCRA-NonGen: RCRA - Non Generators RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous waste.

Contact:

12/02/2011 Next Scheduled EDR

Contact:

03/12/2012 Data Release Frequency: Annually TSCA: Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant site.

Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc.

Telephone: N/A Last EDR

Contact:

N/A Next Scheduled EDR

Contact:

N/A Data Release Frequency: No Update Planned OTHER DATABASE(S)

Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily mean that wetlands do not exist in the area covered by the report.

Electric Power Transmission Line Data Source: Rextag Strategies Corp.

Telephone: (281) 769-2247 U.S. Electric Transmission and Power Plants Systems Digital GIS Data Sensitive Receptors:

There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivity to environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the location of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers, and nursing homes - where individuals who are sensitive receptors are likely to be located.

AHA Hospitals:

Source: American Hospital Association, Inc.

Telephone: 312-280-5991 The database includes a listing of hospitals based on the American Hospital Associations annual survey of hospitals.

Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services Telephone: 410-786-3000 A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services, a federal agency within the U.S. Department of Health and Human Services.

Nursing Homes Source: National Institutes of Health Telephone: 301-594-6248 Information on Medicare and Medicaid certified nursing homes in the United States.

Public Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics primary database on elementary and secondary public education in the United States. It is a comprehensive, annual, national statistical database of all public elementary and secondary schools and school districts, which contains data that are comparable across all states.

Private Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics primary database on private school locations in the United States.

Daycare Centers: Day Care Directory Source: Department of Health & Family Services Telephone: 608-266-9314 Flood Zone Data:

This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.

NWI:

National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.

Scanned Digital USGS 7.5 Topographic Map (DRG)

Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.

TC3220399.2s Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT

STREET AND ADDRESS INFORMATION

© 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.

TC3220399.2s Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT

TC3220399.2s Page A-1 geologic strata.

of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics

2. Groundwater flow velocity.

1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components:

forming an opinion about the impact of potential contaminant migration.

EDRs GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1991 Most Recent Revision:

44089-E5 STEVENS POINT, WI West Map:

1976 Most Recent Revision:

44089-D5 WHITING, WI Southwest Map:

1969 Most Recent Revision:

44089-D4 ARNOTT, WI South Map:

1986 Most Recent Revision:

44089-E4 POLONIA, WI Target Property Map:

USGS TOPOGRAPHIC MAP 1113 ft. above sea level Elevation:

4931000.0 UTM Y (Meters):

301598.3 UTM X (Meters):

Zone 16 Universal Tranverse Mercator:

89.4959 - 89 29 45.3 Longitude (West):

44.50700 - 44 30 25.2 Latitude (North):

TARGET PROPERTY COORDINATES STEVENS POINT, WI 54482 LANDS END WAY, SHINE MEDICAL STEVENS POINT, WI TARGET PROPERTY ADDRESS

GEOCHECK - PHYSICAL SETTING SOURCE ADDENDUM

DRAFT

TC3220399.2s Page A-2 should be field verified.

on a relative (not an absolute) basis. Relative elevation information between sites of close proximity Source: Topography has been determined from the USGS 7.5 Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)

Elevation (ft)

TP TP 0

1/2 1 Miles Target Property Elevation: 1113 ft.

North South West East 1106 1107 1108 1110 1110 1111 1111 1111 1111 1113 1113 1114 1115 1114 1113 1113 1113 1112 1112 1105 1105 1107 1108 1109 1110 1111 1111 1111 1113 1113 1114 1115 1116 1118 1120 1121 1124 1125 General SW General Topographic Gradient:

TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted.

assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or, Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).

sources of information, such as surface topographic information, hydrologic information, hydrogeologic data using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATION

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

TC3220399.2s Page A-3 Not Reported GENERAL DIRECTION LOCATION GROUNDWATER FLOW FROM TP MAP ID hydrogeologically, and the depth to water table.

authorities at select sites and has extracted the date of the report, groundwater flow direction as determined flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW Search Radius: 1.000 Mile.

Not found Status:

1.25 miles Search Radius:

Site-Specific Hydrogeological Data*:

©1996 Siteíspecific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation.

contamination exist on the target property, what downgradient sites might be impacted.

environmental professional in forming an opinion about the impact of nearby contaminated properties or, should of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail Map NOT AVAILABLE NATIONAL WETLAND INVENTORY NWI Electronic Data Coverage NWI Quad at Target Property Not Reported Additional Panels in search area:

55097C - FEMA DFIRM Flood data Flood Plain Panel at Target Property:

YES - refer to the Overview Map and Detail Map PORTAGE, WI FEMA FLOOD ZONE FEMA Flood Electronic Data Target Property County and bodies of water).

Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted.

the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATION

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

TC3220399.2s Page A-4 Map, USGS Digital Data Series DDS - 11 (1994).

of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology ROCK STRATIGRAPHIC UNIT GEOLOGIC AGE IDENTIFICATION Stratified Sequence Category:

Paleozoic Era:

Cambrian System:

Cambrian Series:

C Code:

(decoded above as Era, System & Series) at which contaminant migration may be occurring.

Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils.

characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATION

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

EDR Inc.

1 2

3 0

1/16 1/8 1/4 Miles DRAFT

TC3220399.2s Page A-6 Well drained Soil Drainage Class:

textures.

moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:

sandy loam Soil Surface Texture:

Billett Soil Component Name:

Soil Map ID: 2 Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported sand 59 inches 40 inches 5

Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 40 inches 33 inches 4

Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported sandy loam 33 inches 27 inches 3

Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 27 inches 7 inches 2

Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 7 inches 0 inches 1

Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)

> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

Low Corrosion Potential - Uncoated Steel:

Hydric Status: Not hydric Somewhat excessively drained Soil Drainage Class:

excessively drained sands and gravels.

Class A - High infiltration rates. Soils are deep, well drained to Hydrologic Group:

loamy sand Soil Surface Texture:

Richford Soil Component Name:

Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data.

for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information The U.S. Department of Agricultures (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTY

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

TC3220399.2s Page A-7 Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported loam 7 inches 0 inches 1

Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)

> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

Low Corrosion Potential - Uncoated Steel:

Hydric Status: Not hydric Well drained Soil Drainage Class:

textures.

moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:

loam Soil Surface Texture:

Rosholt Soil Component Name:

Soil Map ID: 3 Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported loamy sand 59 inches 33 inches 4

Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported loamy sand 33 inches 27 inches 3

Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported sandy loam 27 inches 9 inches 2

Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported sandy loam 9 inches 0 inches 1

Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)

> 0 inches Depth to Watertable Min:

> 0 inches Depth to Bedrock Min:

Low Corrosion Potential - Uncoated Steel:

Hydric Status: Not hydric

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

TC3220399.2s Page A-8 1/2 - 1 Mile SSW USGS2429210 16 1/2 - 1 Mile South USGS2429203 15 1/2 - 1 Mile WSW USGS2429044 14 1/2 - 1 Mile South USGS2429204 13 1/2 - 1 Mile NE USGS2429102 12 1/2 - 1 Mile WNW USGS2429076 11 1/2 - 1 Mile West USGS2429070 10 1/2 - 1 Mile West USGS2429067 9

1/2 - 1 Mile SSE USGS2429032 A7 1/2 - 1 Mile SSE USGS2429033 A6 1/2 - 1 Mile SE USGS2429047 5

1/2 - 1 Mile North USGS2429094 4

1/2 - 1 Mile ENE USGS2429073 3

1/2 - 1 Mile West USGS2429066 2

1/4 - 1/2 Mile SSW USGS2429048 1

FEDERAL USGS WELL INFORMATION LOCATION FROM TP WELL ID MAP ID 1.000 State Database Nearest PWS within 1 mile Federal FRDS PWS 1.000 Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)

DATABASE opinion about the impact of contaminant migration on nearby drinking water wells.

professional in assessing sources that may impact ground water flow direction, and in forming an EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported to gravel stratified sand 59 inches 33 inches 5

Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported sand gravelly loamy 33 inches 27 inches 4

Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported sandy loam gravelly fine 27 inches 12 inches 3

Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported fine sandy loam 12 inches 7 inches 2

Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

TC3220399.2s Page A-9 1/2 - 1 Mile WSW WI3000000008386 8

STATE DATABASE WELL INFORMATION LOCATION FROM TP WELL ID MAP ID Note: PWS System location is not always the same as well location.

No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATION FROM TP WELL ID MAP ID 1/2 - 1 Mile SSW USGS2429138 20 1/2 - 1 Mile ENE USGS2429081 B19 1/2 - 1 Mile ENE USGS2429083 B18 1/2 - 1 Mile ENE USGS2429082 B17 FEDERAL USGS WELL INFORMATION LOCATION FROM TP WELL ID MAP ID

GEOCHECK - PHYSICAL SETTING SOURCE

SUMMARY

DRAFT

PHYSICAL SETTING SOURCE MAP-3220399.2s N County Boundary N

Major Roads N

Contour Lines

@ Earthquake epicenter, Richw 5 or greater Wa1BI'Wells Public Water Supply W*lls

~ Cluster of Multiple Icons SITE NAME: SHINE Medical Stevens Point, WI ADDRESS:

Lands End Way, Stevens Point WI 54482 LAT/LONG: 44.5070/89.4959 0

1/4 112

+ Groundwater Flow Direction

@I) lndetarrninata Groundwa1ar Flow at Location (ill Grol.ndwatlr Flow Varies at Location

<HID Closest Hydrogeological Data

' i:l Golder Associates CONTACT:

INQUIRY II: 3220399.2s DATE:

December 07, 2011 11:47 am

TC3220399.2s Page A-11 2

West 1/2 - 1 Mile Lower USGS2429066 FED USGS 1964-06-07 12.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1964-06-07 Ground water data end date:

Ground water data begin date: 1964-06-07 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

80.0 Hole depth:

80.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00 Altitude:

24000 Map scale:

POLONIA Location map:

NESWS01 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.49872787 Dec lon:

44.50135807 Dec lat:

0892955 Longitude:

USGS2429048 EDR Site id:

443005 Latitude:

PT-23/08E/01-0511 Site name:

443005089295501 Site no:

USGS Agency cd:

1 SSW 1/4 - 1/2 Mile Lower USGS2429048 FED USGS Map ID Direction Distance Elevation EDR ID Number Database

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-12 CST Mean greenwich time offset:

19870429 Date inventoried:

19850618 Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1120 Altitude:

24000 Map scale:

POLONIA Location map:

NWNWS06 T23N R09E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.48650552 Dec lon:

44.51052505 Dec lat:

0892911 Longitude:

USGS2429073 EDR Site id:

443038 Latitude:

PT-23/09E/06-1157 Site name:

443038089291101 Site no:

USGS Agency cd:

3 ENE 1/2 - 1 Mile Higher USGS2429073 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

M Coor accr:

M Coor meth:

-89.50622809 Dec lon:

44.50746908 Dec lat:

0893022 Longitude:

USGS2429066 EDR Site id:

443027 Latitude:

PERM 24126 Site name:

443027089302201 Site no:

WI001 Agency cd:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-13 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

M Coor accr:

M Coor meth:

-89.49733911 Dec lon:

44.51469148 Dec lat:

0892950 Longitude:

USGS2429094 EDR Site id:

443053 Latitude:

PERM 24279 Site name:

443053089295001 Site no:

WI001 Agency cd:

4 North 1/2 - 1 Mile Higher USGS2429094 FED USGS 1985-06-18 6.0 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1985-06-18 Ground water data end date:

Ground water data begin date: 1985-06-18 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

71.0 Hole depth:

71.0 Well depth:

SAND AND GRAVEL AQUIFER Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-14 A6 SSE 1/2 - 1 Mile Higher USGS2429033 FED USGS 1963-04-01 21.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1963-04-01 Ground water data end date:

Ground water data begin date: 1963-04-01 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

116 Hole depth:

116 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1130.00 Altitude:

24000 Map scale:

POLONIA Location map:

S06 T023N R009E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

T Coor accr:

M Coor meth:

-89.48733876 Dec lon:

44.50108056 Dec lat:

0892914 Longitude:

USGS2429047 EDR Site id:

443004 Latitude:

PT-23/09E/06-0486 Site name:

443004089291401 Site no:

USGS Agency cd:

5 SE 1/2 - 1 Mile Higher USGS2429047 FED USGS Map ID Direction Distance Elevation EDR ID Number Database

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-15 CST Mean greenwich time offset:

Not Reported Date inventoried:

19591113 Date construction:

Ground-water other than Spring Site type:

Flat surface Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

.1 Altitude accuracy:

Level or other surveying method Altitude method:

1115.32 Altitude:

24000 Map scale:

ARNOTT Location map:

NENENES12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.48928325 Dec lon:

44.49830276 Dec lat:

0892921 Longitude:

USGS2429032 EDR Site id:

442954 Latitude:

PT-23/08E/12-0361 Site name:

442954089292101 Site no:

USGS Agency cd:

A7 SSE 1/2 - 1 Mile Higher USGS2429032 FED USGS 1959-10-16 13.83 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1959-10-16 Ground water data end date:

Ground water data begin date: 1959-10-16 2

Water quality data count:

1974-07-12 Water quality data end date:

1965-06-10 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

driller Source of depth data:

92.0 Hole depth:

87.4 Well depth:

QUATERNARY Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

19591016 Date construction:

Ground-water other than Spring Site type:

Flat surface Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1113.00 Altitude:

24000 Map scale:

ARNOTT Location map:

NENENES12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.48928325 Dec lon:

44.49830276 Dec lat:

0892921 Longitude:

USGS2429033 EDR Site id:

442954 Latitude:

PT-23/08E/12-0360 Site name:

442954089292102 Site no:

USGS Agency cd:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-16 Not Reported Block no:

Not Reported Lot no:

Not Reported Subdivisio:

Not Reported Well stree:

Not Reported Fire:

STEVENS POINT Municipal1:

C Municipal:

0490 Construc 6:

54467 Construc 5:

WI Construc 4:

PLOVER Construc 3:

PO BOX 490 Construc 2:

3262 Construc 1:

ROBERTS IRRIGATION CO INC Constructo:

01/03/2008 Dnr rece 2:

01/03/2008 Dnr rece 1:

10/18/2007 Dnr receiv:

06/21/2007 Complete d:

Not Reported Owner ph 1:

Not Reported Owner phon:

Not Reported Owner are:

Not Reported Owner zip2:

54481 Owner zip1:

WI Owner stat:

STEVENS POINT Owner city:

3217 JOHN JOANIS DR Owner mail:

ADVENTURE 2120 Owner name:

Not Reported Tax parcel:

6 District c:

5.0E+001 County cod:

Not Reported County wel:

TY626 Wi unique:

8 WSW 1/2 - 1 Mile Lower WI3000000008386 WI WELLS 1959-11-13 9.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1959-11-13 Ground water data end date:

Ground water data begin date: 1959-11-13 1

Water quality data count:

1965-06-10 Water quality data end date:

1965-06-10 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

driller Source of depth data:

31.3 Hole depth:

31.3 Well depth:

QUATERNARY Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-17 Not Reported Animal yar:

0 Pav anim 1:

Not Reported Pav animal:

0 Wastewtr a:

Not Reported Wastewtr s:

0 Clewtr amt:

Not Reported Clewtr sum:

0 Coll sew 1:

Not Reported Coll sewer:

Not Reported Build se 3:

Not Reported Build se 2:

0 Build se 1:

Not Reported Build sewe:

Not Reported Build dr 2:

0 Build dr 1:

Not Reported Build drai:

0 Found dr 1:

Not Reported Found drai:

0 Found cl 1:

Not Reported Found clwt:

0 Privy amt:

Not Reported Privy code:

0 Dwnspot 1:

Not Reported Dwnspot hy:

0 Shorline p:

Not Reported Shoreline:

0 Buried p 1:

Not Reported Buried pet:

0 Buried o 1:

Not Reported Buried oil:

0 Nonconfo 1:

Not Reported Nonconform:

0 Sew abso 1:

Not Reported Sew absorb:

0 Septic t 1:

Not Reported Septic tan:

1.4E+001 Build oh a:

Not Reported Build over:

0 Landfill a:

Not Reported Landfill q:

N Flood plai:

Not Reported Highest po:

N Hicap prop:

N Hicap well:

IRRIGATION Facility t:

Not Reported Service co:

X Well categ:

Not Reported Other expl:

1 Well type:

Not Reported New well i:

Not Reported Prev well:

Not Reported Replace re:

Not Reported Orig year:

1 Well statu:

E E w:

8.0E+000 Range no:

2.3E+001 Township n:

2.0E+000 Section:

NE Quar:

SE Quar quar:

Not Reported Govt lot:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-18 B

Static w 1:

2.7E+001 Static wtr:

Not Reported Depth:

S Sacks ya 1:

Not Reported Seal num 1:

5.3E+001 Seal to 1:

3.1E+001 Seal from1:

20 RED FLINT Seal kind1:

S Sacks yard:

Not Reported Seal numbe:

3.1E+001 Seal to am:

0 Seal from:

DRILL CUTTINGS Seal kind:

Not Reported Seal metho:

5.3E+001 Screen to:

4.3E+001 Screen fro:

JOHNSON #20 GALV Screen Type:

6.0E+000 Screen dia:

0 Cls to a 3:

0 Cls to a 2:

0 Cls to a 1:

4.3E+001 Cls to amt:

0 Cls from 3:

0 Cls from 2:

0 Cls from 1:

0 Cls from a:

Not Reported Cls desc 3:

Not Reported Cls desc 2:

Not Reported Cls desc 1:

A53 BLACK NORTHWEST PIPE.280 WELDED Cls desc t:

0 Cls dia 3:

0 Cls dia 2:

0 Cls dia 1:

6.0E+000 Cls dia am:

Not Reported Other ex 1:

Not Reported Other dril:

Not Reported Remove exp:

Not Reported Temp otr r:

0 Dia temp a:

Not Reported Tem otr ca:

0 Cable bit1:

Not Reported Cable bit:

Not Reported Rev rot co:

Not Reported Rot foam c:

Not Reported Rot air co:

X Rot mud co:

0 Dr4 to amt:

0 Dr4 from a:

0 Dr4 dia am:

0 Dr3 to amt:

0 Dr3 from a:

0 Dr3 dia am:

0 Dr2 to amt:

0 Dr2 from a:

0 Dr2 dia am:

5.3E+001 Dr1 to amt:

0 Dr1 from a:

9.0E+000 Dr1 dia am:

Not Reported Nr112 text:

0 Nr 112 a 1:

Not Reported Nr 112 amt:

Not Reported Manure s 2:

0 Manure s 1:

Not Reported Manure sto:

Not Reported Manure t 1:

Not Reported Manure typ:

0 Manure p 1:

Not Reported Manure pip:

0 Barn gut 1:

Not Reported Barn gutte:

Not Reported Silo type:

0 Silo amt:

Not Reported Silo:

0 Animal y 1:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-19 9

West 1/2 - 1 Mile Lower USGS2429067 FED USGS WI3000000008386 Site id:

Not Reported Empty gy:

26915464 Notificati:

WELL CONSTRUCTION Record sou:

1117 Batch:

4 Spec capac:

09/07/2006 Approval d:

Not Reported Approval n:

Not Reported Fid 1:

Not Reported Common wel:

Not Reported Hicap no:

0 Collet sew:

Not Reported Collect se:

Not Reported Varince is:

Not Reported Temp outer:

Not Reported Lower cabl:

Not Reported Lower ro 2:

Not Reported Lower ro 1:

Not Reported Lower rota:

Not Reported Drill casi:

GPS008 Lat long m:

30.555 Long minut:

89 Long degre:

30.192 Lat minute:

44 Lat degree:

PORTAGE County tex:

5.3E+001 Bottom:

05/22/2008 File creat:

Not Reported Shoreline1:

Not Reported Septic typ:

0 Ditch amt:

Y Label sent:

Not Reported Comment fl:

10/15/2007 Ro sign da:

PR Rig op ini:

10/15/2007 Wc sign da:

JP Well cont:

Not Reported Proper s 1:

Not Reported Proper sea:

Y Well cappe:

Y Well disin:

Y Well dev c:

A Well abvbe:

1.3E+001 Well depth:

1.0E+000 Pump hrs t:

M Pump by co:

3.0E+001 Pump gals:

3.4E+001 Pump wtr b:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-20 CST Mean greenwich time offset:

19870422 Date inventoried:

19830603 Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1112 Altitude:

24000 Map scale:

STEVENS POINT Location map:

NENWS01 T23N R08E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.51122822 Dec lon:

44.50913568 Dec lat:

0893040 Longitude:

USGS2429070 EDR Site id:

443033 Latitude:

PT-23/08E/01-1125 Site name:

443033089304001 Site no:

USGS Agency cd:

10 West 1/2 - 1 Mile Lower USGS2429070 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

78.0 Hole depth:

78.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

10 Altitude accuracy:

Interpolated from topographic map Altitude method:

1105.00 Altitude:

24000 Map scale:

STEVENS POINT Location map:

NWSENES02 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.51095042 Dec lon:

44.50746901 Dec lat:

0893039 Longitude:

USGS2429067 EDR Site id:

443027 Latitude:

PT-23/08E/02-0895 Site name:

443027089303901 Site no:

USGS Agency cd:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-21 1

Ground water data count:

1975-05-05 Ground water data end date:

Ground water data begin date: 1975-05-05 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

45.0 Hole depth:

45.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1106.00 Altitude:

24000 Map scale:

STEVENS POINT Location map:

NENES02 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.51095046 Dec lon:

44.51108014 Dec lat:

0893039 Longitude:

USGS2429076 EDR Site id:

443040 Latitude:

PT-23/08E/02-0875 Site name:

443040089303901 Site no:

USGS Agency cd:

11 WNW 1/2 - 1 Mile Lower USGS2429076 FED USGS 1983-06-03 7.0 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1983-06-03 Ground water data end date:

Ground water data begin date: 1983-06-03 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

54.0 Hole depth:

54.0 Well depth:

SAND AND GRAVEL AQUIFER Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-22 13 South 1/2 - 1 Mile Lower USGS2429204 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

other government (other than USGS)

Source of depth data:

76 Hole depth:

76 Well depth:

SAND AND GRAVEL AQUIFER Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

19870203 Date inventoried:

19820512 Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Not Reported Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1117 Altitude:

24000 Map scale:

POLONIA Location map:

NWSWS31 T024N R009E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

T Coor accr:

M Coor meth:

-89.48678338 Dec lon:

44.51663617 Dec lat:

0892912 Longitude:

USGS2429102 EDR Site id:

443100 Latitude:

PT-24/09E/31-1076 Site name:

443100089291201 Site no:

USGS Agency cd:

12 NE 1/2 - 1 Mile Higher USGS2429102 FED USGS 1975-05-05 23.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-23 CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

2.5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1100.00 Altitude:

24000 Map scale:

WHITING Location map:

SESES02 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.51122811 Dec lon:

44.49996898 Dec lat:

0893040 Longitude:

USGS2429044 EDR Site id:

443000 Latitude:

PT-23/08E/02-0593 Site name:

443000089304001 Site no:

USGS Agency cd:

14 WSW 1/2 - 1 Mile Lower USGS2429044 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

78.0 Hole depth:

78.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00 Altitude:

24000 Map scale:

ARNOTT Location map:

NES12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.49345004 Dec lon:

44.49413604 Dec lat:

0892936 Longitude:

USGS2429204 EDR Site id:

442939 Latitude:

PT-23/08E/12-1054 Site name:

442939089293601 Site no:

USGS Agency cd:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-24 4

Ground water data count:

1953-10-14 Ground water data end date:

Ground water data begin date: 1950-07-20 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

30.0 Hole depth:

29.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1100.00 Altitude:

24000 Map scale:

ARNOTT Location map:

SWNES12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

S Coor accr:

M Coor meth:

-89.49706122 Dec lon:

44.49385818 Dec lat:

0892949 Longitude:

USGS2429203 EDR Site id:

442938 Latitude:

PT-23/08E/12-0002 Site name:

442938089294901 Site no:

USGS Agency cd:

15 South 1/2 - 1 Mile Lower USGS2429203 FED USGS 1967-05-04 21.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1

Ground water data count:

1967-05-04 Ground water data end date:

Ground water data begin date: 1967-05-04 0

Water quality data count:

0000-00-00 Water quality data end date:

0000-00-00 Water quality data begin date:

0 Peak flow data count:

0000-00-00 Peak flow data end date:

0000-00-00 Peak flow data begin date:

0 Daily flow data count:

0000-00-00 Daily flow data end date:

0000-00-00 Daily flow data begin date:

0 Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

86.0 Hole depth:

86.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-25 B17 ENE 1/2 - 1 Mile Higher USGS2429082 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

90.0 Hole depth:

90.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1105.00 Altitude:

24000 Map scale:

WHITING Location map:

NWNWS12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

S Coor accr:

M Coor meth:

-89.50567249 Dec lon:

44.49580245 Dec lat:

0893020 Longitude:

USGS2429210 EDR Site id:

442945 Latitude:

PT-23/08E/12-0894 Site name:

442945089302001 Site no:

USGS Agency cd:

16 SSW 1/2 - 1 Mile Lower USGS2429210 FED USGS 1950-10-17 10.42 1950-07-20 10.03 1953-10-14 9.20 1950-11-25 10.91 Date Feet below Surface Feet to Sealevel Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 4

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-26 CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

M Coor accr:

M Coor meth:

-89.47817205 Dec lon:

44.51191414 Dec lat:

0892841 Longitude:

USGS2429083 EDR Site id:

443043 Latitude:

PERM 24110 Site name:

443043089284103 Site no:

WI001 Agency cd:

B18 ENE 1/2 - 1 Mile Higher USGS2429083 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

Not Reported Altitude datum:

Not Reported Altitude accuracy:

Not Reported Altitude method:

Not Reported Altitude:

Not Reported Map scale:

Not Reported Location map:

Not Reported Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

M Coor accr:

M Coor meth:

-89.47817205 Dec lon:

44.51191414 Dec lat:

0892841 Longitude:

USGS2429082 EDR Site id:

443043 Latitude:

PERM 23908 Site name:

443043089284102 Site no:

WI001 Agency cd:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-27 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

96.0 Hole depth:

96.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1132.00 Altitude:

24000 Map scale:

POLONIA Location map:

SESWS31 T024N R009E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

F Coor accr:

M Coor meth:

-89.47817205 Dec lon:

44.51191414 Dec lat:

0892841 Longitude:

USGS2429081 EDR Site id:

443043 Latitude:

PT-24/09E/31-0828 Site name:

443043089284101 Site no:

USGS Agency cd:

B19 ENE 1/2 - 1 Mile Higher USGS2429081 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

Not Reported Source of depth data:

Not Reported Hole depth:

Not Reported Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-28 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:

Not Reported Ground water data end date:

Ground water data begin date: Not Reported Not Reported Water quality data count:

Not Reported Water quality data end date:

Not Reported Water quality data begin date:

Not Reported Peak flow data count:

Not Reported Peak flow data end date:

Not Reported Peak flow data begin date:

Not Reported Daily flow data count:

Not Reported Daily flow data end date:

Not Reported Daily flow data begin date:

Not Reported Real time data flag:

Not Reported Project number:

driller Source of depth data:

80.0 Hole depth:

80.0 Well depth:

Not Reported Aquifer:

Not Reported Aquifer Type:

Single well, other than collector or Ranney type Type of ground water site:

Y Local standard time flag:

CST Mean greenwich time offset:

Not Reported Date inventoried:

Not Reported Date construction:

Ground-water other than Spring Site type:

Not Reported Topographic:

Castle Rock. Wisconsin. Area = 3250 sq.mi.

Hydrologic:

National Geodetic Vertical Datum of 1929 Altitude datum:

5 Altitude accuracy:

Interpolated from topographic map Altitude method:

1110.00 Altitude:

24000 Map scale:

WHITING Location map:

NWSENWS12 T023N R008E 4 Land net:

US Country:

097 County:

55 State:

55 District:

NAD83 Dec latlong datum:

NAD27 Latlong datum:

S Coor accr:

M Coor meth:

-89.50372802 Dec lon:

44.49385806 Dec lat:

0893013 Longitude:

USGS2429138 EDR Site id:

442938 Latitude:

PT-23/08E/12-0512 Site name:

442838089301301 Site no:

USGS Agency cd:

20 SSW 1/2 - 1 Mile Lower USGS2429138 FED USGS Map ID Direction Distance Elevation EDR ID Number Database

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS

DRAFT

TC3220399.2s Page A-29 0%

33%

67%

4.258 pCi/L Basement Not Reported Not Reported Not Reported Not Reported Living Area - 2nd Floor 0%

0%

100%

1.150 pCi/L Living Area - 1st Floor

% >20 pCi/L

% 4-20 pCi/L

% <4 pCi/L Average Activity Area Number of sites tested: 24 Federal Area Radon Information for PORTAGE COUNTY, WI

Zone 3 indoor average level < 2 pCi/L.

Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L.

Note: Zone 1 indoor average level > 4 pCi/L.

Federal EPA Radon Zone for PORTAGE County: 1 AREA RADON INFORMATION

GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADON

DRAFT

TOPOGRAPHIC INFORMATION USGS 7.5 Digital Elevation Model (DEM)

Source: United States Geologic Survey EDR acquired the USGS 7.5 Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data with consistent elevation units and projection.

Scanned Digital USGS 7.5 Topographic Map (DRG)

Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.

HYDROLOGIC INFORMATION Flood Zone Data:

This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.

NWI:

National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.

HYDROGEOLOGIC INFORMATION AQUIFLOW Information System R

Source: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table information.

GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994).

STATSGO:

State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services The U.S. Department of Agricultures (USDA) Natural Resources Conservation Service (NRCS) leads the national Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps.

SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services (NRCS)

Telephone: 800-672-5559 SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the original soil survey maps. This level of mapping is designed for use by landowners, townships and county natural resource planning and management.

TC3220399.2s Page A-30 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT

LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLS PWS: Public Water Systems Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources.

PWS ENF: Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS).

USGS Water Wells:

USGS National Water Inventory System (NWIS)

This database contains descriptive information on sites where the USGS collects or has collected data on surface water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater.

STATE RECORDS Wisconsin Well Construction Report File Source: Department of Natural Resources Telephone: 608-266-0153 In the past, not all latitude/longitudes were accurate. Many were protracted from centroid (center of the quarter sections given in PLSS). The ones that were not accurate were removed from the well database.

OTHER STATE DATABASE INFORMATION RADON State Database: WI Radon Source: Department of Health & Family Services Telephone: 608-266-1865 Wisconsin Measurement Summary Area Radon Information Source: USGS Telephone: 703-356-4020 The National Radon Database has been developed by the U.S. Environmental Protection Agency (USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey.

The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at private sources such as universities and research institutions.

EPA Radon Zones Source: EPA Telephone: 703-356-4020 Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor radon levels.

OTHER Airport Landing Facilities:

Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656 Epicenters:

World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration TC3220399.2s Page A-31 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT

STREET AND ADDRESS INFORMATION

© 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.

TC3220399.2s Page A-32 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT

@@ Line 2: / Line 2: @@
 | number = ML13309B013
 | issue date = 02/10/2012
-| title = Shine Medical Technologies, Inc., Application for Construction Permit Response to Environmental Requests for Additional Information, Enclosure 2 Attachment 19 - Draft Phase I Environmental Site Assessment (Stevens Point, Wi) [Part 1 of 9]
+| title = Shine Medical Technologies, Inc., Application for Construction Permit Response to Environmental Requests for Additional Information, Enclosure 2 Attachment 19 - Draft Phase I Environmental Site Assessment (Stevens Point, Wi) (Part 1 of 9)
 | author name =
 | author affiliation = SHINE Medical Technologies, Inc
@@ Line 14: / Line 14: @@
 | document type = Environmental Assessment
 | page count = 111
+| project =
+| stage = Draft Request
 }}
 =Text=
-{{#Wiki_filter:156 pages follow ENCLOSURE 2 ATTACHMENT 19
+{{#Wiki_filter:156 pages follow ENCLOSURE 2 ATTACHMENT 19 SHINE MEDICAL TECHNOLOGIES, INC.
+SHINE MEDICAL TECHNOLOGIES, INC. APPLICATION FOR CONSTRUCTION PERMIT RESPONSE TO ENVIRONMENTAL REQUESTS FOR ADDITIONAL INFORMATION DRAFT PHASE I ENVIRONMENTAL SITE ASSESSMENT STEVENS POINT, WISCONSIN FEBRUARY 10, 2012
-SHINE MEDICAL TECHNOLOGIES, INC.
-SHINE MEDICAL TECHNOLOGIES, INC. APPLICATION FOR CONSTRUCTION PERMIT RESPONSE TO ENVIRONMENTAL REQUESTS FOR ADDITIONAL INFORMATION DRAFT PHASE I ENVIRONMENTAL SITE ASSESSMENT STEVENS POINT, WISCONSIN FEBRUARY 10, 2012 Aworldcapabilitieslocally
+*ROGHU*ROGHU$VVRFLDWHVDQGWKH*$JOREHGHVLJQDUHWUDGHPDUNVRI*ROGHU$VVRFLDWHV&RUSRUDWLRQ
+A world RI capabilities GHOLYHUHG locally
+REPORT
+PHASE I ENVIRONMENTAL SITE ASSESSMENT SHINE MEDICAL STEVENS POINT, WI T23N R8W, SECTION 1 STEVENS POINT, WI 54481 Submitted To: SHINE Medical Technologies 8123 Forsythia St. Suite 140 Middleton, WI 53562 Submitted By: Golder Associates Inc.
+Haines Road Duluth, MN 55811 February 10, 2012 Project No. 113-81093 DRAFT
-REPORTPHASE I ENVIRONMENTAL SITE ASSESSMENTSHINE MEDICAL STEVENS POINT, WI T23N R8W, SECTION 1 STEVENS POINT, WI 54481SubmittedTo:SHINE Medical Technologies8123 Forsythia St. Suite 140 Middleton,WI 53562 Submitted By:
+Golder Associates 4438 Haines Road Duluth, MN 55811 Ph. 218-724-0088 Fax 218-724-0089 February 10, 2012 Dr. Gregory Piefer/CEO SHINE Medical Technologies 8123 Forsythia St. Suite 140 Middleton, WI 53562 Our Ref: 113-81093 RE: Phase I Environmental Site Assessment P113-81093 SHINE Medical - Stevens Point, WI Lands End Way Stevens Point, WI
-Golder Associates Inc.
-Haines Road
-Duluth, MN 55811February 10, 2012Project No. 113-81093 DRAFT Golder Associates 4438 Haines Road Duluth, MN 55811 Ph. 218-724-0088 Fax 218-724-0089 February 10, 2012 Dr. Gregory Piefer/CEO SHINE Medical Technologies
-Forsythia St. Suite 140
-Middleton, WI  53562 Our Ref: 113-81093 RE: Phase I Environmental Site Assessment P113-81093 SHINE Medical - Stevens Point, WI
-Lands End Way
-Stevens Point, WI
 ==Dear Dr. Piefer:==
+Golder Associates (Golder) is pleased to present to SHINE Medical Technolgies this Phase I Environmental Site Assessment Report for the Subject Property. Information presented in this Report is subject to the general limitations presented in the Report and Golders Proposal dated December 7, 2011.
+Golder appreciates this opportunity to assist you with your environmental needs. If you have any questions or comments regarding the information presented in this report, please call our office.
+Sincerely, GOLDER ASSOCIATES INC.
+Kathryn R Larson Kathryn R Larson Senior Project Geologist Golder Associates DRAFT
-Golder Associates (Golder) is pleased to present to SHINE Medical Technolgies this Phase IEnvironmental Site Assessment Report for the Subject Property. Information presented in this Report is subject to the general limitations presented in the Report and Golder's Proposal dated December 7,
+/10/2012 Table of Contents Project No. 113-81093
-.Golder appreciates this opportunity to assist you with your environmental needs. If you have any questions or comments regarding the information presented in this report, please call our office.
+==SUMMARY==
-Sincerely, GOLDER ASSOCIATES INC.
-Kathryn R Larson Kathryn R Larson Senior Project Geologist Golder Associates DRAFT 2/10/2012 Table of Contents Project No. 113-81093SUMMARY1...............................................................................................................................
-.....................
-==1.0INTRODUCTION==
+==1.0 INTRODUCTION==
+1.1 Purpose 2
+.2 Scope of Services 2
+.3 Limitations and Exceptions 3
+.4 Special Terms and Conditions 4
+.5 User Reliance 4
+.0 PROPERTY DESCRIPTION 5
+.1 Location and Legal Description 5
+.2 Site and Vicinity General Characteristics 5
+.3 Current Use of the Subject Property 5
+.4 Description of Structures, Roads, and Other Improvements on the Subject Property 5
+.5 Current Use of Adjoining Properties 6
+.0 USER PROVIDED INFORMATION 7
+.1 Environmental Cleanup Liens 7
+.2 Activity and Use Limitations 7
+.3 Relationship of the Purchase Price to the Fair Market Value 7
+.4 Commonly Known or Reasonably Ascertainable Information 7
+.5 The Degree of Obviousness or the Presence of Contamination 8
+.6 Reason for Conducting ESA 8
+.0 RECORDS REVIEW 9
+.1 Standard Environmental Records Sources, Federal and State 9
+.1.1 Subject Property Database Listing 9
+.1.2 Off-Site Properties Database Listings 10 4.1.3 Orphans Summary 10 4.1.4 Other Agency Records 10 4.2 Additional Environmental Record Sources 10 4.3 Physical Setting Sources 10 4.3.1 Sources Reviewed 10 4.3.2 General Topographic Setting of the Area 10 4.3.3 Geologic and Hydrogeologic Setting 10 4.3.4 Surface Water and Hydrologic Setting 11 4.4 Historical Use Information on the Subject Property 11 4.4.1 Subject Property Historical Use Summary 11 4.4.2 Standard Historical Records 11 4.5 Historical Use Information on Adjoining Properties 13 5.0 SITE RECONNAISSANCE 14 5.1 Methodology and Limiting Conditions 14 5.2 General Site Setting 14 5.2.1 Current Use of the Subject Property 14 5.2.2 Past Use of the Subject Property 14 5.2.3 General Description of Structures 14 5.2.4 Roads 14 5.2.5 Potable Water Supply 14 5.2.6 Sewage Disposal System 14 DRAFT
-...............................................................................................................................
+/10/2012 Table of Contents Project No. 113-81093 5.3 Interior and Exterior Observations 15 5.3.1 Storage Tanks 15 5.3.2 Odors 15 5.3.3 Pools of Liquid 15 5.3.4 Drums 15 5.3.5 Hazardous Substance and Petroleum Product Containers 15 5.3.6 Unidenti&#xbf;ed Substance Containers 15 5.3.7 Evidence of Polychlorinated Biphenyls 15 5.3.8 Heating/Conditioning 15 5.3.9 Stains or Corrosion 15 5.3.10 Drains and Sumps 15 5.3.11 Pits, Ponds, or Lagoons 16 5.3.12 Stained Soil or Pavements 16 5.3.13 Stressed Vegetation 16 5.3.14 Solid Waste Disposal 16 5.3.15 Waste Water 16 5.3.16 Wells 16 5.3.17 Septic Systems 16 5.3.18 Other Interior and Exterior Observations 16 5.4 Off-Site Conditions 16 5.4.1 Adjoining Properties 16 5.4.2 Other Surrounding Properties 16 6.0 INTERVIEWS 17 6.1 Overview 17 6.2 Interview with Owners, Past Owners, Past Operators and Past Occupants 17 6.3 Interview with Site Manager 17 6.4 Interview with Occupants 17 6.5 Interview with Local Government Of&#xbf;cials 18 6.6 Interviews with Others 18 7.0 DISCUSSION 19 7.1 Findings and Opinions 19 7.1.1 Recognized Environmental Conditions 19 7.1.2 Historical Recognized Environmental Conditions 19 7.1.3 De Minimis Conditions 19 7.2 Additional Investigation 19 7.3 Data Gaps 19
-.....1.1Purpose 2...............................................................................................................................
-........1.2Scope of Services 2........................................................................................................................1.3Limitations and Exceptions3
-..........................................................................................................1.4Special Terms and Conditions4
-.....................................................................................................1.5User Reliance 4..............................................................................................................................2.0PROPERTY DESCRIPTION5
-..................................................................................................................2.1Location and Legal Description5
-...................................................................................................2.2Site and Vicinity General Characteristics5
-.....................................................................................2.3Current Use of the Subject Property5
-............................................................................................2.4Description of Structures, Roads, and Other Improvements on the Subject Property5
-.................2.5Current Use of Adjoining Properties6
-............................................................................................3.0USER PROVIDED INFORMATION7
-........................................................................................................3.1Environmental Cleanup Liens7
-......................................................................................................3.2Activity and Use Limitations7
-.........................................................................................................3.3Relationship of the Purchase Price to the Fair Market Value7
-.......................................................3.4Commonly Known or Reasonably Ascertainable Information7
-......................................................3.5The Degree of Obviousness or the Presence of Contamination8
-.................................................3.6Reason for Conducting ESA8
-........................................................................................................4.0RECORDS REVIEW 9..............................................................................................................................4.1Standard Environmental Records Sources, Federal and State9
-...................................................4.1.1Subject Property Database Listing9
-....................................................................................4.1.2Off-Site Properties Database Listings10
-.............................................................................4.1.3Orphans Summary10
-..........................................................................................................4.1.4Other Agency Records10
-....................................................................................................4.2Additional Environmental Record Sources10
-................................................................................4.3Physical Setting Sources10
-...........................................................................................................4.3.1Sources Reviewed10
-..........................................................................................................4.3.2General Topographic Setting of the Area10
-........................................................................4.3.3Geologic and Hydrogeologic Setting10
-...............................................................................4.3.4Surface Water and Hydrologic Setting11
-............................................................................4.4Historical Use Information on the Subject Property11
-...................................................................4.4.1Subject Property Historical Use Summary11
-......................................................................4.4.2Standard Historical Records11
-...........................................................................................4.5Historical Use Information on Adjoining Properties13
-...................................................................5.0SITE RECONNAISSANCE14
-...................................................................................................................5.1Methodology and Limiting Conditions14
-........................................................................................5.2General Site Setting14
-...................................................................................................................5.2.1Current Use of the Subject Property14
-...............................................................................5.2.2Past Use of the Subject Property14
-....................................................................................5.2.3General Description of Structures14
-...................................................................................5.2.4Roads 14..............................................................................................................................5.2.5Potable Water Supply14
-......................................................................................................5.2.6Sewage Disposal System14
-...............................................................................................
-DRAFT 2/10/2012 Table of Contents Project No. 113-810935.3Interior and Exterior Observations15
-.............................................................................................5.3.1Storage Tanks15
-.................................................................................................................5.3.2Odors 15..............................................................................................................................5.3.3Pools of Liquid15
-.................................................................................................................5.3.4Drums 15.............................................................................................................................5.3.5Hazardous Substance and Petroleum Product Containers15
-.............................................5.3.6Unidentied Substance Containers15
-.................................................................................5.3.7Evidence of Polychlorinated Biphenyls15
-...........................................................................5.3.8Heating/Conditioning15
-.......................................................................................................5.3.9Stains or Corrosion15
-.........................................................................................................5.3.10Drains and Sumps15
-...........................................................................................................5.3.11Pits, Ponds, or Lagoons16
-..................................................................................................5.3.12Stained Soil or Pavements16
-..............................................................................................5.3.13Stressed Vegetation16
-........................................................................................................5.3.14Solid Waste Disposal16
-......................................................................................................5.3.15Waste Water 16....................................................................................................................5.3.16Wells 16...............................................................................................................................5.3.17Septic Systems16
-...............................................................................................................5.3.18Other Interior and Exterior Observations16
-........................................................................5.4Off-Site Conditions 16.....................................................................................................................5.4.1Adjoining Properties16
-........................................................................................................5.4.2Other Surrounding Properties16
-.........................................................................................6.0INTERVIEWS 17...............................................................................................................................
-........6.1Overview 17...............................................................................................................................
-.....6.2Interview with Owners, Past Owners, Past Operators and Past Occupants17
-..............................6.3Interview with Site Manager17
-.......................................................................................................6.4Interview with Occupants17
-...........................................................................................................6.5Interview with Local Government Ofcials18.................................................................................6.6Interviews with Others18
-...............................................................................................................7.0DISCUSSION 19...............................................................................................................................
-........7.1Findings and Opinions19
-...............................................................................................................7.1.1Recognized Environmental Conditions19
-...........................................................................7.1.2Historical Recognized Environmental Conditions19
-...........................................................7.1.3De Minimis Conditions19
-....................................................................................................7.2Additional Investigation19
-..............................................................................................................7.3Data Gaps 19...............................................................................................................................
-...
-==8.0CONCLUSION==
+==8.0 CONCLUSION==
-S 20...............................................................................................................................
+S 20 9.0 QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS 21
-....9.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS21
-...........................
 ==10.0REFERENCES==
+LIST OF FIGURES FIGURE 1 VICINITY MAP FIGURE 2 SITE MAP LIST OF APPENDICES Appendix A Legal Description of the Subject Property/Chain of Title Report Appendix B Federal and State Regulatory Database Search DRAFT
-...............................................................................................................................
+/10/2012 Table of Contents Project No. 113-81093 Appendix C Historical Documentation Appendix D Photographs Recorded During the Subject Property Inspection Appendix E User Questionnaire Appendix F Resumes of Environmental Professionals DRAFT
-......LIST OF FIGURESFIGURE 1 VICINITY MAP FIGURE 2 SITE MAP LIST OF APPENDICESAppendix A Legal Description of the Subject Property/Chain of Title Report Appendix B Federal and State Regulatory Database Search DRAFT 2/10/2012 Table of Contents Project No. 113-81093Appendix C Historical DocumentationAppendix D Photographs Recorded During the Subject Property Inspection
-Appendix E User Questionnaire Appendix F Resumes of Environmental Professionals DRAFT 2/10/20121Project No. 113-81093 SUMMARYSHINE Medical retained Golder Associates Inc. (Golder) to perform a Phase I Environmental SiteAssessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose ofthis Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December
-th, 2011 (the Proposal), and Golder's professional judgment.
-This Summary is to be used only in conjunction with the attached Phase I ESA for SHINE Medical, Stevens Point, Wisconsin dated February 2, 2012 (the Report). All definitions used in this Summary have the same meanings as in the Report, and the use of this Summary is subject to the limitations and conditions contained in the Report. The Report shall govern in the event of any inconsistency between
-this Summary and the Report.
-This assessment has revealed no evidence of RECs in connection with the Subject Property except for the following:
+/10/2012 1
+Project No. 113-81093
-Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and
+==SUMMARY==
+SHINE Medical retained Golder Associates Inc. (Golder) to perform a Phase I Environmental Site Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December 15th, 2011 (the Proposal), and Golder's professional judgment.
+This Summary is to be used only in conjunction with the attached Phase I ESA for SHINE Medical, Stevens Point, Wisconsin dated February 2, 2012 (the Report). All definitions used in this Summary have the same meanings as in the Report, and the use of this Summary is subject to the limitations and conditions contained in the Report. The Report shall govern in the event of any inconsistency between this Summary and the Report.
+This assessment has revealed no evidence of RECs in connection with the Subject Property except for the following:
+Golder identified the following de minimis conditions, at the Subject Property:
+FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.
+OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.
+De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
+DRAFT
-herbicides is a de minimis condition.
+/10/2012 2
+Project No. 113-81093
-De minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
+==1.0 INTRODUCTION==
-DRAFT 2/10/20122Project No. 113-8109
+.1 Purpose SHINE Medical (the User) retained Golder Associates Inc. (Golder) to perform a Phase I Environmental Site Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposal dated December 7, 2011, and Golder's professional judgment. Golder representatives performed the Phase I ESA in conformance with these criteria.
+The AAI Rule states that the ASTM Standard may be used to comply with the requirements of the AAI Rule, so whenever reference is made in this Report to the ASTM Standard, it shall include the AAI Rule.
-==31.0INTRODUCTION==
+The ASTM Standard defines RECs as "the presence or likely presence of any hazardous substances or petroleum products on a property under conditions that indicate an existing release, a past release, or a material threat of a release of any hazardous substances or petroleum products into structures on the property or into the ground, groundwater, or surface water of the property. The term includes hazardous substances or petroleum products even under conditions in compliance with laws."
-.1PurposeSHINE Medical (the User) retained Golder Associates Inc. (Golder) to perform a Phase I EnvironmentalSite Assessment (ESA) of the property located at T23N, R8W, Section 1, Stevens Point, WI. The purpose of this Phase I ESA is to identify recognized environmental conditions (RECs) in connection with the Subject Property, to the extent feasible, pursuant to the processes prescribed in the ASTM Practice E 1527-05 entitled "Standard Practice for Environmental Site Assessments: Phase I Environmental Site Assessment Process" (ASTM Standard), and the EPA Rule entitled, "Standards and Practices for All Appropriate Inquiries; Final Rule" (AAI Rule), 40 CFR Part 312, the Golder Proposaldated December 7, 2011, and Golder's professional judgment. Golder representatives performed the Phase I ESA in conformance with these criteria.The AAI Rule states that the ASTM Standard may be used to comply with the requirements of the AAI Rule, so whenever reference is made in this Report to the ASTM Standard, it shall include the AAI Rule.
+.2 Scope of Services The scope of services for this ESA consisted of the following tasks:
+Records Review Reviewing property information to confirm the legal description and location of the Subject Property.
-The ASTM Standard defines RECs as "the presence or likely presence of any hazardous substances orpetroleum products on a property under conditions that indicate an existing release, a past release, or amaterial threat of a release of any hazardous substances or petroleum products into structures on the property or into the ground, groundwater, or surface water of the property. The term includes hazardous
+This information is included in Appendix A; Reviewing environmental record sources including federal and state regulatory databases to identify facilities with past or current regulatory enforcement actions within applicable distances of the Subject Property as defined in the ASTM Standard. The regulatory database search report is presented in Appendix B; Reviewing physical setting information sources to identify information about the geologic, hydrogeologic, hydrologic, and topographic conditions in the area of the Subject Property. The U.S.
+Geological Survey (USGS) 7.5-minute topographic map of the area of the Subject Property is shown on Figure 1; Reviewing historical record sources to identify past land use activities at the Subject Property and surrounding properties. Selected historical information obtained during performance of the Phase I ESA investigation is included in Appendix C.
-substances or petroleum products even under conditions in compliance with laws."1.2Scope of Services The scope of services for this ESA consisted of the following tasks:
+Site Reconnaissance Performing a visual inspection of the Subject Property and surrounding properties to identify potential sources of chemical and petroleum contamination such as aboveground storage tanks (ASTs),
-Records Review
+underground storage tanks (USTs), potential sources of polychlorinated biphenyls (PCBs),
- *Reviewing property information to confirm the legal description and location of the Subject Property.
+chemicals, and hazardous materials. Surficial evidence of potential RECs such as distressed vegetation, stained soils, and/or stained paving was also evaluated. Photographs recorded during the site reconnaissance are included in Appendix D.
-This information is included in Appendix A;*Reviewing environmental record sources including federal and state regulatory databases to identifyfacilities with past or current regulatory enforcement actions within applicable distances of the Subject Property as defined in the ASTM Standard. The regulatory database search report is
+DRAFT
-presented in Appendix B;*Reviewing physical setting information sources to identify information about the geologic,hydrogeologic, hydrologic, and topographic conditions in the area of the Subject Property. The U.S.
-Geological Survey (USGS) 7.5-minute topographic map of the area of the Subject Property is shown on Figure 1;*Reviewing historical record sources to identify past land use activities at the Subject Property andsurrounding properties. Selected historical information obtained during performance of the Phase I
-ESA investigation is included in Appendix C.
-Site Reconnaissance
- *Performing a visual inspection of the Subject Property and surrounding properties to identify potentialsources of chemical and petroleum contamination such as aboveground storage tanks (ASTs),underground storage tanks (USTs), potential sources of polychlorinated biphenyls (PCBs),chemicals, and hazardous materials. Surficial evidence of potential RECs such as distressedvegetation, stained soils, and/or stained paving was also evaluated. Photographs recorded during the site reconnaissance are included in Appendix D.
-DRAFT 2/10/20123Project No. 113-81093 Interviews*Interviewing available individuals with knowledge of current or historical use, storage, or disposal ofpotentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. User provided information is included in Appendix E.
-Report Preparation
- *Preparing a report that documents the findings, opinions, and conclusions of the Phase I ESAinvestigation conducted at the Subject Property, and provides the supporting documentation and references for those findings, opinions, and conclusions (the Report). Resumes for the environmentalprofessionals that performed the assessment and prepared this Phase I ESA Report are included in Appendix F. 1.3Limitations and ExceptionsGolder performed our services in accordance with the following principles, which are an integral part ofthe ASTM Standard: (i) No environmental site assessment can wholly eliminate uncertainty regardingthe potential for RECs in connection with a property. Performance of this ESA is intended to reduce, but not eliminate, uncertainty regarding the potential for RECs in connection with the Subject Property, andthe ASTM Standard recognizes reasonable limits of time and cost; (ii) "all appropriate inquiry" does not mean an exhaustive assessment of a property. Golder performed this ESA in conformance with the ASTM Standard's principle of identifying a balance between the competing goals of limiting the costs and time demands inherent in performing an ESA and the reduction of uncertainty about unknownconditions resulting from additional information; (iii) not every property warrants the same level ofassessment - the type of property subject to the assessment, the expertise and risk tolerance of the user, and the information developed in the course of the inquiry guided the appropriate level of assessment for this ESA; and (iv) ESAs must be evaluated based on the reasonableness of judgments made at the time and under the circumstances in which they were made. Subsequent ESAs should not be considered valid standards to judge the appropriateness of any prior assessment based on hindsight,
-new information, use of developing technology or analytical techniques, or other factors.
+/10/2012 3
+Project No. 113-81093 Interviews Interviewing available individuals with knowledge of current or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. User provided information is included in Appendix E.
+Report Preparation Preparing a report that documents the findings, opinions, and conclusions of the Phase I ESA investigation conducted at the Subject Property, and provides the supporting documentation and references for those findings, opinions, and conclusions (the Report). Resumes for the environmental professionals that performed the assessment and prepared this Phase I ESA Report are included in Appendix F.
+.3 Limitations and Exceptions Golder performed our services in accordance with the following principles, which are an integral part of the ASTM Standard: (i) No environmental site assessment can wholly eliminate uncertainty regarding the potential for RECs in connection with a property. Performance of this ESA is intended to reduce, but not eliminate, uncertainty regarding the potential for RECs in connection with the Subject Property, and the ASTM Standard recognizes reasonable limits of time and cost; (ii) "all appropriate inquiry" does not mean an exhaustive assessment of a property. Golder performed this ESA in conformance with the ASTM Standard's principle of identifying a balance between the competing goals of limiting the costs and time demands inherent in performing an ESA and the reduction of uncertainty about unknown conditions resulting from additional information; (iii) not every property warrants the same level of assessment - the type of property subject to the assessment, the expertise and risk tolerance of the user, and the information developed in the course of the inquiry guided the appropriate level of assessment for this ESA; and (iv) ESAs must be evaluated based on the reasonableness of judgments made at the time and under the circumstances in which they were made. Subsequent ESAs should not be considered valid standards to judge the appropriateness of any prior assessment based on hindsight, new information, use of developing technology or analytical techniques, or other factors.
 Along with all of the limitations set forth in various sections of the ASTM E 1527-00 protocol, the accuracy and completeness of this report may be limited by the following:
+Access Limitations - None Physical Obstructions to Observations - Dormant winter vegetation, dense woodland Outstanding Information Requests - None Other - None The information and conclusions contained in this report are based upon work undertaken by trained professional and technical staff in accordance with generally accepted engineering and scientific practices current at the time the work was performed. The conclusions and recommendations presented represent the best judgment of Golder based on the data obtained from the work. Due to the nature of investigation and the limited data available, Golder cannot warrant against undiscovered environmental liabilities. Conclusions and recommendations presented in this report should not be construed as legal advice.
+Should additional information become available which differs significantly from our understanding of conditions presented in this report, we request that this information be brought to our attention so that we may reassess the conclusions provided herein.
+DRAFT
-Access Limitations - None
+/10/2012 4
+Project No. 113-81093 1.4 Special Terms and Conditions No special terms and conditions are applicable to this ESA.
-Physical Obstructions to Observations - Dormant winter vegetation, dense woodland
+.5 User Reliance Golder has prepared this Report at the request of the User for the purpose identified by the User in Section 3.6. Use of the information contained in this Report by anyone other than User is permissible only with the prior written authorization to do so from Golder, and only under the conditions allowed by the ASTM Standard. Golder is not responsible for independent conclusions, opinions, or recommendations made by others or otherwise based on the findings presented in this Report.
+DRAFT
-Outstanding Information Requests - None
-Other - None The information and conclusions contained in this report are based upon work undertaken by trained professional and technical staff in accordance with generally accepted engineering and scientific practices current at the time the work was performed. The conclusions and recommendations presented represent the best judgment of Golder based on the data obtained from the work. Due to the nature of investigation and the limited data available, Golder cannot warrant against undiscovered environmental liabilities. Conclusions and recommendations presented in this report should not be construed as legal advice.
-Should additional information become available which differs significantly from our understanding of conditions presented in this report, we request that this information be brought to our attention so that
-we may reassess the conclusions provided herein.
-DRAFT 2/10/20124Project No. 113-810931.4Special Terms and Conditions No special terms and conditions are applicable to this ESA.1.5User RelianceGolder has prepared this Report at the request of the User for the purpose identified by the User inSection 3.6. Use of the information contained in this Report by anyone other than User is permissible only with the prior written authorization to do so from Golder, and only under the conditions allowed by the ASTM Standard. Golder is not responsible for independent conclusions, opinions, or recommendations made by others or otherwise based on the findings presented in this Report.
-DRAFT 2/10/20125Project No. 113-810932.0PROPERTY DESCRIPTION2.1Location and Legal DescriptionTheSubject Property is located at T23N, R8W, Section 1, Stevens Point, WI. The parcel is located onequarter-mile north of County Road HH and  one half-mile west of Burbank Road and is accessed by a private road that extends west from Burbank Road. The square-shaped parcel is comprised of
-.08 acres of land. The Subject Property is located in Section 1, T23N, R8W on the United States Geological Survey(USGS) 7.5-minute, Polonia, WI topographic quadrangle map, as shown on Figure 1. The Assessor'sParcel Numbers for the Subject Property are 020-23-0801-01.04, 020-23-0801-02.02,020-23-0801-02.06, 020-23-0801-03.01, 020-23-0801-03.02, 020-23-0801-04.01, 030-23-0801-13, and 030-23-0801-14.The Subject Property is located at approximately 44 30' 27.45"N and89 29' 41.70"W.
-The site layout is shown on Figure 2. According to The City of Stevens Point, the legal description for the Subject Property is a parcel of landlocated in the NE 1/4 of the NE 1/4 of the NE 1/4 of Section 1, T23N, R8W, Town of Hull and Town ofPlover, Marathon and Portage Counties, Wisconsin bounded and described in Appendix A. A copy of the description is included in Appendix A.2.2Site and Vicinity General CharacteristicsThe Subject Property is located on the eastern edge of Stevens Point, WI . The adjacent properties to the north, south, and east of the Subject Property are rural, consisting of agricultural and forest land and,according to aerial photographs, has been agricultural and forest land since at least 1938. The adjacent properties to the west of the Subject Property are developed as industrial and residential areas.
-Development to the west of the Subject Property has occurred recently with the adjacent property being developed after 1998. A rail line exists within one quarter-mile to the north of the Subject Property. The
-rail line has been north of the Subject Property since at least 1938.
+/10/2012 5
+Project No. 113-81093 2.0 PROPERTY DESCRIPTION 2.1 Location and Legal Description The Subject Property is located at T23N, R8W, Section 1, Stevens Point, WI. The parcel is located one quarter-mile north of County Road HH and one half-mile west of Burbank Road and is accessed by a private road that extends west from Burbank Road. The square-shaped parcel is comprised of 88.08 acres of land.
-The topographic gradient is low and gently slopes to Portage River and McDill Pond located approximately 2 miles to the southwest. 2.3Current Use of the Subject Property The Subject Property is used for agriculture and forestry. No buildings exist on the property.
+The Subject Property is located in Section 1, T23N, R8W on the United States Geological Survey (USGS) 7.5-minute, Polonia, WI topographic quadrangle map, as shown on Figure 1. The Assessor's Parcel Numbers for the Subject Property are 020-23-0801-01.04, 020-23-0801-02.02, 020-23-0801-02.06, 020-23-0801-03.01, 020-23-0801-03.02, 020-23-0801-04.01, 030-23-0801-13, and 030-23-0801-14. The Subject Property is located at approximately 44 30' 27.45"N and 89 29' 41.70"W.
+The site layout is shown on Figure 2.
+According to The City of Stevens Point, the legal description for the Subject Property is a parcel of land located in the NE 1/4 of the NE 1/4 of the NE 1/4 of Section 1, T23N, R8W, Town of Hull and Town of Plover, Marathon and Portage Counties, Wisconsin bounded and described in Appendix A. A copy of the description is included in Appendix A.
+.2 Site and Vicinity General Characteristics The Subject Property is located on the eastern edge of Stevens Point, WI. The adjacent properties to the north, south, and east of the Subject Property are rural, consisting of agricultural and forest land and, according to aerial photographs, has been agricultural and forest land since at least 1938. The adjacent properties to the west of the Subject Property are developed as industrial and residential areas.
+Development to the west of the Subject Property has occurred recently with the adjacent property being developed after 1998. A rail line exists within one quarter-mile to the north of the Subject Property. The rail line has been north of the Subject Property since at least 1938.
+The topographic gradient is low and gently slopes to Portage River and McDill Pond located approximately 2 miles to the southwest.
+.3 Current Use of the Subject Property The Subject Property is used for agriculture and forestry. No buildings exist on the property.
 Pesticides and herbicides are applied to the agricultural areas of the Subject Property bi-annually. No hazardous substances or petroleum products are stored, generated, or disposed of on site.
+Selective tree harvesting has occurred on the wooded portions of the parcel.
+.4 Description of Structures, Roads, and Other Improvements on the Subject Property No structures exist on the Subject Property.
+A private access road extends west from Burbank Road through the subject property.
+A private trap shooting range located near the center of the Subject Property is used approximately twice a year.
+Residences and businesses in the vicinity of the Subject Property are served by municipal water from the city of Stevens Point Wisconsin. Wastewater in the vicinity of the Subject Property is handled by the City of Stevens Point Wastewater Treatment system.
+DRAFT
-Selective tree harvesting has occurred on the wooded portions of the parcel. 2.4Description of Structures, Roads, and Other Improvements on the Subject PropertyNo structures exist on the Subject Property.
+/10/2012 6
+Project No. 113-81093 2.5 Current Use of Adjoining Properties The adjoining property uses are described below:
-A private access road extends west from Burbank Road through the subject property.
-A private trap shooting range located near the center of the Subject Property is used approximately twice a year.
-Residences and businesses in the vicinity of the Subject Property are served by municipal water from the city of Stevens Point Wisconsin. Wastewater in the vicinity of the Subject Property is handled by the
-City of Stevens Point Wastewater Treatment system.
-DRAFT 2/10/20126Project No. 113-810932.5Current Use of Adjoining Properties The adjoining property uses are described below:
 North - Agriculture and woodland. A rail line exists just north of these parcels.
+East - Agriculture and woodland.
-East -  Agriculture and woodland.
 South - Agriculture and woodland.
 West - Industrial Park. A Land's End Inlet occupies the adjoining parcel.
-DRAFT 2/10/20127Project No. 113-810933.0USER PROVIDED INFORMATIONThe ASTM Standard defines User as the party seeking to use Practice E 1527 to complete an ESA ofthe Subject Property. The ASTM Standard requires the User to provide certain information to theenvironmental professional. Golder has provided a User Questionnaire to SHINE Medial to facilitate the transfer of this information to Golder. Dawn Sovinec of SHINE Medical completed the User Questionnaire and provided it to Golder on December 21st, 2011. A copy of the completed User
+DRAFT
-Questionnaire is included in Appendix E. 3.1Environmental Cleanup LiensGolder representatives asked the User about their knowledge of environmental cleanup liens against the
-Subject Property that are filed or recorded under federal, tribal, state or local law. The User replied:
-User has no knowledge of environmental cleanup liens on the Subject Property.3.2Activity and Use LimitationsGolder representatives asked the User about their knowledge of activity and use limitations (AULs),such as engineering controls, land use restrictions or institutional controls that are in place on theSubject Property or have that been filed or recorded in a registry under federal, tribal, state or local law.
+/10/2012 7
+Project No. 113-81093 3.0 USER PROVIDED INFORMATION The ASTM Standard defines User as the party seeking to use Practice E 1527 to complete an ESA of the Subject Property. The ASTM Standard requires the User to provide certain information to the environmental professional. Golder has provided a User Questionnaire to SHINE Medial to facilitate the transfer of this information to Golder. Dawn Sovinec of SHINE Medical completed the User Questionnaire and provided it to Golder on December 21st, 2011. A copy of the completed User Questionnaire is included in Appendix E.
+.1 Environmental Cleanup Liens Golder representatives asked the User about their knowledge of environmental cleanup liens against the Subject Property that are filed or recorded under federal, tribal, state or local law. The User replied:
+User has no knowledge of environmental cleanup liens on the Subject Property.
+.2 Activity and Use Limitations Golder representatives asked the User about their knowledge of activity and use limitations (AULs),
+such as engineering controls, land use restrictions or institutional controls that are in place on the Subject Property or have that been filed or recorded in a registry under federal, tribal, state or local law.
 The User replied:
+User has no information regarding activity or land use limitations at the Subject Property.
-User has no information regarding activity or land use limitations at the Subject Property.3.3Relationship of the Purchase Price to the Fair Market ValueGolder representatives asked the User if the purchase price being paid for this property reasonably reflects the fair market value of the property. The User replied:
+.3 Relationship of the Purchase Price to the Fair Market Value Golder representatives asked the User if the purchase price being paid for this property reasonably reflects the fair market value of the property. The User replied:
+User believes the purchase price being paid for the Subject Property reasonably reflects the fair market value of the property.
-User believes the purchase price being paid for the Subject Property reasonably reflects the fair market value of the property. 3.4Commonly Known or Reasonably Ascertainable InformationGolder representatives asked the User if they were aware of commonly known or reasonably ascertainable information about the Subject Property that would assist the environmental professional inidentifying conditions indicative of releases or threatened releases. Golder representatives asked the following questions:
+.4 Commonly Known or Reasonably Ascertainable Information Golder representatives asked the User if they were aware of commonly known or reasonably ascertainable information about the Subject Property that would assist the environmental professional in identifying conditions indicative of releases or threatened releases. Golder representatives asked the following questions:
-a) Do you know the past uses of the Subject Property?  The User replied:
+a) Do you know the past uses of the Subject Property? The User replied:
+The User knows that the Subject Property has been used as an agricultural field and that selective tree harvesting/logging has occurred on the wooded portions of the parcel, and is being used for such purposes currently.
-The User knows that the Subject Property has been used as an agricultural field and that selective tree harvesting/logging has occurred on the wooded portions of the parcel, and is being used for such purposes currently.b) Do you know of specific chemicals that are present or once were present at the Subject Property?
+b) Do you know of specific chemicals that are present or once were present at the Subject Property?
 The User replied:
+The User has no information regarding specific chemicals that are, or once were, present at the Subject Property.
-The User has no information regarding specific chemicals that are, or once were, present at the Subject
+c) Do you know of spills or other chemical releases that have taken place at the Subject Property? The User replied:
-Property.c) Do you know of spills or other chemical releases that have taken place at the Subject Property?  The User replied:
 The User knows of no spills or other chemical releases that have taken place at the Subject Property.
-DRAFT 2/10/20128Project No. 113-81093d) Do you know of any environmental cleanups that have taken place at the Subject Property?  The User replied:
+DRAFT
-The User knows of no environmental cleanups that have taken place at the Subject Property. 3.5The Degree of Obviousness or the Presence of ContaminationGolder representatives asked the User if, based on User's knowledge and experience related to theSubject Property, there are any obvious indicators that point to the presence or likely presence of contamination at the Subject Property. The User replied:
-The User has no information regarding contamination on the Subject Property. 3.6Reason for Conducting ESAThe User indicated the ESA is being conducted as part of a property transfer and financing, to satisfy one of the conditions required for landowner liability protection (LLP) under CERCLA.
-DRAFT 2/10/20129Project No. 113-810934.0RECORDS REVIEW4.1Standard Environmental Records Sources, Federal and StateGolder retained Environmental Data Resources (EDR) to perform an environmental regulatory databasesearch of the general area of the Subject Property, which is presented in Appendix B. In accordance with the search requirements of ASTM E-1527-05 Standard, Golder representatives reviewed the federal and state regulatory agency records listed below to identify the use, generation, storage, treatment or disposal of hazardous substances or petroleum products, or release incidents of such materials that might impact the Subject Property. A summary of significant listings (Subject Property and adjacent properties with the potential to impact the Subject Property) presented in the environmentalregulatory database report is presented below. The following is a listing of databases reviewed during the Phase I ESA.
-Federal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance Federal NPL (National Priorities List)1.0 mileFederal delisted NPL site list0.5 mile Federal Comprehensive Environmental Response,
-Compensation and Liability Information System
-(CERCLIS) site list 0.5 mileFederal CERCLIS-No Further Remedial Action Planned (NFRAP) site list 0.5 mileFederal Resource Conservation and Recovery Act (RCRA) CORRACTS (Corrective Action Report) facilities list 1.0 mileFederal RCRA non-CORRACTS Treatment Storage and Disposal (TSD) facilities list 0.5 mileFederal RCRA Generators listSubject Property and adjoining properties Federal Institutional Control/Engineering Control Registries Subject Property Federal Emergency Response Notification System (ERNS) list Subject Property State and Tribal ASTM Standard DatabasesDatabaseApproximate Minimum Search Distance State and tribal hazardous waste sites identified
-for investigation or remediation: NPL - equivalent sites1.0 mileState and tribal hazardous waste sites identified for investigation or remediation: CERCLIS -
-equivalent sites 0.5 mileState and tribal landfill and/or solid waste disposal site list 0.5 mileState and tribal leaking storage tank lists0.5 mileState and tribal registered storage tank listsSubject Property and adjoining properties State and tribal Institutional Control/Engineering Control Registries Subject PropertyState and tribal voluntary cleanup sites0.5 mileState and tribal Brownfield sites0.5 mile4.1.1Subject Property Database Listing The Subject Property is not listed on any of the databases listed in the EDR database report.
-DRAFT 2/10/201210Project No. 113-810934.1.2Off-Site Properties Database ListingsNo off-site facilities were identified in the environmental database report that are considered potential environmental concerns to the Subject Property.4.1.3Orphans SummaryThirteen facilities listed in the EDR Report were shown as "orphan sites."  These are sites that are listedin environmental databases, but which EDR has been unable to locate with adequate precision to determine whether they are pertinent to the investigation at the Subject Property. Golder was able todetermine to a reasonable degree of certainty that these orphan sites were not listed on databases that indicated environmental impairment and/or were not within the specified database search distances. 4.1.4Other Agency Records No other agency records were reviewed for this Phase I ESA.4.2Additional Environmental Record SourcesGolder representatives did not review additional environmental record sources as part of this Phase I
-ESA.4.3Physical Setting Sources4.3.1Sources ReviewedThe USGS 7.5-minute Polonia, WI topographic map was reviewed in order to obtain information regarding the topographic, geologic, hydrogeologic, and hydrologic characteristics of the area of the Subject Property. In the sections below (4.3.2 through 4.3.4), topographic conditions are noted to the extent that they can be determined from review of topographic maps, or were visually and/or physically observed during the Site visit.4.3.2General Topographic Setting of the AreaBased on the site reconnaissance, the EDR Radius Map with GeoCheck and information provided onthe USGS Polonia, Wisconsin, 7.5 Minute Series Topographic Maps, the Subject Property is
-characterized by low topographic relief, lying approximately 1090 feet above mean sea level. 4.3.3Geologic and Hydrogeologic SettingGolder installed four groundwater monitoring wells at the Subject Property in December of 2011 (Figure 2). Based on Golder's 2012 Geotechnical and Hydrological Investigation of the site the soil conditions indicated by the boreholes is about one foot of topsoil and crop residue overlying a medium to coarsegrained, silty SAND nding to depths of 9 to 14 feet. Below this is a relatively clean, medium to coarsegrained, SAND with silt to the borehole termination depth of 31 feet. One borehole was advanced without sampling to a depth of 140 feet adjacent to SM-GW3A. This borehole was intended for a well installation into bedrock and bedrock was not encountered within 140 feet of the urface. Groundwater was encountered in all of the wells at elevations ranging from about 1096 to 1106 (about 8 to 11 feet below grade) as indicated in the table below. Groundwater levels should be expected to fluctuate
-seasonally and annually with changes in precipitation patterns.
-DRAFT 2/10/201211Project No. 113-810934.3.4Surface Water and Hydrologic SettingSurface water runoff in the vicinity of the Subject Property is to the southwest toward the Portage River and McDill Pond. The Portage River flows to the Mississippi River to the Southwest.4.4Historical Use Information on the Subject Property4.4.1Subject Property Historical Use SummaryLand adjacent in to the Subject Property has supported agriculture and forestry since at least 1938.
-Sometime between 1998 and 2005, a business park has developed to the west of the Subject Property.4.4.2Standard Historical Records4.4.2.1Aerial Photographs ReviewGolder representatives obtained historical aerial photographs from Historical Information Gatherers, Inc.for the years 2010, 2005, 1998, 1992, 1986, 1978, 1968, 1960, 1953, and 1938. Selected historicalaerial photographs are provided in Appendix C. The following table summarizes observations from the
-review of these aerial photographs.YearScaleDescription19381" = 500'The Subject Property and surrounding area is a mix of woodlands and argicultural land. A railroad appears to run east west approximately 700 feet north of the Subject Property.19531" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 photograph. 19601" = 500'The Subject Property and surround area appear relatively unchanged from the 1938 and 1953 photographs. 19681" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953 and 1960 photographs. 19781" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960 and 1968
-photographs.19861" = 800'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968 and 1978
-photographs.19921" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978 and 1986 photographs.19981" = 500'The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978, 1986
-and 1992 photographs. 20051' = 500'The Subjecr Property and surrounding area appear unchanged from the previous photographs except that the edge of a business park is visible just west of the Subject Property.20101" = 500'The Subject Property and surrounding area appears relatively unchanged from the 2005 photograph.4.4.2.2Sanborn Fire Insurance Map ReviewGolder representatives requested historical Sanborn&#xa9; Fire Insurance Maps from Environmental Data Resources, Inc. Golder was informed that Sanborn&#xa9; maps were not developed for the area surrounding
-the Subject Property. A copy of the "No Coverage" document is included in Appendix C.
+/10/2012 8
-DRAFT 2/10/201212Project No. 113-810934.4.2.3Property Tax Files Golder representatives obtained Subject Property Tax records for the County Parcel ID Nos:
+Project No. 113-81093 d) Do you know of any environmental cleanups that have taken place at the Subject Property? The User replied:
-Parcel ID Number 020-23-0801-02.06- Owner = Thomas Mocadlo and Margaret Jakusz
+The User knows of no environmental cleanups that have taken place at the Subject Property.
+.5 The Degree of Obviousness or the Presence of Contamination Golder representatives asked the User if, based on User's knowledge and experience related to the Subject Property, there are any obvious indicators that point to the presence or likely presence of contamination at the Subject Property. The User replied:
+The User has no information regarding contamination on the Subject Property.
+.6 Reason for Conducting ESA The User indicated the ESA is being conducted as part of a property transfer and financing, to satisfy one of the conditions required for landowner liability protection (LLP) under CERCLA.
+DRAFT
--23-0801-03.01- Owner = Thomas Mocadlo and Margaret Jakusz
+/10/2012 9
+Project No. 113-81093 4.0 RECORDS REVIEW 4.1 Standard Environmental Records Sources, Federal and State Golder retained Environmental Data Resources (EDR) to perform an environmental regulatory database search of the general area of the Subject Property, which is presented in Appendix B. In accordance with the search requirements of ASTM E-1527-05 Standard, Golder representatives reviewed the federal and state regulatory agency records listed below to identify the use, generation, storage, treatment or disposal of hazardous substances or petroleum products, or release incidents of such materials that might impact the Subject Property. A summary of significant listings (Subject Property and adjacent properties with the potential to impact the Subject Property) presented in the environmental regulatory database report is presented below. The following is a listing of databases reviewed during the Phase I ESA.
+Federal ASTM Standard Databases Database Approximate Minimum Search Distance Federal NPL (National Priorities List) 1.0 mile Federal delisted NPL site list 0.5 mile Federal Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) site list 0.5 mile Federal CERCLIS-No Further Remedial Action Planned (NFRAP) site list 0.5 mile Federal Resource Conservation and Recovery Act (RCRA) CORRACTS (Corrective Action Report) facilities list 1.0 mile Federal RCRA non-CORRACTS Treatment Storage and Disposal (TSD) facilities list 0.5 mile Federal RCRA Generators list Subject Property and adjoining properties Federal Institutional Control/Engineering Control Registries Subject Property Federal Emergency Response Notification System (ERNS) list Subject Property State and Tribal ASTM Standard Databases Database Approximate Minimum Search Distance State and tribal hazardous waste sites identified for investigation or remediation: NPL - equivalent sites 1.0 mile State and tribal hazardous waste sites identified for investigation or remediation: CERCLIS -
+equivalent sites 0.5 mile State and tribal landfill and/or solid waste disposal site list 0.5 mile State and tribal leaking storage tank lists 0.5 mile State and tribal registered storage tank lists Subject Property and adjoining properties State and tribal Institutional Control/Engineering Control Registries Subject Property State and tribal voluntary cleanup sites 0.5 mile State and tribal Brownfield sites 0.5 mile 4.1.1 Subject Property Database Listing The Subject Property is not listed on any of the databases listed in the EDR database report.
+DRAFT
--23-0801-02.02- Owner = Thomas J. and Sandra M. Mocadlo
+/10/2012 10 Project No. 113-81093 4.1.2 Off-Site Properties Database Listings No off-site facilities were identified in the environmental database report that are considered potential environmental concerns to the Subject Property.
+.1.3 Orphans Summary Thirteen facilities listed in the EDR Report were shown as "orphan sites." These are sites that are listed in environmental databases, but which EDR has been unable to locate with adequate precision to determine whether they are pertinent to the investigation at the Subject Property. Golder was able to determine to a reasonable degree of certainty that these orphan sites were not listed on databases that indicated environmental impairment and/or were not within the specified database search distances.
+.1.4 Other Agency Records No other agency records were reviewed for this Phase I ESA.
+.2 Additional Environmental Record Sources Golder representatives did not review additional environmental record sources as part of this Phase I ESA.
+.3 Physical Setting Sources 4.3.1 Sources Reviewed The USGS 7.5-minute Polonia, WI topographic map was reviewed in order to obtain information regarding the topographic, geologic, hydrogeologic, and hydrologic characteristics of the area of the Subject Property. In the sections below (4.3.2 through 4.3.4), topographic conditions are noted to the extent that they can be determined from review of topographic maps, or were visually and/or physically observed during the Site visit.
+.3.2 General Topographic Setting of the Area Based on the site reconnaissance, the EDR Radius Map with GeoCheck and information provided on the USGS Polonia, Wisconsin, 7.5 Minute Series Topographic Maps, the Subject Property is characterized by low topographic relief, lying approximately 1090 feet above mean sea level.
+.3.3 Geologic and Hydrogeologic Setting Golder installed four groundwater monitoring wells at the Subject Property in December of 2011 (Figure 2). Based on Golder's 2012 Geotechnical and Hydrological Investigation of the site the soil conditions indicated by the boreholes is about one foot of topsoil and crop residue overlying a medium to coarse grained, silty SAND nding to depths of 9 to 14 feet. Below this is a relatively clean, medium to coarse grained, SAND with silt to the borehole termination depth of 31 feet. One borehole was advanced without sampling to a depth of 140 feet adjacent to SM-GW3A. This borehole was intended for a well installation into bedrock and bedrock was not encountered within 140 feet of the urface. Groundwater was encountered in all of the wells at elevations ranging from about 1096 to 1106 (about 8 to 11 feet below grade) as indicated in the table below. Groundwater levels should be expected to fluctuate seasonally and annually with changes in precipitation patterns.
+DRAFT
--23-0801-01.04- Owner = Bernard Mocadlo
+/10/2012 11 Project No. 113-81093 4.3.4 Surface Water and Hydrologic Setting Surface water runoff in the vicinity of the Subject Property is to the southwest toward the Portage River and McDill Pond. The Portage River flows to the Mississippi River to the Southwest.
+.4 Historical Use Information on the Subject Property 4.4.1 Subject Property Historical Use Summary Land adjacent in to the Subject Property has supported agriculture and forestry since at least 1938.
+Sometime between 1998 and 2005, a business park has developed to the west of the Subject Property.
+.4.2 Standard Historical Records 4.4.2.1 Aerial Photographs Review Golder representatives obtained historical aerial photographs from Historical Information Gatherers, Inc.
+for the years 2010, 2005, 1998, 1992, 1986, 1978, 1968, 1960, 1953, and 1938. Selected historical aerial photographs are provided in Appendix C. The following table summarizes observations from the review of these aerial photographs.
+Year Scale Description 1938 1" = 500' The Subject Property and surrounding area is a mix of woodlands and argicultural land. A railroad appears to run east west approximately 700 feet north of the Subject Property.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938 photograph.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938 and 1953 photographs.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953 and 1960 photographs.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960 and 1968 photographs.
+1" = 800' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968 and 1978 photographs.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978 and 1986 photographs.
+1" = 500' The Subject Property and surround area appear relatively unchanged from the 1938, 1953, 1960, 1968, 1978, 1986 and 1992 photographs.
+1' = 500' The Subjecr Property and surrounding area appear unchanged from the previous photographs except that the edge of a business park is visible just west of the Subject Property.
+1" = 500' The Subject Property and surrounding area appears relatively unchanged from the 2005 photograph.
+.4.2.2 Sanborn Fire Insurance Map Review Golder representatives requested historical Sanborn&#xa9; Fire Insurance Maps from Environmental Data Resources, Inc. Golder was informed that Sanborn&#xa9; maps were not developed for the area surrounding the Subject Property. A copy of the "No Coverage" document is included in Appendix C.
+DRAFT
--23-0801-04.01- Owner = Bernard Mocadlo 020-23-0801-03.02- Owner = Blue Top Farms, Inc.
+/10/2012 12 Project No. 113-81093 4.4.2.3 Property Tax Files Golder representatives obtained Subject Property Tax records for the County Parcel ID Nos:
+Parcel ID Number 020-23-0801-02.06-Owner = Thomas Mocadlo and Margaret Jakusz 020-23-0801-03.01-Owner = Thomas Mocadlo and Margaret Jakusz 020-23-0801-02.02-Owner = Thomas J. and Sandra M. Mocadlo 020-23-0801-01.04-Owner = Bernard Mocadlo 020-23-0801-04.01-Owner = Bernard Mocadlo 020-23-0801-03.02-Owner = Blue Top Farms, Inc.
 -23-0801 Owner = Blue Top Farms, Inc.
+-23-0801 Owner = MS & S Enterprises Limited Partnership Copies and parcel maps are provided in Appendix A.
+The property tax records did not indicate records of past ownership, appraisals, maps, sketches, photos, or other information pertaining to the property.
+.4.2.4 Recorded Land Title Records Title documents were not obtained for this Phase I ESA.
+.4.2.5 Historical Topographic Map Review Golder representatives obtained historical USGS topographic quadrangle maps from Environmental Data Resources, Inc. for the years 1955, 1957, 1969, 1970, 1976, 1978, 1980, 1986, and 1991. Copies of the historical topographic maps are provided in Appendix C. The following paragraphs summarize our observations from the review of these historical topographic maps.
+Year Scale Description 1955 1:48000 A portion of the Subject Property is visible in the southwest corner of the topographic map. An elecric tranmission line runs near the southern boundary of the Subject Property.
+The Minneapolis, St. Paul and Sault Ste Marie Rail Line is visible north of the Subject Property.
+1:24000 The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.
+1:24000 The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.
+.4.2.6 Local Street Directories Local Street Directories from EDR were requested. The Subject Property address was not included in the city directory listing.
+.4.2.7 Building Department Records No building records pertaining to the Subject Property were available.
+.4.2.8 Zoning and Land Use Records Golder used the Portage County Geographic Information Systems (GIS) Map to review a property profile for the Subject Property. Information indicated that the Subject Property is zoned A1 for agricultural use.
+DRAFT
--23-0801 Owner = MS & S Enterprises Limited Partnership
+/10/2012 13 Project No. 113-81093 4.4.2.9 Other Historical Records No additional historical records were reviewed during this assessment.
+.5 Historical Use Information on Adjoining Properties The following is a summary of historical use information for adjacent properties based on information obtained from the Subject Property visit, a review of historical topographic maps and previous ESA reports for the Subject Property:
+The adjacent properties were all agricultural and woodland since at least 1938. The rail line present north of the Subject Property was operational since at least 1938 and has been operated by at least two railroads. An electrical transmission line has run near the southern boundary of the Subject Property since at least 1938. A business park was built west of the Subject Property some time between 1998 and 2005.
+DRAFT
-Copies and parcel maps are  provided in Appendix A.
+/10/2012 14 Project No. 113-81093 5.0 SITE RECONNAISSANCE Golder representative Alexandra A. Prasch performed a visual assessment of the Subject Property on December 15th, 2011 to identify potential sources of chemical and petroleum contamination. The Golder representative assessed surficial evidence of potential impacts such as waste or refuse dumping, distressed vegetation, stained soils, and/or stained paving. Photographs recorded during the site assessment are presented in Appendix D.
+.1 Methodology and Limiting Conditions The site reconnaissance was conducted during the period of December 15th - December 17th, 2011 by Alexandra Prasch, Environmental Technician with Golder Associates. Weather conditions at the time of the site reconnaissance were sunny, partly cloudy, and windy. The visual reconnaissance consisted of observing the boundaries of the property and systematically traversing the site to provide an overlapping field of view, wherever possible. Portions of the property and boundaries were inaccessible due to heavily wooded land and brush. Photographs of pertinent site features identified during the site reconnaissance are included in Appendix D.
+.2 General Site Setting The Subject Property consists of approximately 88.08 acres of farmland and forest with no buildings, utilities, or other developments. The ground surface at the site is level and slopes gently to the southwest. The Subject Property is accessed from a private road extending west from Burbank Road.
+.2.1 Current Use of the Subject Property Information about the current use of the Subject Property is detailed in section 2.3 of this report.
+.2.2 Past Use of the Subject Property The Subject Property has been used for agricultural and forestry purposes since 1938 or before. The use of the Subject Property prior to 1938 is unknown.
+.2.3 General Description of Structures No structures were observed on the Subject Property.
+.2.4 Roads There are no public roads through or leading to the Subject Property. A private access road extends to and through the Subject Property from Burbank Road.
+.2.5 Potable Water Supply Currently the Subject Property has no potable water supply.
+.2.6 Sewage Disposal System There is no sewage disposal system within the Subject Property.
+DRAFT
-The property tax records did not indicate records of past ownership, appraisals, maps, sketches, photos, or other information pertaining to the property. 4.4.2.4Recorded Land Title Records Title documents were not obtained for this Phase I ESA. 4.4.2.5Historical Topographic Map ReviewGolder representatives obtained historical USGS topographic quadrangle maps from EnvironmentalData Resources, Inc. for the years 1955, 1957, 1969, 1970, 1976, 1978, 1980, 1986, and 1991. Copies of the historical topographic maps are provided in Appendix C. The following paragraphs summarize our
+/10/2012 15 Project No. 113-81093 5.3 Interior and Exterior Observations Golder identified current or past uses likely to involve the use, treatment, storage, disposal or generation of hazardous substances or petroleum products, to the extent they were visually and/or physically observed during the Subject Property visit or identified from the interviews or the records review. The substances and approximate quantities, types of containers (if any) and storage conditions are discussed in the following subsections.
+.3.1 Storage Tanks Golder observed no evidence of underground or aboveground storage tanks at the Subject Property at the time of the site visit.
+.3.2 Odors Golder observed no unusual odors at the Subject Property at the time of the site visit.
+.3.3 Pools of Liquid Golder observed no pools of liquid at the Subject Property at the time of the site visit.
+.3.4 Drums Golder observed no drums at the Subject Property at the time of the site visit.
+.3.5 Hazardous Substance and Petroleum Product Containers Golder observed no hazardous substance or petroleum product containers at the Subject Property at the time of the site visit.
+.3.6 Unidentified Substance Containers Golder observed no unidentified substance containers at the Subject Property at the time of the site visit.
+.3.7 Evidence of Polychlorinated Biphenyls Golder observed no evidence of polychlorinated biphenyls.
+.3.8 Heating/Conditioning The Subject Property is undeveloped. No heating or air conditioning systems were present.
+.3.9 Stains or Corrosion Golder observed no evidence of stains or corrosion at the Subject Property at the time of the site visit.
+.3.10 Drains and Sumps Golder observed no drains or sumps on the Subject Property at the time of the site visit.
+DRAFT
-observations from the review of these historical topographic maps.YearScaleDescription19551:48000A portion of the Subject Property is visible in the southwest corner of the topographic map. An elecric tranmission line
+/10/2012 16 Project No. 113-81093 5.3.11 Pits, Ponds, or Lagoons Golder observed no pits, ponds, or lagoons on the Subject Property at the time of the site visit.
+.3.12 Stained Soil or Pavements Golder observed no stained soil or pavements at the Subject Property at the time of the site visit.
+.3.13 Stressed Vegetation Golder observed no stressed vegetation at the Subject Property at the time of the site visit.
+.3.14 Solid Waste Disposal No readily apparent evidence of solid waste dumping, suspect fill material, or landfills was identified on the Subject Property during the site reconnaissance.
+.3.15 Waste Water Golder observed no evidence that industrial waste water is generated or discharged from the Subject Property at the time of the site visit.
+.3.16 Wells Golder observed no evidence of wells at the Subject Property at the time of the site visit.
+.3.17 Septic Systems Golder observed no evidence of septic systems at the Subject Property at the time of the site visit.
+.3.18 Other Interior and Exterior Observations Golder made no other interior or exterior observations of the Subject Property during the site visit.
+.4 Off-Site Conditions The following two sections discuss the off-site observations, to the extent that the current uses of the adjoining properties were observable during the Subject Property reconnaissance, and were likely to indicate an REC in connection with the adjoining properties or the Subject Property.
+.4.1 Adjoining Properties Golder did not observe any evidence of RECs on adjoining properties from the Subject Property during the site visit.
+.4.2 Other Surrounding Properties The adjacent properties were observed to be a business park, forested land and agricultural land during the site visit. There were no indications of RECs noted on other surrounding properties during the site visit.
+DRAFT
-runs near the southern boundary of the Subject Property.
+/10/2012 17 Project No. 113-81093 6.0 INTERVIEWS 6.1 Overview During the completion of this Phase I ESA, available individuals were interviewed with knowledge of current or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. Information provided is summarized throughout the text of the report and in the following sections.
+.2 Interview with Owners, Past Owners, Past Operators and Past Occupants Golder interviewed the owners identified in section 4.4.2.3 of the report. Interviews were conducted via telephone call. Phase I ESA Interview forms summarizing the interviews are available for review in the Golder file.
+Thomas Mocadlo, owner of parcels 020-23-081-02.02, 020-23-081-02.06 and 020-23-801-03.01, indicated that he purchased the property around 1985 for the purpose of hunting and gathering firewood. His brother Bernard owns other parcels that are part of the Subject Property. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.
+Bernard Mocadlo, owner of parcels 020-23-0801-04.01 and 020-23-1.04, indicated that he has owned the property for 54 years and farmed the property for 30 years. The land has been used for potato, sweet corn, pea and vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.
+Curt Soik, owner of parcel 030-230-0801-1.13, indicated that he purchased his parcel in 1962 from a farmer. His parcel has been used for growing of corn and other vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.
+Peter Zakrzewski, President of Blue Top Farms and owner of parcels 030-230-801.14 and 020-230-801-03.02, indicated that he is the son of the original owner (J. James Zakrzewski). His father purchased the property 30 years ago. Peter has been the Vice President of Blue Top Farms for the last 10 years. The property has been used for corn, green bean, soy bean and potato crops. He rented a portion of the parcels he owns to a potato farmer in the past. He believed liquid manure was handled in the southwest corner of the parcels he owns in the past, but has not been used in the last two years. He indicated that pesticides and herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. He does maintain a private shooting range on the parcels that he owns. He uses the shooting range no more than a few times a year.
+.3 Interview with Site Manager Golder did not interview a Site Manager for the Phase I ESA.
+.4 Interview with Occupants Golder did not interview Occupants for the Phase I ESA.
+DRAFT
-The Minneapolis, St. Paul and Sault Ste Marie Rail Line is
+/10/2012 18 Project No. 113-81093 6.5 Interview with Local Government Officials Golder did not interview Local Government Officials for the Phase I ESA.
+.6 Interviews with Others Golder did not interview Others for the Phase I ESA.
+DRAFT
-visible north of the Subject Property.19691:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.19861:24000The Subject Property is entirely visible on this map. The map appears similar ot the 1955 map.4.4.2.6Local Street DirectoriesLocal Street Directories from EDR were requested. The Subject Property address was not included in the city directory listing.4.4.2.7Building Department Records No building records pertaining to the Subject Property were available.4.4.2.8Zoning and Land Use RecordsGolder used the Portage County Geographic Information Systems (GIS) Map to review a property profile for the Subject Property. Information indicated that the Subject Property is zoned A1 for agricultural use.
+/10/2012 19 Project No. 113-81093 7.0 DISCUSSION This section identifies the known or suspect RECs, historical RECs, and de minimis conditions identified during the assessment.
-DRAFT 2/10/201213Project No. 113-810934.4.2.9Other Historical Records No additional historical records were reviewed during this assessment. 4.5Historical Use Information on Adjoining PropertiesThe following is a summary of historical use information for adjacent properties based on informationobtained from the Subject Property visit, a review of historical topographic maps and previous ESA
+.1 Findings and Opinions 7.1.1 Recognized Environmental Conditions No Recognized Environmental Conditions were identified during this assessment.
+.1.2 Historical Recognized Environmental Conditions An HREC is an environmental condition which, in the past, would have been considered a REC, but which may or may not be considered a REC currently. Golder's rationale for considering these environmental conditions as HRECs is based solely on the information stated herein. Designation as an HREC however, does not preclude the potential for the condition to affect the Subject Property.
+No Historical Recognized Environmental Conditions were identified during this assessment.
+.1.3 De Minimis Conditions De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
+FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.
+OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.
+.2 Additional Investigation No additional investigation is indicated based on the information gathered during this assessment.
+.3 Data Gaps A Data Failure occurs when all of the standard historical sources that are reasonably ascertainable and likely to be useful have been reviewed and yet the objectives have not been met. Some Data Failures may comprise Data Gaps. A Data Gap is defined as the lack of or inability to obtain information required by the ASTM Standard despite good faith efforts by the EP to gather such information. A significant data gap occurs when a data gap impacts the ability of the EP to identify RECs.
+Golder representatives did not identify significant data gaps during this assessment.
+DRAFT
-reports for the Subject Property:
+/10/2012 20 Project No. 113-81093
-The adjacent properties were all agricultural and woodland since at least 1938. The rail line presentnorth of the Subject Property was operational since at least 1938 and has been operated by at least two railroads. An electrical transmission line has run near the southern boundary of the Subject Property since at least 1938. A business park was built west of the Subject Property some time between 1998 and 2005.
+==8.0 CONCLUSION==
-DRAFT 2/10/201214Project No. 113-810935.0SITE RECONNAISSANCEGolder representative Alexandra A. Prasch performed a visual assessment of the Subject Propertyon December 15th, 2011 to identify potential sources of chemical and petroleum contamination. The Golder representative assessed surficial evidence of potential impacts such as waste or refuse dumping, distressed vegetation, stained soils, and/or stained paving. Photographs recorded during the site
+S Golder performed a Phase I ESA of the property located at T23N, R8W, Section 1, Stevens Point, WI in conformance with the scope and limitations of the ASTM Standard. Any exceptions to, or deletions from, the ASTM Standard are described in the appropriate sections of this Report. This assessment has revealed no evidence of RECs in connection with the Subject Property except:
+Golder identified the following de minimis conditions, at the Subject Property:
+FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.
+OPINION: The use of pesticides and herbicides on the Subject Property generally does not present a threat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and herbicides is a de minimis condition.
+De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
+DRAFT
-assessment are presented in Appendix D.5.1Methodology and Limiting ConditionsThe site reconnaissance was conducted during the period of December 15th - December 17th, 2011 by Alexandra Prasch, Environmental Technician with Golder Associates. Weather conditions at the time of the site reconnaissance were sunny, partly cloudy, and windy. The visual reconnaissance consisted of observing the boundaries of the property and systematically traversing the site to provide an overlapping field of view, wherever possible. Portions of the property and boundaries were inaccessible due to heavily wooded land and brush. Photographs of pertinent site features identified during the site
+/10/2012 21 Project No. 113-81093 9.0 QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALS Alexandra Prasch, Geologist in Training, Level 1 Environmental Technician with 2 years of professional experience, conducted the site visit. Kathryn Larson, Senior Project Geologist with 15 years of experience, prepared this Report, and Amy Thorson, Senior Engineer with 20 years of professional experience, served as the senior reviewer of the Report. Resumes for members of the project team are included in Appendix F.
+"We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental Professional as defined in Section 312.10 of 40 CFR Part 312.
+We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject Property. We have developed and performed the all appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312."
+GOLDER ASSOCIATES INC.
+DRAFT
-reconnaissance are included in Appendix D. 5.2General Site SettingThe Subject Property consists of approximately 88.08 acres of farmland and forest with no buildings, utilities, or other developments. The ground surface at the site is level and slopes gently to the southwest. The Subject Property is accessed from a private road extending west from Burbank Road.5.2.1Current Use of the Subject Property Information about the current use of the Subject Property is detailed in section 2.3 of this report. 5.2.2Past Use of the Subject PropertyThe Subject Property has been used for agricultural and forestry purposes since 1938 or before. The
+/10/2012 22 Project No. 113-81093
-use of the Subject Property prior to 1938 is unknown. 5.2.3General Description of Structures No structures were observed on the Subject Property.5.2.4RoadsThere are no public roads through or leading to the Subject Property. A private access road extends to
+==10.0 REFERENCES==
+The Report's author annotated the reference sources relied upon in preparing the Phase I ESA in the relevant sections of this Report.
+DRAFT
-and through the Subject Property from Burbank Road.5.2.5Potable Water Supply Currently the Subject Property has no potable water supply. 5.2.6Sewage Disposal System There is no sewage disposal system within the Subject Property.
+List of Figures DRAFT
-DRAFT 2/10/201215Project No. 113-810935.3Interior and Exterior ObservationsGolder identified current or past uses likely to involve the use, treatment, storage, disposal or generationof hazardous substances or petroleum products, to the extent they were visually and/or physicallyobserved during the Subject Property visit or identified from the interviews or the records review. The substances and approximate quantities, types of containers (if any) and storage conditions are
-discussed in the following subsections.5.3.1Storage TanksGolder observed no evidence of underground or aboveground storage tanks at the Subject Property at
+SCALE 0
+1
+MILES CHECK REVIEW DESIGN CADD SCALE FILE No.
+PROJECT No.
+TITLE AS SHOWN REV.
+J:\\2011 Jobs\\113-81093 SHINE Steven's Point WI\\CAD\\VICINITY_MAP_WI.dwg l 1/11/2012 10:58 AM l AGarrigus l STEVENS POINT 1
+APG 1/11/12 MTK 1/11/12 AT 1/11/12 0
+FIG.
+-81051 VICINITY_MAP_WI.dwg SMT / STEVENS POINT / AK VICINITY MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN REFERENCE TOPOGRAPHIC MAP PROVIDED BY WISCONSIN DNR.
+PROJECT LOCATION PROJECT LOCATION DRAFT
-the time of the site visit.5.3.2Odors Golder observed no unusual odors at the Subject Property at the time of the site visit. 5.3.3Pools of Liquid Golder observed no pools of liquid at the Subject Property at the time of the site visit.5.3.4Drums Golder observed no drums at the Subject Property at the time of the site visit. 5.3.5Hazardous Substance and Petroleum Product Containers Golder observed no hazardous substance or petroleum product containers at the Subject Property at the
+' 162' 66' 100' 60' 66' 66' 66' 2308-01-2101-01 2308-01-2201-01 4.26 AC.
+AC.
+AC.
+.4 AC.
+.61 AC.
+S88&deg;58'06"E 1,868' 1,868' N01&deg;01'45"W 1,868' 1,868' TRANSMISSION LINE 1,000'R 1,000'R 80' FUTURE STREET 100' FUTURE STREET S88&deg;58'06"E TRANSIT FACILITY 21 AC.
+AC.
+AC.
+.2 AC.
+AC.
+.4 AC.
+.1 AC.
+.52 AC.
+.93 AC.
+.7 AC.
+.23 AC.
+.33 AC.
+.34 AC.
+.5 AC.
+.23 AC.
+.69 AC.
+' 700' 700' 0.4 AC.
+.43 AC.
+.1 AC.
+.5 AC.
+'-3" 316'-3" SM-GW1A SM-GW2A SM-GW3A SM-GW4A 1.) LOCATION OF POTENTIAL LOCATION FOR SHINE MEDICAL FACILITY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
+.) AERIAL IMAGERY PROVIDED BY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
+REFERENCES
+\\\\anc1-s-fs2-vm\\Jobs_In_Progress\\2011 Jobs\\113-81093 SHINE Steven's Point WI\\CAD\\Proposed_building_layout_SP.dwg l 1/11/2012 11:01 AM l AGarrigus l STEVENS POINT SCALE 0
+FEET 100O 100O 2
+APG 1/11/12 MTK 1/11/12 AT 1/11/12 1
+FIG.
+-81051 Proposed_building_layout_SP.dwg SMT / STEVENS POINT / AK SITE MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN CHECK REVIEW DESIGN CADD SCALE FILE No.
+PROJECT No.
+TITLE AS SHOWN REV.
+PROPOSED BUILDING OUTLINE PROPOSED BUILDING AREA INTERSTATE HIGHWAY 39 PROPOSED PROPERTY BOUNDARY 1.) NORTHINGS AND EASTINGS PROVIDED IN NAD_1983_HARN_WISCRS_PORTAGE_COUNTY_FEET NOTES DRAFT
-time of the site visit. 5.3.6Unidentified Substance Containers Golder observed no unidentified substance containers at the Subject Property at the time of the site visit. 5.3.7Evidence of Polychlorinated Biphenyls Golder observed no evidence of polychlorinated biphenyls.5.3.8Heating/Conditioning The Subject Property is undeveloped. No heating or air conditioning systems were present. 5.3.9Stains or Corrosion Golder observed no evidence of stains or corrosion at the Subject Property at the time of the site visit.5.3.10Drains and Sumps Golder observed no drains or sumps on the Subject Property at the time of the site visit.
+Appendix A Legal Description of the Subject Property/
-DRAFT 2/10/201216Project No. 113-810935.3.11Pits, Ponds, or Lagoons Golder observed no pits, ponds, or lagoons on the Subject Property at the time of the site visit.5.3.12Stained Soil or Pavements Golder observed no stained soil or pavements at the Subject Property at the time of the site visit.5.3.13Stressed Vegetation Golder observed no stressed vegetation at the Subject Property at the time of the site visit.5.3.14Solid Waste DisposalNo readily apparent evidence of solid waste dumping, suspect fill material, or landfills was identified on the Subject Property during the site reconnaissance.5.3.15Waste WaterGolder observed no evidence that industrial waste water is generated or discharged from the Subject
+Chain of Title Report DRAFT
-Property at the time of the site visit. 5.3.16Wells Golder observed no evidence of wells at the Subject Property at the time of the site visit.5.3.17Septic Systems Golder observed no evidence of septic systems at the Subject Property at the time of the site visit.5.3.18Other Interior and Exterior Observations Golder made no other interior or exterior observations of the Subject Property during the site visit.5.4Off-Site ConditionsThe following two sections discuss the off-site observations, to the extent that the current uses of the adjoining properties were observable during the Subject Property reconnaissance, and were likely to
+DRAFT RFI RESPONSE FORM PM-001, Revision 2 RFI NO.: GOLDER-2011-RFI Revision: 0 0051 Due Date: 12/16/2011 Sheet 1 of 3 RFI RESPONSE:
+The following table is the legal parcels description for the Stevens Point property:
+Parcel Township Owner(s)
+Approximate Identification Acreage Number 020-23-0801-02.06 Town of Hull 7.2 020-23-0801-03.01 Town of Hull 19.92
+. 020-23-0801-02.02 Town of Hull 6.6 020-23-0801-01.04 Town of Hull 25.23 020-23-0801-04.01 020-23-0801-03.02 Town of Hull 19.93 030-23-0801-1 4 Town of Plover 5.5 030-23-0801-13 Town of Plover 3.7 Total Combined 88.08 Parcel Acreage Please also find Phase 1 ESA User Questionnaire responses on pages 2 and 3 of the RFI response.
+Responder: ______________ _
+Company: SHINE Medical Independent Reviewer (for Design Input)---------------
+Responder's Management:
+SHINE Licensing:
+Originator Acceptance:
+/28/2011 X
+------~------------
+Date: 12.21.11 Phone No.: ----------1 Date:
+------------------------~
+Date: ------------------1
-indicate an REC in connection with the adjoining properties or the Subject Property.5.4.1Adjoining PropertiesGolder did not observe any evidence of RECs on adjoining properties from the Subject Property during
+My Map 020230801-01.04 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:26:25 PM.
+DRAFT Bernard J Mocadlo 5823 Old Highway 18 Stevens Point, WI 54482
-the site visit.5.4.2Other Surrounding PropertiesTheadjacent properties were observed to be a business park, forested land and agricultural land duringthe site visit. There were no indications of RECs noted on other surrounding properties during the site visit. DRAFT 2/10/201217Project No. 113-810936.0INTERVIEWS6.1OverviewDuring the completion of this Phase I ESA, available individuals were interviewed with knowledge ofcurrent or historical use, storage, or disposal of potentially hazardous materials or other environmentally related activities on or adjacent to the Subject Property. Information provided is summarized throughout
+My Map 020230801-02.02 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:40:03 PM.
+DRAFT
-the text of the report and in the following sections.6.2Interview with Owners, Past Owners, Past Operators and Past OccupantsGolder interviewed the owners identified in section 4.4.2.3 of the report. Interviews were conducted via telephone call. Phase I ESA Interview forms summarizing the interviews are available for review in the
+My Map 020230801-02.06 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:42:58 PM.
+DRAFT
-Golder file.
+My Map 020230801-03.01 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:15:59 PM.
+DRAFT Jakusz Margaret A Etal Mocadlo Thomas, J 5931 Old Highway 18 Stevens Point, WI
-Thomas Mocadlo, owner of parcels 020-23-081-02.02, 020-23-081-02.06 and 020-23-801-03.01, indicated that he purchased the property around 1985 for the purpose of hunting and gatheringfirewood. His brother Bernard owns other parcels that are part of the Subject Property. He was notaware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject
+My Map 020-23-0801-03.02 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:30:47 PM.
+DRAFT Emmerich Hakrzewski Bluetop Farms Inc 5613 County Road HH Stevens Point, WI
-Property, but they have not been stored on the Subject Property.
+My Map 020230801-04.01 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:28:50 PM.
+DRAFT Bernard J Mocadlo 5823 Old Highway 18 Stevens Point, WI 54482
-Bernard Mocadlo, owner of parcels 020-23-0801-04.01 and 020-23-1.04, indicated that he has ownedthe property for 54 years and farmed the property for 30 years. The land has been used for potato,sweet corn, pea and vegetable crops. He was not aware of any solid or liquid wastes that have beenhandled or disposed of on the Subject Property. He indicated that small amounts of pesticides or herbicides have been used in the past on the Subject Property, but they have not been stored on the
+My Map 030-23-0801-13 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:34:11 PM.
+DRAFT M S & S Enterprises 6213 County Road HH Stevens Point, WI 54482
-Subject Property.
+My Map 030-23-0801-14 This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:32:31 PM.
+DRAFT Blue Top Farms Inc.
+County Road HH Stevens Point, WI 54482
-Curt Soik, owner of parcel 030-230-0801-1.13, indicated that he purchased his parcel in 1962 from a farmer. His parcel has been used for growing of corn and other vegetable crops. He was not aware of any solid or liquid wastes that have been handled or disposed of on the Subject Property. He indicatedthat small amounts of pesticides have been used in the past on the Subject Property, but they have not been stored on the Subject Property.
+Appendix B Federal and State Regulatory Database Search DRAFT
-Peter Zakrzewski, President of Blue Top Farms and owner of parcels 030-230-801.14 and 020-230-801-03.02, indicated that he is the son of the original owner (J. James Zakrzewski). His father purchased the property 30 years ago. Peter has been the Vice President of Blue Top Farms for the last 10 years. The property has been used for corn, green bean, soy bean and potato crops. He rented aportion of the parcels he owns to a potato farmer in the past. He believed liquid manure was handled in the southwest corner of the parcels he owns in the past, but has not been used in the last two years. He indicated that pesticides and herbicides have been used in the past on the Subject Property, but they have not been stored on the Subject Property. He does maintain a private shooting range on the
+FORM-BPK-SPM
-parcels that he owns. He uses the shooting range no more than a few times a year. 6.3Interview with Site Manager Golder did not interview a Site Manager for the Phase I ESA.6.4Interview with Occupants Golder did not interview Occupants for the Phase I ESA.
+k c
-DRAFT 2/10/201218Project No. 113-810936.5Interview with Local Government Officials Golder did not interview Local Government Officials for the Phase I ESA.6.6Interviews with Others Golder did not interview Others for the Phase I ESA.
+e h
-DRAFT 2/10/201219Project No. 113-810937.0DISCUSSIONThis section identifies the known or suspect RECs, historical RECs, and de minimis conditions identified during the assessment.7.1Findings and Opinions7.1.1Recognized Environmental Conditions No Recognized Environmental Conditions were identified during this assessment.7.1.2Historical Recognized Environmental ConditionsAn HREC is an environmental condition which, in the past, would have been considered a REC, butwhich may or may not be considered a REC currently. Golder's rationale for considering these environmental conditions as HRECs is based solely on the information stated herein. Designation as an
+C o
+e G
+h ti w
+tr o
+p e
+R p
+a M
+s u
+i d
+a R
+R D
+E e
+h T
+Wheelers Farms Road Milford, CT 06461 Toll Free: 800.352.0050 www.edrnet.com SHINE Medical Stevens Point, WI Lands End Way, Stevens Point, WI 54482 Inquiry Number: 3220399.2s December 07, 2011 DRAFT
-HREC however, does not preclude the potential for the condition to affect the Subject Property.
+SECTION PAGE Executive Summary ES1 Overview Map 2
-No Historical Recognized Environmental Conditions were identified during this assessment. 7.1.3De Minimis ConditionsDe minimis conditions are not recognized environmental conditions. De minimis conditions generally donot present a threat to human health or the environment and generally would not be the subject of an enforcement action if brought to the attention of appropriate governmental agencies.
+Detail Map 3
+Map Findings Summary 4
+Map Findings 7
+Orphan Summary 8
+Government Records Searched/Data Currency Tracking GR-1 GEOCHECK ADDENDUM Physical Setting Source Addendum A-1 Physical Setting Source Summary A-2 Physical Setting SSURGO Soil Map A-5 Physical Setting Source Map A-9 Physical Setting Source Map Findings A-11 Physical Setting Source Records Searched A-30 TC3220399.2s Page 1 Thank you for your business.
+Please contact EDR at 1-800-352-0050 with any questions or comments.
+Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmental Data Resources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties does not exist from other sources. NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION, MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE, ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL, CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT. Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intended to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any property. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental risk for any property. Additionally, the information provided in this Report is not to be construed as legal advice.
+Copyright 2011 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission.
+EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. All other trademarks used herein are the property of their respective owners.
+TABLE OF CONTENTS DRAFT
-FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural and forestry activities. There is no evidence that pesticides and herbicides are stored or have been stored
+EXECUTIVE
-on the Subject Property in the past.
+==SUMMARY==
+TC3220399.2s EXECUTIVE
-OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcementaction if brought to the attention of appropriate governmental agencies. The use of pesticides and
+==SUMMARY==
+A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).
+The report was designed to assist parties seeking to meet the search requirements of EPAs Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-05) or custom requirements developed for the evaluation of environmental risk associated with a parcel of real estate.
+TARGET PROPERTY INFORMATION ADDRESS LANDS END WAY, STEVENS POINT, WI 54482 COORDINATES 44.507000 - 44 30 25.2 Latitude (North):
+.495900 - 89 29 45.2 Longitude (West):
+Zone 16 Universal Tranverse Mercator:
+.3 UTM X (Meters):
+4931000.0 UTM Y (Meters):
+ft. above sea level Elevation:
+USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 44089-E4 POLONIA, WI Target Property Map:
+Most Recent Revision:
+-D4 ARNOTT, WI South Map:
+Most Recent Revision:
+-D5 WHITING, WI Southwest Map:
+Most Recent Revision:
+-E5 STEVENS POINT, WI West Map:
+Most Recent Revision:
+AERIAL PHOTOGRAPHY IN THIS REPORT 2010 Photo Year:
+USDA Source:
+TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR.
+DRAFT
-herbicides is a de minimis condition. 7.2Additional Investigation No additional investigation is indicated based on the information gathered during this assessment.7.3Data GapsA Data Failure occurs when all of the standard historical sources that are reasonably ascertainable and likely to be useful have been reviewed and yet the objectives have not been met. Some Data Failures may comprise Data Gaps. A Data Gap is defined as the lack of or inability to obtain information requiredby the ASTM Standard despite good faith efforts by the EP to gather such information. A significant data gap occurs when a data gap impacts the ability of the EP to identify RECs.
+EXECUTIVE
-Golder representatives did not identify significant data gaps during this assessment.
+==SUMMARY==
-DRAFT 2/10/201220Project No. 113-8109
+TC3220399.2s EXECUTIVE
-==38.0CONCLUSION==
+==SUMMARY==
-SGolder performed a Phase I ESA of the property located at T23N, R8W, Section 1, Stevens Point, WI inconformancewith the scope and limitations of the ASTM Standard. Any exceptions to, or deletions from,the ASTM Standard are described in the appropriate sections of this Report. This assessment has
+DATABASES WITH NO MAPPED SITES No mapped sites were found in EDRs search of available ("reasonably ascertainable ") government records either on the target property or within the search radius around the target property for the following databases:
+STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL National Priority List Proposed NPL Proposed National Priority List Sites NPL LIENS Federal Superfund Liens Federal Delisted NPL site list Delisted NPL National Priority List Deletions Federal CERCLIS list CERCLIS Comprehensive Environmental Response, Compensation, and Liability Information System FEDERAL FACILITY Federal Facility Site Information listing Federal CERCLIS NFRAP site List CERC-NFRAP CERCLIS No Further Remedial Action Planned Federal RCRA CORRACTS facilities list CORRACTS Corrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDF RCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-LQG RCRA - Large Quantity Generators RCRA-SQG RCRA - Small Quantity Generators RCRA-CESQG RCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries US ENG CONTROLS Engineering Controls Sites List US INST CONTROL Sites with Institutional Controls Federal ERNS list ERNS Emergency Response Notification System State-and tribal - equivalent CERCLIS SHWS Hazard Ranking List DRAFT
-revealed no evidence of RECs in connection with the Subject Property except:
+EXECUTIVE
-Golder identified the following de minimis conditions, at the Subject Property:FINDING: Pesticides and herbicides have been used on the Subject Property for agricultural andforestry activities. There is no evidence that pesticides and herbicides are stored or have been stored on the Subject Property in the past.OPINION: The use of pesticides and herbicides on the Subject Property generally does not present athreat to human health or the environmental and generally would not be the subject of enforcement action if brought to the attention of appropriate governmental agencies. The use of pesticides and
+==SUMMARY==
+TC3220399.2s EXECUTIVE
-herbicides is a de minimis condition.
+==SUMMARY==
-De minimis conditions are not recognized environmental conditions. De minimis conditions generally do not present a threat to human health or the environment and generally would not be the subject of an
+State and tribal landfill and/or solid waste disposal site lists SWF/LF List of Licensed Landfills WDS Registry of Waste Disposal Sites SHWIMS Solid & Hazardous Waste Information Management System State and tribal leaking storage tank lists LUST Leaking Underground Storage Tank Database LAST Leaking Aboveground Storage Tank Listing INDIAN LUST Leaking Underground Storage Tanks on Indian Land State and tribal registered storage tank lists UST Registered Underground Storage Tanks AST Tanks Database INDIAN UST Underground Storage Tanks on Indian Land FEMA UST Underground Storage Tank Listing State and tribal institutional control / engineering control registries CRS Closed Remediation Sites AUL Deed Restriction at Closeout Sites State and tribal voluntary cleanup sites VCP Voluntary Party Liability Exemption Sites INDIAN VCP Voluntary Cleanup Priority Listing State and tribal Brownfields sites BEAP Brownfields Environmental Assessment Program BROWNFIELDS Brownfields Site Locations Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS A Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites DEBRIS REGION 9 Torres Martinez Reservation Illegal Dump Site Locations ODI Open Dump Inventory SWRCY Recycling Center Listing INDIAN ODI Report on the Status of Open Dumps on Indian Lands Local Lists of Hazardous waste / Contaminated Sites US CDL Clandestine Drug Labs WI ERP Environmental Repair Program Database CDL Clandestine Drug Lab Listing US HIST CDL National Clandestine Laboratory Register DRAFT
-enforcement action if brought to the attention of appropriate governmental agencies.
+EXECUTIVE
-DRAFT 2/10/201221Project No. 113-810939.0QUALIFICATIONS AND SIGNATURES OF ENVIRONMENTAL PROFESSIONALSAlexandra Prasch, Geologist in Training, Level 1 Environmental Technician with 2 years of professionalexperience, conducted the site visit. Kathryn Larson, Senior Project Geologist with 15 years of experience, prepared this Report, and Amy Thorson, Senior Engineer with 20 years of professional experience, served as the senior reviewer of the Report. Resumes for members of the project team are
-included in Appendix F.
+==SUMMARY==
+TC3220399.2s EXECUTIVE
-"We declare that, to the best of our professional knowledge and belief, we meet the definition of Environmental Professional as defined in Section 312.10 of 40 CFR Part 312.
+==SUMMARY==
+Local Land Records LIENS 2 CERCLA Lien Information LUCIS Land Use Control Information System Records of Emergency Release Reports HMIRS Hazardous Materials Information Reporting System SPILLS Spills Database AGSPILLS Agricultural Spill Cases Other Ascertainable Records RCRA-NonGen RCRA - Non Generators DOT OPS Incident and Accident Data DOD Department of Defense Sites FUDS Formerly Used Defense Sites CONSENT Superfund (CERCLA) Consent Decrees ROD Records Of Decision UMTRA Uranium Mill Tailings Sites MINES Mines Master Index File TRIS Toxic Chemical Release Inventory System TSCA Toxic Substances Control Act FTTS FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act)
+HIST FTTS FIFRA/TSCA Tracking System Administrative Case Listing SSTS Section 7 Tracking Systems ICIS Integrated Compliance Information System PADS PCB Activity Database System MLTS Material Licensing Tracking System RADINFO Radiation Information Database FINDS Facility Index System/Facility Registry System RAATS RCRA Administrative Action Tracking System BRRTS Bureau of Remediation & Redevelopment Tracking System NPDES NPDES Permit Listing MANIFEST Hazardous Waste Manifest Data DRYCLEANERS Five Star Recognition Program Sites WI WRRSER Wisconsin Remedial Response Site Evaluation Report AIRS Air Permit Program Listing TIER 2 Tier 2 Facility Listing LEAD Lead Inspection Data INDIAN RESERV Indian Reservations SCRD DRYCLEANERS State Coalition for Remediation of Drycleaners Listing COAL ASH EPA Coal Combustion Residues Surface Impoundments List FINANCIAL ASSURANCE Financial Assurance Information Listing COAL ASH Coal Ash Disposal Site Listing PCB TRANSFORMER PCB Transformer Registration Database COAL ASH DOE Sleam-Electric Plan Operation Data EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas Plants EDR Proprietary Manufactured Gas Plants DRAFT
-We have the specific qualifications based on education, training, and experience to assess a property of the nature, history, and setting of the Subject Property. We have developed and performed the all
+EXECUTIVE
-appropriate inquiries in conformance with the standards and practices set forth in 40 CFR Part 312."
+==SUMMARY==
+TC3220399.2s EXECUTIVE
-GOLDER ASSOCIATES INC.
+==SUMMARY==
-DRAFT 2/10/201222Project No. 113-81093
+SURROUNDING SITES: SEARCH RESULTS Surrounding sites were not identified.
+Unmappable (orphan) sites are not considered in the foregoing analysis.
+DRAFT
-==10.0REFERENCES==
+EXECUTIVE
-The Report's author annotated the reference sources relied upon in preparing the Phase I ESA in the relevant sections of this Report.
-DRAFT List of Figures DRAFT SCALE011MILESCHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.
-TITLEAS SHOWNREV.J:\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\VICINITY_MAP_WI.dwg l 1/11/2012 10:58 AM l AGarrigus l STEVENS POINT 1--------APG1/11/12MTK1/11/12AT1/11/12 0----FIG.113-81051 VICINITY_MAP_WI.dwg SMT / STEVENS POINT / AK VICINITY MAP SHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN REFERENCE TOPOGRAPHIC MAP PROVIDED BY WISCONSIN DNR.
-PROJECTLOCATIONPROJECTLOCATIONDRAFT 100'162'66'100'60'66'66'66'2308-01-2101-01 2308-01-2201-01 4.26 AC.13 AC.80 AC.2.4 AC.18.61 AC.
-S88&deg;58'06"E  1,868' 1,868'N01&deg;01'45"W  1,868' 1,868'TRANSMISSION LINE 1,000'R1,000'R80' FUTURE STREET 100' FUTURE STREET S88&deg;58'06"E TRANSIT FACILITY 21 AC.3 AC.21 AC.2.2 AC.5 AC.2.4 AC.5.1 AC.17.52 AC.
-.93 AC.
-.7 AC.25.23 AC.
-.33 AC.
-.34 AC.
-.5 AC.34.23 AC.
-.69 AC.
-'700'700'0.4 AC.10.43 AC.
-.1 AC.1.5 AC.316'-3"316'-3"SM-GW1ASM-GW2ASM-GW3ASM-GW4A1.) LOCATION OF POTENTIAL LOCATION FOR SHINE MEDICAL FACILITY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
-.) AERIAL IMAGERY PROVIDED BY PROVIDED BY CITY OF STEVENS POINT ON 12/20/11.
-REFERENCES\\anc1-s-fs2-vm\Jobs_In_Progress\2011 Jobs\113-81093 SHINE Steven's Point WI\CAD\Proposed_building_layout_SP.dwg l 1/11/2012 11:01 AM l AGarrigus l STEVENS POINT SCALE0FEET100O100O2--------APG1/11/12MTK1/11/12AT1/11/121----FIG.113-81051 Proposed_building_layout_SP.dwg SMT / STEVENS POINT / AK SITE MAPSHINE MEDICAL TECHNOLOGIES STEVENS POINT, WISCONSIN CHECKREVIEWDESIGNCADDSCALEFILE No.PROJECT No.
-TITLEAS SHOWNREV.PROPOSEDBUILDINGOUTLINEPROPOSED BUILDINGAREAINTERSTATE HIGHWAY 39 PROPOSEDPROPERTYBOUNDARY1.) NORTHINGS AND EASTINGS PROVIDED IN NAD_1983_HARN_WISCRS_PORTAGE_COUNTY_FEET NOTESDRAFT Appendix ALegal Description of the Subject Property/Chain of Title Report DRAFT DRAFTRFI RESPONSE FORM PM-001, Revision 2 RFI NO.: GOLDER-2011-RFI Revision:
-0051 Due Date: 12/16/2011 Sheet 1 of 3 RFI RESPONSE:
-The following table is the legal parcels description for the Stevens Point property:
-Parcel Township Owner(s)
-Approximate Identification Acreage Number 020-23-0801-02.06 Town of Hull 7.2 020-23-0801-03.01 Town of Hull 19.92 . 020-23-0801-02.02 Town of Hull 6.6 020-23-0801-01.04 Town of Hull 25.23 020-23-0801-04.01 020-23-0801-03.02 Town of Hull 19.93 030-23-0801-1 4 Town of Plover 5.5 030-23-0801-13 Town of Plover 3.7 Total Combined 88.08 Parcel Acreage Please also find Phase 1 ESA User Questionnaire responses on pages 2 and 3 of the RFI response.
-Responder:
-______________
-_ Company:
-SHINE Medical Independent Reviewer (for Design Input)---------------
-Responder's Management:
-SHINE Licensing:
-Originator Acceptance:
-/28/2011 X
-Date: 12.21.11 Phone No.: ----------1 Date:
-Date: ------------------1 My Map020230801-01.04This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:26:25 PM.
-DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map020230801-02.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:40:03 PM.
-DRAFT My Map020230801-02.06This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:42:58 PM.
-DRAFT My Map020230801-03.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:15:59 PM.
-DRAFTJakuszMargaretAEtalMocadloThomas,J 5931OldHighway18 StevensPoint,WI My Map020-23-0801-03.02This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:30:47 PM.
-DRAFTEmmerichHakrzewskiBluetopFarmsInc 5613CountyRoadHH StevensPoint,WI My Map020230801-04.01This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:28:50 PM.
-DRAFTBernardJMocadlo5823OldHighway18 StevensPoint,WI54482 My Map030-23-0801-13This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:34:11 PM.
-DRAFTMS&SEnterprises6213CountyRoadHH StevensPoint,WI54482 My Map030-23-0801-14This map does not constitute a legal survey. Contact Planning and Zoning Office (715) 346-1334 Tue Jan 3 2012 02:32:31 PM.
-DRAFTBlueTopFarmsInc.5613CountyRoadHH StevensPoint,WI54482 Appendix BFederal and State Regulatory Database SearchDRAFT FORM-BPK-SPM kcehCoeG htiw tropeR  &#x17d;paM suidaR RDE ehT440 Wheelers Farms Road Milford, CT 06461
-Toll Free: 800.352.0050
+==SUMMARY==
+TC3220399.2s EXECUTIVE
-www.edrnet.com SHINE Medical Stevens Point, WI Lands End Way,
+==SUMMARY==
+Due to poor or inadequate address information, the following sites were not mapped. Count: 13 records.
+Site Name Database(s)
+STEVENS POINT MUNICIPAL AIRPORT NPDES STEVENS POINT MUNI FINDS FROM STEVENS POINT CTY LIMITS TO C SPILLS JUNCTION CITY TO STEVENS POINT SPILLS WI RIVER & WISCONSIN ST SPILLS UW STEVENS POINT BALDWIN HALL SPILLS WISCONSIN RIVER BELOW POINT PAPER SPILLS STEVENS POINT AIRPORT #2 WI WRRSER KWIK TRIP - STEVENS POINT WI WRRSER STEVENS POINT BRRTS WI RIVER BOAT LANDING BRRTS STEVENS POINT BRRTS STEVENS POINT WATER DEPARTMENT - W TIER 2 DRAFT
-Stevens Point, WI  54482 Inquiry Number: 3220399.2s December 07, 2011 DRAFT SECTIONPAGEExecutive Summary ES1Overview Map 2Detail Map 3Map Findings Summary4 Map Findings 7Orphan Summary 8Government Records Searched/Data Currency TrackingGR-1 GEOCHECK ADDENDUMPhysical Setting Source AddendumA-1Physical Setting Source SummaryA-2Physical Setting SSURGO Soil MapA-5Physical Setting Source MapA-9Physical Setting Source Map FindingsA-11Physical Setting Source Records SearchedA-30 TC3220399.2s   Page 1 Thank you for your business.
-Please contact EDR at 1-800-352-0050 with any questions or comments.
-Disclaimer - Copyright and Trademark Notice This Report contains certain information obtained from a variety of public and other sources reasonably available to Environmen tal DataResources, Inc. It cannot be concluded from this Report that coverage information for the target and surrounding properties doe s not exist from other sources.
-NO WARRANTY EXPRESSED OR IMPLIED, IS MADE WHATSOEVER IN CONNECTION WITH THIS REPORT. ENVIRONMENTAL DATA RESOURCES, INC. SPECIFICALLY DISCLAIMS THE MAKING OF ANY SUCH WARRANTIES, INCLUDING WITHOUT LIMITATION,
-MERCHANTABILITY OR FITNESS FOR A PARTICULAR USE OR PURPOSE. ALL RISK IS ASSUMED BY THE USER. IN NO EVENT SHALL
-ENVIRONMENTAL DATA RESOURCES, INC. BE LIABLE TO ANYONE, WHETHER ARISING OUT OF ERRORS OR OMISSIONS, NEGLIGENCE,
-ACCIDENT OR ANY OTHER CAUSE, FOR ANY LOSS OF DAMAGE, INCLUDING, WITHOUT LIMITATION, SPECIAL, INCIDENTAL,
-CONSEQUENTIAL, OR EXEMPLARY DAMAGES. ANY LIABILITY ON THE PART OF ENVIRONMENTAL DATA RESOURCES, INC. IS STRICTLY
-LIMITED TO A REFUND OF THE AMOUNT PAID FOR THIS REPORT.
-Purchaser accepts this Report "AS IS". Any analyses, estimates, ratings, environmental risk levels or risk codes provided in this Report are provided for illustrative purposes only, and are not intend ed to provide, nor should they be interpreted as providing any facts regarding, or prediction or forecast of, any environmental risk for any prope rty. Only a Phase I Environmental Site Assessment performed by an environmental professional can provide information regarding the environmental ri sk for any property. Additionally, the information provided in this Report is not to be construed as legal advice.
-Copyright 2011 by Environmental Data Resources, Inc. All rights reserved. Reproduction in any media or format, in whole or in part, of any report or map of Environmental Data Resources, Inc., or its affiliates, is prohibited without prior written permission.
-EDR and its logos (including Sanborn and Sanborn Map) are trademarks of Environmental Data Resources, Inc. or its affiliates. A ll othertrademarks used herein are the property of their respective owners.
-TABLE OF CONTENTS DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 1A search of available environmental records was conducted by Environmental Data Resources, Inc (EDR).The report was designed to assist parties seeking to meet the search requirements of EPA's Standards and Practices for All Appropriate Inquiries (40 CFR Part 312), the ASTM Standard Practice for Environmental Site Assessments (E 1527-05) or custom requirements developed for the evaluation of
-environmental risk associated with a parcel of real estate.
-TARGET PROPERTY INFORMATION ADDRESSLANDS END WAY,
-STEVENS POINT, WI 54482 COORDINATES 44.507000 - 44 30' 25.2''
-Latitude (North):
-.495900 - 89 29' 45.2''
-Longitude (West):
-Zone 16Universal Tranverse Mercator:
-.3UTM X (Meters):
-4931000.0 UTM Y (Meters):
-ft. above sea level Elevation:
-USGS TOPOGRAPHIC MAP ASSOCIATED WITH TARGET PROPERTY 44089-E4 POLONIA, WI Target Property Map:
-Most Recent Revision:
--D4 ARNOTT, WI South Map:
-Most Recent Revision:
--D5 WHITING, WI Southwest Map:
-Most Recent Revision:
--E5 STEVENS POINT, WI West Map:
-Most Recent Revision:
-AERIAL PHOTOGRAPHY IN THIS REPORT 2010Photo Year:
-USDASource:TARGET PROPERTY SEARCH RESULTS The target property was not listed in any of the databases searched by EDR.
-DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 2 DATABASES WITH NO MAPPED SITESNo mapped sites were found in EDR's search of available ("reasonably ascertainable ") governmentrecords either on the target property or within the search radius around the target property for the
-following databases:
-STANDARD ENVIRONMENTAL RECORDS Federal NPL site listNPLNational Priority ListProposed NPLProposed National Priority List SitesNPL LIENSFederal Superfund Liens Federal Delisted NPL site list Delisted NPLNational Priority List Deletions Federal CERCLIS list CERCLISComprehensive Environmental Response, Compensation, and Liability Information SystemFEDERAL FACILITYFederal Facility Site Information listing Federal CERCLIS NFRAP site List CERC-NFRAPCERCLIS No Further Remedial Action Planned Federal RCRA CORRACTS facilities list CORRACTSCorrective Action Report Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDFRCRA - Treatment, Storage and Disposal Federal RCRA generators list RCRA-LQGRCRA - Large Quantity GeneratorsRCRA-SQGRCRA - Small Quantity GeneratorsRCRA-CESQGRCRA - Conditionally Exempt Small Quantity Generator Federal institutional controls / engineering controls registries US ENG CONTROLSEngineering Controls Sites ListUS INST CONTROLSites with Institutional Controls Federal ERNS list ERNSEmergency Response Notification System State- and tribal - equivalent CERCLIS SHWSHazard Ranking List DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 3 State and tribal landfill and/or solid waste disposal site listsSWF/LFList of Licensed LandfillsWDSRegistry of Waste Disposal SitesSHWIMSSolid & Hazardous Waste Information Management System State and tribal leaking storage tank lists LUSTLeaking Underground Storage Tank DatabaseLASTLeaking Aboveground Storage Tank ListingINDIAN LUSTLeaking Underground Storage Tanks on Indian Land State and tribal registered storage tank lists USTRegistered Underground Storage TanksASTTanks DatabaseINDIAN USTUnderground Storage Tanks on Indian LandFEMA USTUnderground Storage Tank Listing State and tribal institutional control / engineering control registries CRSClosed Remediation SitesAULDeed Restriction at Closeout Sites State and tribal voluntary cleanup sites VCPVoluntary Party Liability Exemption SitesINDIAN VCPVoluntary Cleanup Priority Listing State and tribal Brownfields sites BEAPBrownfields Environmental Assessment ProgramBROWNFIELDSBrownfields Site Locations Listing ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDSA Listing of Brownfields Sites Local Lists of Landfill / Solid Waste Disposal Sites DEBRIS REGION 9Torres Martinez Reservation Illegal Dump Site LocationsODIOpen Dump InventorySWRCYRecycling Center ListingINDIAN ODIReport on the Status of Open Dumps on Indian Lands Local Lists of Hazardous waste / Contaminated Sites US CDLClandestine Drug LabsWI ERPEnvironmental Repair Program DatabaseCDLClandestine Drug Lab ListingUS HIST CDLNational Clandestine Laboratory Register DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 4 Local Land RecordsLIENS 2CERCLA Lien InformationLUCISLand Use Control Information System Records of Emergency Release Reports HMIRSHazardous Materials Information Reporting SystemSPILLSSpills DatabaseAGSPILLSAgricultural Spill Cases Other Ascertainable Records RCRA-NonGenRCRA - Non GeneratorsDOT OPSIncident and Accident DataDODDepartment of Defense SitesFUDSFormerly Used Defense SitesCONSENTSuperfund (CERCLA) Consent DecreesRODRecords Of DecisionUMTRAUranium Mill Tailings SitesMINESMines Master Index FileTRISToxic Chemical Release Inventory SystemTSCAToxic Substances Control ActFTTSFIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide                                                Act)/TSCA (Toxic Substances Control Act)HIST FTTSFIFRA/TSCA Tracking System Administrative Case ListingSSTSSection 7 Tracking SystemsICISIntegrated Compliance Information SystemPADSPCB Activity Database SystemMLTSMaterial Licensing Tracking SystemRADINFORadiation Information DatabaseFINDSFacility Index System/Facility Registry SystemRAATSRCRA Administrative Action Tracking SystemBRRTSBureau of Remediation & Redevelopment Tracking SystemNPDESNPDES Permit ListingMANIFESTHazardous Waste Manifest DataDRYCLEANERSFive Star Recognition Program SitesWI WRRSERWisconsin Remedial Response Site Evaluation ReportAIRSAir Permit Program ListingTIER 2Tier 2 Facility ListingLEADLead Inspection DataINDIAN RESERVIndian ReservationsSCRD DRYCLEANERSState Coalition for Remediation of Drycleaners ListingCOAL ASH EPACoal Combustion Residues Surface Impoundments ListFINANCIAL ASSURANCEFinancial Assurance Information ListingCOAL ASHCoal Ash Disposal Site ListingPCB TRANSFORMERPCB Transformer Registration DatabaseCOAL ASH DOESleam-Electric Plan Operation Data EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas PlantsEDR Proprietary Manufactured Gas Plants DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 5 SURROUNDING SITES: SEARCH RESULTS Surrounding sites were not identified.
-Unmappable (orphan) sites are not considered in the foregoing analysis.
-DRAFT EXECUTIVE SUMMARY TC3220399.2s  EXECUTIVE SUMMARY 6 Due to poor or inadequate address information, the following sites were not mapped. Count: 13 records.Site Name Database(s)____________ ____________STEVENS POINT MUNICIPAL AIRPORT NPDESSTEVENS POINT MUNI FINDS FROM STEVENS POINT CTY LIMITS TO C SPILLS JUNCTION CITY TO STEVENS POINT SPILLS WI RIVER & WISCONSIN ST SPILLS UW STEVENS POINT BALDWIN HALL SPILLS WISCONSIN RIVER BELOW POINT PAPER SPILLS STEVENS POINT AIRPORT #2 WI WRRSER KWIK TRIP - STEVENS POINT WI WRRSER STEVENS POINT BRRTS WI RIVER BOAT LANDING BRRTS STEVENS POINT BRRTS STEVENS POINT WATER DEPARTMENT - W TIER 2 DRAFT EDR Inc.EDR Inc.
 EDR Inc.
 EDR Inc.
@@ Line 507: / Line 587: @@
 EDR Inc.
 EDR Inc.
-EDR Inc.1120DRAFT N Target Property
+EDR Inc.
-... Sillls at eleva1ions higher than or equal to the target property
+EDR Inc.
-* Sbs at eleva11ons lower 1han 1he target property
+EDR Inc.
-.1 Manufactured Gas Plants &enslave AecepiDra E;:J Nallonal Priarlly Ust Silltl ITIJ Dept. Delenaa SIIBS SITE NAME: SHINE Mec:lcal Stevena Point, WI ADDRESS:
+DRAFT
-Lands End Way, Stevens Poln: WI 64482 LA TILONG: 44.5070 /89.4959 It , .. Indian Raaarvatlons BIA N Oil & Gas pipelines from USGS 100-year flood zone 600-yaar flood Z(lne ,,. .... ThiS report includes lntBratliYe Map display and/or hide map information.
-le legend includes only thOse icons for 1he dtlfault map view. D R i::l NT: Golder Associates CONTACT:
+N Target Property Sillls at eleva1ions higher than or equal to the target property Sbs at eleva11ons lower 1han 1he target property
+.1 Manufactured Gas Plants
+~ &enslave AecepiDra E;:J Nallonal Priarlly Ust Silltl ITIJ Dept. Delenaa SIIBS SITE NAME: SHINE Mec:lcal Stevena Point, WI ADDRESS:
+Lands End Way, Stevens Poln: WI 64482 LA TILONG: 44.5070 /89.4959 It
+~
+Indian Raaarvatlons BIA N Oil & Gas pipelines from USGS
+~
+-year flood zone
+~
+-yaar flood Z(lne ThiS report includes lntBratliYe Map ~to display and/or hide map information. 11le legend includes only thOse icons for 1he dtlfault map view.
+D R i::l NT:
+Golder Associates CONTACT:
 INQUIRY 1: 3220399.2&
 DATE:
-11:47 am MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0  NR     0      0      0    0 1.000NPL    0  NR     0      0      0    0 1.000Proposed NPL 0  NR   NR    NR    NR  NR   TPNPL LIENS Federal Delisted NPL site list 0  NR     0      0      0    0 1.000Delisted NPL Federal CERCLIS list 0  NR   NR      0      0    0 0.500CERCLIS    0  NR     0      0      0    0 1.000FEDERAL FACILITY Federal CERCLIS NFRAP site List 0  NR   NR      0      0    0 0.500CERC-NFRAP Federal RCRA CORRACTS facilities list 0  NR     0      0      0    0 1.000CORRACTSFederal RCRA non-CORRACTS TSD facilities list 0  NR   NR      0      0    0 0.500RCRA-TSDF Federal RCRA generators list 0  NR   NR    NR      0    0 0.250RCRA-LQG    0  NR   NR    NR      0    0 0.250RCRA-SQG    0  NR   NR    NR      0    0 0.250RCRA-CESQG Federal institutional controls /
+Dece~R)er07, 2011 11:47 am
-engineering controls registries 0  NR   NR      0      0    0 0.500US ENG CONTROLS 0  NR   NR      0      0    0 0.500US INST CONTROL Federal ERNS list 0  NR   NR    NR    NR  NR   TPERNSState- and tribal - equivalent CERCLIS 0  NR     0      0      0    0 1.000SHWSState and tribal landfill and/or solid waste disposal site lists 0  NR   NR      0      0    0 0.500SWF/LF    0  NR   NR      0      0    0 0.500WDS    0  NR   NR    NR    NR  NR   TPSHWIMSState and tribal leaking storage tank lists 0  NR   NR      0      0    0 0.500LUST    0  NR   NR      0      0    0 0.500LAST    0  NR   NR      0      0    0 0.500INDIAN LUST TC3220399.2s   Page 4 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted State and tribal registered storage tank lists 0  NR   NR    NR      0    0 0.250UST    0  NR   NR    NR      0    0 0.250AST    0  NR   NR    NR      0    0 0.250INDIAN UST 0  NR   NR    NR      0    0 0.250FEMA USTState and tribal institutional control / engineering control registries 0  NR   NR    NR    NR  NR   TPCRS    0  NR   NR      0      0    0 0.500AULState and tribal voluntary cleanup sites 0  NR   NR      0      0    0 0.500VCP    0  NR   NR      0      0    0 0.500INDIAN VCP State and tribal Brownfields sites 0  NR   NR      0      0    0 0.500BEAP    0  NR   NR      0      0    0 0.500BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0  NR   NR      0      0    0 0.500US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0  NR   NR      0      0    0 0.500DEBRIS REGION 9 0  NR   NR      0      0    0 0.500ODI    0  NR   NR      0      0    0 0.500SWRCY    0  NR   NR      0      0    0 0.500INDIAN ODI Local Lists of Hazardous waste /
-Contaminated Sites 0  NR   NR    NR    NR  NR   TPUS CDL    0  NR   NR      0      0    0 0.500WI ERP    0  NR   NR    NR    NR  NR   TPCDL    0  NR   NR    NR    NR  NR   TPUS HIST CDL Local Land Records 0  NR   NR    NR    NR  NR   TPLIENS 2    0  NR   NR      0      0    0 0.500LUCISRecords of Emergency Release Reports 0  NR   NR    NR    NR  NR   TPHMIRS    0  NR   NR    NR    NR  NR   TPSPILLS    0  NR   NR    NR    NR  NR   TPAGSPILLSOther Ascertainable Records 0  NR   NR    NR      0    0 0.250RCRA-NonGen TC3220399.2s   Page 5 DRAFT MAP FINDINGS SUMMARY SearchTargetDistanceTotalDatabaseProperty(Miles)< 1/81/8 - 1/41/4 - 1/21/2 - 1> 1Plotted 0  NR   NR    NR    NR  NR   TPDOT OPS    0  NR     0      0      0    0 1.000DOD    0  NR     0      0      0    0 1.000FUDS    0  NR     0      0      0    0 1.000CONSENT    0  NR     0      0      0    0 1.000ROD    0  NR   NR      0      0    0 0.500UMTRA    0  NR   NR    NR      0    0 0.250MINES    0  NR   NR    NR    NR  NR   TPTRIS    0  NR   NR    NR    NR  NR   TPTSCA    0  NR   NR    NR    NR  NR   TPFTTS    0  NR   NR    NR    NR  NR   TPHIST FTTS 0  NR   NR    NR    NR  NR   TPSSTS    0  NR   NR    NR    NR  NR   TPICIS    0  NR   NR    NR    NR  NR   TPPADS    0  NR   NR    NR    NR  NR   TPMLTS    0  NR   NR    NR    NR  NR   TPRADINFO    0  NR   NR    NR    NR  NR   TPFINDS    0  NR   NR    NR    NR  NR   TPRAATS    0  NR   NR    NR    NR  NR   TPBRRTS    0  NR   NR    NR    NR  NR   TPNPDES    0  NR   NR    NR      0    0 0.250MANIFEST    0  NR   NR    NR      0    0 0.250DRYCLEANERS 0  NR   NR    NR    NR  NR   TPWI WRRSER 0  NR   NR    NR    NR  NR   TPAIRS    0  NR   NR    NR    NR  NR   TPTIER 2    0  NR   NR    NR    NR  NR   TPLEAD    0  NR     0      0      0    0 1.000INDIAN RESERV 0  NR   NR      0      0    0 0.500SCRD DRYCLEANERS 0  NR   NR      0      0    0 0.500COAL ASH EPA 0  NR   NR    NR    NR  NR   TPFINANCIAL ASSURANCE 0  NR   NR      0      0    0 0.500COAL ASH    0  NR   NR    NR    NR  NR   TPPCB TRANSFORMER 0  NR   NR    NR    NR  NR   TPCOAL ASH DOE EDR PROPRIETARY RECORDS EDR Proprietary Records 0  NR     0      0      0    0 1.000Manufactured Gas Plants NOTES:   TP = Target Property
-NR = Not Requested at this Search Distance
-Sites may be listed in more than one database TC3220399.2s   Page 6 DRAFT MAP FINDINGS Map IDDirection EDR ID Number DistanceEPA ID Number Database(s)
-SiteElevation NO SITES FOUND TC3220399.2s   Page 7 DRAFT ORPHAN SUMMARYCityEDR IDSite NameSite AddressZipDatabase(s)
-Count: 13 records.STEVENS POINTS109260948STEVENS POINT AIRPORT #2HWY 66 WI WRRSERSTEVENS POINTS110356483STEVENS POINT MUNICIPAL AIRPORTHWY 66 OF POINT ENPDES STEVENS POINTS106975782STEVENS POINT ADDRESS UNKNOWNBRRTSSTEVENS POINTS107426958FROM STEVENS POINT CTY LIMITS TO CFROM STEVENS PTSPILLSSTEVENS POINTS100670543KWIK TRIP - STEVENS POINT3533 E HWY 66 WI WRRSERSTEVENS POINTS107429234JUNCTION CITY TO STEVENS POINTJUNCTION CITY TO STEVENS PTSPILLS STEVENS POINTS109326408WI RIVER & WISCONSIN STWI RIV S SPILLSSTEVENS POINTS110674654WI RIVER BOAT LANDINGRIVER RD BRRTSSTEVENS POINTS107432651UW STEVENS POINT BALDWIN HALLUW STEVENS PTSPILLSSTEVENS POINTS110357602STEVENS POINTSTEVENS PT BRRTSSTEVENS POINT1011985398STEVENS POINT MUNIUNKNOWN FINDSSTEVENS POINTS107685149STEVENS POINT WATER DEPARTMENT - W100 WELL FIELD RDTIER 2 STEVENS POINTS107433219WISCONSIN RIVER BELOW POINT PAPERWISCONSIN RIVER BELOW PTSPILLS TC3220399.2s   Page 8 DRAFT To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required.
-Number of Days to Update:
-Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public.
-STANDARD ENVIRONMENTAL RECORDS Federal NPL site list
-NPL:  National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority
-cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon
-coverage for over 1,000 NPL site boundaries produced by EPA's Environmental Photographic Interpretation Center
-(EPIC) and regional EPA offices.
-Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 79 Source:  EPA Telephone:  N/A
-Last EDR Contact: 10/12/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly NPL Site Boundaries Sources:
-EPA's Environmental Photographic Interpretation Center (EPIC)
-Telephone: 202-564-7333EPA Region 1EPA Region 6Telephone 617-918-1143Telephone: 214-655-6659EPA Region 3EPA Region 7Telephone 215-814-5418Telephone: 913-551-7247EPA Region 4EPA Region 8Telephone 404-562-8033Telephone: 303-312-6774EPA Region 5EPA Region 9Telephone 312-886-6686Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL:  Proposed National Priority List SitesA site that has been proposed for listing on the NationalPriorities List through the issuance of a proposed rule in the Federal Register.EPA then accepts public comments on the site, responds to the comments,and places on the NPL those sites that continue to meet therequirements for listing.
-Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 79 Source:  EPA Telephone:  N/A
-Last EDR Contact: 10/12/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly NPL LIENS:  Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority
-to file liens against real property in order to recover remedial action expenditures or when the property owner
-received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens.
-Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994
-Date Made Active in Reports: 03/30/1994
-Number of Days to Update: 56 Source:  EPA Telephone:  202-564-4267
-Last EDR Contact: 08/15/2011
-Next Scheduled EDR Contact: 11/28/2011
-Data Release Frequency: No Update Planned TC3220399.2s     Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal Delisted NPL site list DELISTED NPL:  National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the
-EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the
-NPL where no further response is appropriate.
-Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 79 Source:  EPA Telephone:  N/A
-Last EDR Contact: 10/12/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly Federal CERCLIS list
-CERCLIS:  Comprehensive Environmental Response, Compensation, and Liability Information System CERCLIS contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities,
-private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation,
-and Liability Act (CERCLA). CERCLIS contains sites which are either proposed to or on the National Priorities
-List (NPL) and sites which are in the screening and assessment phase for possible inclusion on the NPL.
-Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011
-Date Made Active in Reports: 05/02/2011
-Number of Days to Update: 62 Source:  EPA Telephone:  703-412-9810
-Last EDR Contact: 11/29/2011
-Next Scheduled EDR Contact: 03/12/2012
-Data Release Frequency: Quarterly FEDERAL FACILITY:  Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive
-Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities
-Restoration and Reuse Office is involved in cleanup activities.
-Date of Government Version: 12/10/2010 Date Data Arrived at EDR: 01/11/2011
-Date Made Active in Reports: 02/16/2011
-Number of Days to Update: 36 Source:  Environmental Protection Agency Telephone:  703-603-8704
-Last EDR Contact: 10/14/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Varies Federal CERCLIS NFRAP site List
-CERCLIS-NFRAP:  CERCLIS No Further Remedial Action Planned Archived sites are sites that have been removed and archived from the inventory of CERCLIS sites. Archived status
-indicates that, to the best of EPA's knowledge, assessment at a site has been completed and that EPA has determined
-no further steps will be taken to list this site on the National Priorities List (NPL), unless information indicates
-this decision was not appropriate or other considerations require a recommendation for listing at a later time.
-This decision does not necessarily mean that there is no hazard associated with a given site; it only means that,
-based upon available information, the location is not judged to be a potential NPL site.
-Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011
-Date Made Active in Reports: 05/02/2011
-Number of Days to Update: 62 Source:  EPA Telephone:  703-412-9810
-Last EDR Contact: 11/29/2011
-Next Scheduled EDR Contact: 03/12/2012
-Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list
-CORRACTS:  Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity.
-TC3220399.2s     Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 03/09/2011 Date Data Arrived at EDR: 03/15/2011
-Date Made Active in Reports: 06/14/2011
-Number of Days to Update: 91 Source:  EPA Telephone:  800-424-9346
-Last EDR Contact: 11/14/2011
-Next Scheduled EDR Contact: 02/27/2012
-Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list
-RCRA-TSDF:  RCRA - Treatment, Storage and Disposal RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
-and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
-includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
-as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that
-move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the
-waste. TSDFs treat, store, or dispose of the waste.
-Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
-Date Made Active in Reports: 08/08/2011
-Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
-Last EDR Contact: 10/05/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Quarterly Federal RCRA generators list
-RCRA-LQG:  RCRA - Large Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
-and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
-includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
-as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate
-over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month.
-Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
-Date Made Active in Reports: 08/08/2011
-Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
-Last EDR Contact: 10/05/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Quarterly RCRA-SQG:  RCRA - Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
-and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
-includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
-as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate
-between 100 kg and 1,000 kg of hazardous waste per month.
-Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
-Date Made Active in Reports: 08/08/2011
-Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
-Last EDR Contact: 10/05/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Quarterly RCRA-CESQG:  RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
-and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
-includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
-as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators
-(CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month.
-Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
-Date Made Active in Reports: 08/08/2011
-Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
-Last EDR Contact: 10/05/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Varies TC3220399.2s     Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Federal institutional controls / engineering controls registries US ENG CONTROLS:  Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building
-foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental
-media or effect human health.
-Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011
-Date Made Active in Reports: 06/14/2011
-Number of Days to Update: 81 Source:  Environmental Protection Agency Telephone:  703-603-0695
-Last EDR Contact: 09/12/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Varies US INST CONTROL:  Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures,
-such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation
-care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally
-required as part of the institutional controls.
-Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011
-Date Made Active in Reports: 06/14/2011
-Number of Days to Update: 81 Source:  Environmental Protection Agency Telephone:  703-603-0695
-Last EDR Contact: 09/12/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Varies Federal ERNS list
-ERNS:  Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous
-substances.
-Date of Government Version: 10/03/2011 Date Data Arrived at EDR: 10/04/2011
-Date Made Active in Reports: 11/11/2011
-Number of Days to Update: 38 Source:  National Response Center, United States Coast Guard Telephone:  202-267-2180
-Last EDR Contact: 10/04/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Annually State- and tribal - equivalent CERCLIS
-SHWS:  Hazard Ranking List State Hazardous Waste Sites. State hazardous waste site records are the states' equivalent to CERCLIS. These sites
-may or may not already be listed on the federal CERCLIS list. Priority sites planned for cleanup using state funds
-(state equivalent of Superfund) are identified along with sites where cleanup will be paid for by potentially
-responsible parties. Available information varies by state.
-Date of Government Version: 11/30/1994 Date Data Arrived at EDR: 02/10/1995
-Date Made Active in Reports: 03/01/1995
-Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2632
-Last EDR Contact: 10/03/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: No Update Planned State and tribal landfill and/or solid waste disposal site lists
-SWF/LF:  List of Licensed Landfills Solid Waste Facilities/Landfill Sites. SWF/LF type records typically contain an inventory of solid waste disposal
-facilities or landfills in a particular state. Depending on the state, these may be active or inactive facilities
-or open dumps that failed to meet RCRA Subtitle D Section 4004 criteria for solid waste landfills or disposal
-sites.TC3220399.2s     Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/12/2011 Date Data Arrived at EDR: 10/13/2011
-Date Made Active in Reports: 11/22/2011
-Number of Days to Update: 40 Source:  Department of Natural Resources Telephone:  608-267-7557
-Last EDR Contact: 10/03/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Semi-Annually WDS:  Registry of Waste Disposal Sites The registry was created by the DNR to serve as a comprehensive listing of all sites where solid or hazardous
-wastes have been or may have been deposited.
-Date of Government Version: 07/19/2011 Date Data Arrived at EDR: 10/06/2011
-Date Made Active in Reports: 10/25/2011
-Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2632
-Last EDR Contact: 10/06/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: No Update Planned SHWIMS:  Solid & Hazardous Waste Information Management System Information on sites, and facilities operating at sites, that are regulated by the Waste Management program Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/06/2011
-Date Made Active in Reports: 10/25/2011
-Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-266-2414
-Last EDR Contact: 10/06/2011
+MAP FINDINGS
-Next Scheduled EDR Contact: 01/16/2012
+==SUMMARY==
+Search Target Distance Total Database Property (Miles)
+< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1
+> 1 Plotted STANDARD ENVIRONMENTAL RECORDS Federal NPL site list 0
+NR 0
+0
+1.000 NPL 0
+NR 0
+0
+1.000 Proposed NPL 0
+NR NR NR NR NR TP NPL LIENS Federal Delisted NPL site list 0
+NR 0
+0
+1.000 Delisted NPL Federal CERCLIS list 0
+NR NR 0
+0
+.500 CERCLIS 0
+NR 0
+0
+1.000 FEDERAL FACILITY Federal CERCLIS NFRAP site List 0
+NR NR 0
+0
+.500 CERC-NFRAP Federal RCRA CORRACTS facilities list 0
+NR 0
+0
+1.000 CORRACTS Federal RCRA non-CORRACTS TSD facilities list 0
+NR NR 0
+0
+.500 RCRA-TSDF Federal RCRA generators list 0
+NR NR NR 0
+0.250 RCRA-LQG 0
+NR NR NR 0
+0.250 RCRA-SQG 0
+NR NR NR 0
+0.250 RCRA-CESQG Federal institutional controls /
+engineering controls registries 0
+NR NR 0
+0
+.500 US ENG CONTROLS 0
+NR NR 0
+0
+.500 US INST CONTROL Federal ERNS list 0
+NR NR NR NR NR TP ERNS State-and tribal - equivalent CERCLIS 0
+NR 0
+0
+1.000 SHWS State and tribal landfill and/or solid waste disposal site lists 0
+NR NR 0
+0
+.500 SWF/LF 0
+NR NR 0
+0
+.500 WDS 0
+NR NR NR NR NR TP SHWIMS State and tribal leaking storage tank lists 0
+NR NR 0
+0
+.500 LUST 0
+NR NR 0
+0
+.500 LAST 0
+NR NR 0
+0
+.500 INDIAN LUST TC3220399.2s Page 4 DRAFT
-Data Release Frequency: Quarterly State and tribal leaking storage tank lists
+MAP FINDINGS
-LUST:  Leaking Underground Storage Tank Database Leaking Underground Storage Tank Incident Reports. LUST records contain an inventory of reported leaking underground
+==SUMMARY==
+Search Target Distance Total Database Property (Miles)
+< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1
+> 1 Plotted State and tribal registered storage tank lists 0
+NR NR NR 0
+0.250 UST 0
+NR NR NR 0
+0.250 AST 0
+NR NR NR 0
+0.250 INDIAN UST 0
+NR NR NR 0
+0.250 FEMA UST State and tribal institutional control / engineering control registries 0
+NR NR NR NR NR TP CRS 0
+NR NR 0
+0
+.500 AUL State and tribal voluntary cleanup sites 0
+NR NR 0
+0
+.500 VCP 0
+NR NR 0
+0
+.500 INDIAN VCP State and tribal Brownfields sites 0
+NR NR 0
+0
+.500 BEAP 0
+NR NR 0
+0
+.500 BROWNFIELDS ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists 0
+NR NR 0
+0
+.500 US BROWNFIELDS Local Lists of Landfill / Solid Waste Disposal Sites 0
+NR NR 0
+0
+.500 DEBRIS REGION 9 0
+NR NR 0
+0
+.500 ODI 0
+NR NR 0
+0
+.500 SWRCY 0
+NR NR 0
+0
+.500 INDIAN ODI Local Lists of Hazardous waste /
+Contaminated Sites 0
+NR NR NR NR NR TP US CDL 0
+NR NR 0
+0
+.500 WI ERP 0
+NR NR NR NR NR TP CDL 0
+NR NR NR NR NR TP US HIST CDL Local Land Records 0
+NR NR NR NR NR TP LIENS 2 0
+NR NR 0
+0
+.500 LUCIS Records of Emergency Release Reports 0
+NR NR NR NR NR TP HMIRS 0
+NR NR NR NR NR TP SPILLS 0
+NR NR NR NR NR TP AGSPILLS Other Ascertainable Records 0
+NR NR NR 0
+0.250 RCRA-NonGen TC3220399.2s Page 5 DRAFT
-storage tank incidents. Not all states maintain these records, and the information stored varies by state.
+MAP FINDINGS
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
-Date Made Active in Reports: 08/01/2011
+==SUMMARY==
+Search Target Distance Total Database Property (Miles)
+< 1/8 1/8 - 1/4 1/4 - 1/2 1/2 - 1
+> 1 Plotted 0
+NR NR NR NR NR TP DOT OPS 0
+NR 0
+0
+1.000 DOD 0
+NR 0
+0
+1.000 FUDS 0
+NR 0
+0
+1.000 CONSENT 0
+NR 0
+0
+1.000 ROD 0
+NR NR 0
+0
+.500 UMTRA 0
+NR NR NR 0
+0.250 MINES 0
+NR NR NR NR NR TP TRIS 0
+NR NR NR NR NR TP TSCA 0
+NR NR NR NR NR TP FTTS 0
+NR NR NR NR NR TP HIST FTTS 0
+NR NR NR NR NR TP SSTS 0
+NR NR NR NR NR TP ICIS 0
+NR NR NR NR NR TP PADS 0
+NR NR NR NR NR TP MLTS 0
+NR NR NR NR NR TP RADINFO 0
+NR NR NR NR NR TP FINDS 0
+NR NR NR NR NR TP RAATS 0
+NR NR NR NR NR TP BRRTS 0
+NR NR NR NR NR TP NPDES 0
+NR NR NR 0
+0.250 MANIFEST 0
+NR NR NR 0
+0.250 DRYCLEANERS 0
+NR NR NR NR NR TP WI WRRSER 0
+NR NR NR NR NR TP AIRS 0
+NR NR NR NR NR TP TIER 2 0
+NR NR NR NR NR TP LEAD 0
+NR 0
+0
+1.000 INDIAN RESERV 0
+NR NR 0
+0
+.500 SCRD DRYCLEANERS 0
+NR NR 0
+0
+.500 COAL ASH EPA 0
+NR NR NR NR NR TP FINANCIAL ASSURANCE 0
+NR NR 0
+0
+.500 COAL ASH 0
+NR NR NR NR NR TP PCB TRANSFORMER 0
+NR NR NR NR NR TP COAL ASH DOE EDR PROPRIETARY RECORDS EDR Proprietary Records 0
+NR 0
+0
+1.000 Manufactured Gas Plants NOTES:
+TP = Target Property NR = Not Requested at this Search Distance Sites may be listed in more than one database TC3220399.2s Page 6 DRAFT
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
+MAP FINDINGS Map ID Direction EDR ID Number Distance EPA ID Number Database(s)
+Site Elevation NO SITES FOUND TC3220399.2s Page 7 DRAFT
-Last EDR Contact: 11/03/2011
+ORPHAN
-Next Scheduled EDR Contact: 01/23/2012
+==SUMMARY==
+City EDR ID Site Name Site Address Zip Database(s)
+Count: 13 records.
+STEVENS POINT S109260948 STEVENS POINT AIRPORT #2 HWY 66 WI WRRSER STEVENS POINT S110356483 STEVENS POINT MUNICIPAL AIRPORT HWY 66 OF POINT E NPDES STEVENS POINT S106975782 STEVENS POINT ADDRESS UNKNOWN BRRTS STEVENS POINT S107426958 FROM STEVENS POINT CTY LIMITS TO C FROM STEVENS PT SPILLS STEVENS POINT S100670543 KWIK TRIP - STEVENS POINT 3533 E HWY 66 WI WRRSER STEVENS POINT S107429234 JUNCTION CITY TO STEVENS POINT JUNCTION CITY TO STEVENS PT SPILLS STEVENS POINT S109326408 WI RIVER & WISCONSIN ST WI RIV S SPILLS STEVENS POINT S110674654 WI RIVER BOAT LANDING RIVER RD BRRTS STEVENS POINT S107432651 UW STEVENS POINT BALDWIN HALL UW STEVENS PT SPILLS STEVENS POINT S110357602 STEVENS POINT STEVENS PT BRRTS STEVENS POINT 1011985398 STEVENS POINT MUNI UNKNOWN FINDS STEVENS POINT S107685149 STEVENS POINT WATER DEPARTMENT - W 100 WELL FIELD RD TIER 2 STEVENS POINT S107433219 WISCONSIN RIVER BELOW POINT PAPER WISCONSIN RIVER BELOW PT SPILLS TC3220399.2s Page 8 DRAFT
-Data Release Frequency: Quarterly LAST:  Leaking Aboveground Storage Tank Listing A listing of leaking aboveground storage tank sites.
+To maintain currency of the following federal and state databases, EDR contacts the appropriate governmental agency on a monthly or quarterly basis, as required.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
+Number of Days to Update: Provides confirmation that EDR is reporting records that have been updated within 90 days from the date the government agency made the information available to the public.
+STANDARD ENVIRONMENTAL RECORDS Federal NPL site list NPL: National Priority List National Priorities List (Superfund). The NPL is a subset of CERCLIS and identifies over 1,200 sites for priority cleanup under the Superfund Program. NPL sites may encompass relatively large areas. As such, EDR provides polygon coverage for over 1,000 NPL site boundaries produced by EPAs Environmental Photographic Interpretation Center (EPIC) and regional EPA offices.
+Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 79 Source: EPA Telephone: N/A Last EDR
-Date Made Active in Reports: 08/01/2011
+==Contact:==
+/12/2011 Next Scheduled EDR
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly NPL Site Boundaries Sources:
+EPAs Environmental Photographic Interpretation Center (EPIC)
+Telephone: 202-564-7333 EPA Region 1 EPA Region 6 Telephone 617-918-1143 Telephone: 214-655-6659 EPA Region 3 EPA Region 7 Telephone 215-814-5418 Telephone: 913-551-7247 EPA Region 4 EPA Region 8 Telephone 404-562-8033 Telephone: 303-312-6774 EPA Region 5 EPA Region 9 Telephone 312-886-6686 Telephone: 415-947-4246 EPA Region 10 Telephone 206-553-8665 Proposed NPL: Proposed National Priority List Sites A site that has been proposed for listing on the National Priorities List through the issuance of a proposed rule in the Federal Register. EPA then accepts public comments on the site, responds to the comments, and places on the NPL those sites that continue to meet the requirements for listing.
+Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 79 Source: EPA Telephone: N/A Last EDR
-Last EDR Contact: 11/03/2011
+==Contact:==
+/12/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/23/2012
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly NPL LIENS: Federal Superfund Liens Federal Superfund Liens. Under the authority granted the USEPA by CERCLA of 1980, the USEPA has the authority to file liens against real property in order to recover remedial action expenditures or when the property owner received notification of potential liability. USEPA compiles a listing of filed notices of Superfund Liens.
+Date of Government Version: 10/15/1991 Date Data Arrived at EDR: 02/02/1994 Date Made Active in Reports: 03/30/1994 Number of Days to Update: 56 Source: EPA Telephone: 202-564-4267 Last EDR
-Data Release Frequency: Varies INDIAN LUST R9:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 01/31/2011 Date Data Arrived at EDR: 02/01/2011
+==Contact:==
+/15/2011 Next Scheduled EDR
-Date Made Active in Reports: 03/21/2011
+==Contact:==
+/28/2011 Data Release Frequency: No Update Planned TC3220399.2s Page GR-1 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Number of Days to Update: 48 Source:  Environmental Protection Agency Telephone:  415-972-3372
+Federal Delisted NPL site list DELISTED NPL: National Priority List Deletions The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) establishes the criteria that the EPA uses to delete sites from the NPL. In accordance with 40 CFR 300.425.(e), sites may be deleted from the NPL where no further response is appropriate.
+Date of Government Version: 06/30/2011 Date Data Arrived at EDR: 07/12/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 79 Source: EPA Telephone: N/A Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/12/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly Federal CERCLIS list CERCLIS: Comprehensive Environmental Response, Compensation, and Liability Information System CERCLIS contains data on potentially hazardous waste sites that have been reported to the USEPA by states, municipalities, private companies and private persons, pursuant to Section 103 of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA). CERCLIS contains sites which are either proposed to or on the National Priorities List (NPL) and sites which are in the screening and assessment phase for possible inclusion on the NPL.
+Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011 Date Made Active in Reports: 05/02/2011 Number of Days to Update: 62 Source: EPA Telephone: 703-412-9810 Last EDR
-Data Release Frequency: Quarterly INDIAN LUST R4:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina.
+==Contact:==
-Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011
+/29/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/12/2012 Data Release Frequency: Quarterly FEDERAL FACILITY: Federal Facility Site Information listing A listing of National Priority List (NPL) and Base Realignment and Closure (BRAC) sites found in the Comprehensive Environmental Response, Compensation and Liability Information System (CERCLIS) Database where EPA Federal Facilities Restoration and Reuse Office is involved in cleanup activities.
+Date of Government Version: 12/10/2010 Date Data Arrived at EDR: 01/11/2011 Date Made Active in Reports: 02/16/2011 Number of Days to Update: 36 Source: Environmental Protection Agency Telephone: 703-603-8704 Last EDR
-Number of Days to Update: 32 Source:  EPA Region 4 Telephone:  404-562-8677
+==Contact:==
+/14/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/23/2012 Data Release Frequency: Varies Federal CERCLIS NFRAP site List CERCLIS-NFRAP: CERCLIS No Further Remedial Action Planned Archived sites are sites that have been removed and archived from the inventory of CERCLIS sites. Archived status indicates that, to the best of EPAs knowledge, assessment at a site has been completed and that EPA has determined no further steps will be taken to list this site on the National Priorities List (NPL), unless information indicates this decision was not appropriate or other considerations require a recommendation for listing at a later time.
+This decision does not necessarily mean that there is no hazard associated with a given site; it only means that, based upon available information, the location is not judged to be a potential NPL site.
+Date of Government Version: 02/25/2011 Date Data Arrived at EDR: 03/01/2011 Date Made Active in Reports: 05/02/2011 Number of Days to Update: 62 Source: EPA Telephone: 703-412-9810 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/29/2011 Next Scheduled EDR
-Data Release Frequency: Semi-Annually TC3220399.2s     Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN LUST R10:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington.
+==Contact:==
-Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011
+/12/2012 Data Release Frequency: Quarterly Federal RCRA CORRACTS facilities list CORRACTS: Corrective Action Report CORRACTS identifies hazardous waste handlers with RCRA corrective action activity.
+TC3220399.2s Page GR-2 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Date Made Active in Reports: 11/11/2011
+Date of Government Version: 03/09/2011 Date Data Arrived at EDR: 03/15/2011 Date Made Active in Reports: 06/14/2011 Number of Days to Update: 91 Source: EPA Telephone: 800-424-9346 Last EDR
-Number of Days to Update: 7 Source:  EPA Region 10 Telephone:  206-553-2857
+==Contact:==
+/14/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/27/2012 Data Release Frequency: Quarterly Federal RCRA non-CORRACTS TSD facilities list RCRA-TSDF: RCRA - Treatment, Storage and Disposal RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Transporters are individuals or entities that move hazardous waste from the generator offsite to a facility that can recycle, treat, store, or dispose of the waste. TSDFs treat, store, or dispose of the waste.
+Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011 Date Made Active in Reports: 08/08/2011 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/05/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly INDIAN LUST R1:  Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land.
+==Contact:==
-Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011
+/16/2012 Data Release Frequency: Quarterly Federal RCRA generators list RCRA-LQG: RCRA - Large Quantity Generators RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Large quantity generators (LQGs) generate over 1,000 kilograms (kg) of hazardous waste, or over 1 kg of acutely hazardous waste per month.
+Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011 Date Made Active in Reports: 08/08/2011 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186 Last EDR
-Date Made Active in Reports: 11/11/2011
+==Contact:==
+/05/2011 Next Scheduled EDR
-Number of Days to Update: 10 Source:  EPA Region 1 Telephone:  617-918-1313
+==Contact:==
+/16/2012 Data Release Frequency: Quarterly RCRA-SQG: RCRA - Small Quantity Generators RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Small quantity generators (SQGs) generate between 100 kg and 1,000 kg of hazardous waste per month.
+Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011 Date Made Active in Reports: 08/08/2011 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186 Last EDR
-Last EDR Contact: 11/01/2011
+==Contact:==
+/05/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/16/2012 Data Release Frequency: Quarterly RCRA-CESQG: RCRA - Conditionally Exempt Small Quantity Generators RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Conditionally exempt small quantity generators (CESQGs) generate less than 100 kg of hazardous waste, or less than 1 kg of acutely hazardous waste per month.
+Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011 Date Made Active in Reports: 08/08/2011 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186 Last EDR
-Data Release Frequency: Varies INDIAN LUST R6:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma.
+==Contact:==
-Date of Government Version: 09/12/2011 Date Data Arrived at EDR: 09/13/2011
+/05/2011 Next Scheduled EDR
-Date Made Active in Reports: 11/11/2011
+==Contact:==
+/16/2012 Data Release Frequency: Varies TC3220399.2s Page GR-3 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Number of Days to Update: 59 Source:  EPA Region 6 Telephone:  214-665-6597
+Federal institutional controls / engineering controls registries US ENG CONTROLS: Engineering Controls Sites List A listing of sites with engineering controls in place. Engineering controls include various forms of caps, building foundations, liners, and treatment methods to create pathway elimination for regulated substances to enter environmental media or effect human health.
+Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011 Date Made Active in Reports: 06/14/2011 Number of Days to Update: 81 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/12/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/26/2011 Data Release Frequency: Varies US INST CONTROL: Sites with Institutional Controls A listing of sites with institutional controls in place. Institutional controls include administrative measures, such as groundwater use restrictions, construction restrictions, property use restrictions, and post remediation care requirements intended to prevent exposure to contaminants remaining on site. Deed restrictions are generally required as part of the institutional controls.
+Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/25/2011 Date Made Active in Reports: 06/14/2011 Number of Days to Update: 81 Source: Environmental Protection Agency Telephone: 703-603-0695 Last EDR
-Data Release Frequency: Varies INDIAN LUST R7:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 02/16/2011 Date Data Arrived at EDR: 06/02/2011
+==Contact:==
+/12/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/26/2011 Data Release Frequency: Varies Federal ERNS list ERNS: Emergency Response Notification System Emergency Response Notification System. ERNS records and stores information on reported releases of oil and hazardous substances.
+Date of Government Version: 10/03/2011 Date Data Arrived at EDR: 10/04/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 38 Source: National Response Center, United States Coast Guard Telephone: 202-267-2180 Last EDR
-Number of Days to Update: 103 Source:  EPA Region 7 Telephone:  913-551-7003
+==Contact:==
+/04/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/16/2012 Data Release Frequency: Annually State-and tribal - equivalent CERCLIS SHWS: Hazard Ranking List State Hazardous Waste Sites. State hazardous waste site records are the states equivalent to CERCLIS. These sites may or may not already be listed on the federal CERCLIS list. Priority sites planned for cleanup using state funds (state equivalent of Superfund) are identified along with sites where cleanup will be paid for by potentially responsible parties. Available information varies by state.
+Date of Government Version: 11/30/1994 Date Data Arrived at EDR: 02/10/1995 Date Made Active in Reports: 03/01/1995 Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2632 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/03/2011 Next Scheduled EDR
-Data Release Frequency: Varies INDIAN LUST R8:  Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming.
+==Contact:==
-Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011
+/16/2012 Data Release Frequency: No Update Planned State and tribal landfill and/or solid waste disposal site lists SWF/LF: List of Licensed Landfills Solid Waste Facilities/Landfill Sites. SWF/LF type records typically contain an inventory of solid waste disposal facilities or landfills in a particular state. Depending on the state, these may be active or inactive facilities or open dumps that failed to meet RCRA Subtitle D Section 4004 criteria for solid waste landfills or disposal sites.
+TC3220399.2s Page GR-4 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Date Made Active in Reports: 09/13/2011
+Date of Government Version: 10/12/2011 Date Data Arrived at EDR: 10/13/2011 Date Made Active in Reports: 11/22/2011 Number of Days to Update: 40 Source: Department of Natural Resources Telephone: 608-267-7557 Last EDR
-Number of Days to Update: 25 Source:  EPA Region 8 Telephone:  303-312-6271
+==Contact:==
+/03/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/16/2012 Data Release Frequency: Semi-Annually WDS: Registry of Waste Disposal Sites The registry was created by the DNR to serve as a comprehensive listing of all sites where solid or hazardous wastes have been or may have been deposited.
+Date of Government Version: 07/19/2011 Date Data Arrived at EDR: 10/06/2011 Date Made Active in Reports: 10/25/2011 Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2632 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/06/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly State and tribal registered storage tank lists
+==Contact:==
+/16/2012 Data Release Frequency: No Update Planned SHWIMS: Solid & Hazardous Waste Information Management System Information on sites, and facilities operating at sites, that are regulated by the Waste Management program Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/06/2011 Date Made Active in Reports: 10/25/2011 Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-266-2414 Last EDR
-UST:  Registered Underground Storage Tanks Registered Underground Storage Tanks. UST's are regulated under Subtitle I of the Resource Conservation and Recovery
+==Contact:==
+/06/2011 Next Scheduled EDR
-Act (RCRA) and must be registered with the state department responsible for administering the UST program. Available
+==Contact:==
+/16/2012 Data Release Frequency: Quarterly State and tribal leaking storage tank lists LUST: Leaking Underground Storage Tank Database Leaking Underground Storage Tank Incident Reports. LUST records contain an inventory of reported leaking underground storage tank incidents. Not all states maintain these records, and the information stored varies by state.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-information varies by state program.
+==Contact:==
-Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011
+/03/2011 Next Scheduled EDR
-Date Made Active in Reports: 10/13/2011
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly LAST: Leaking Aboveground Storage Tank Listing A listing of leaking aboveground storage tank sites.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Number of Days to Update: 21 Source:  Department of Commerce Telephone:  608-266-7874
+==Contact:==
+/03/2011 Next Scheduled EDR
-Last EDR Contact: 09/22/2011
+==Contact:==
+/23/2012 Data Release Frequency: Varies INDIAN LUST R9: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Arizona, California, New Mexico and Nevada Date of Government Version: 01/31/2011 Date Data Arrived at EDR: 02/01/2011 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 48 Source: Environmental Protection Agency Telephone: 415-972-3372 Last EDR
-Next Scheduled EDR Contact: 01/02/2012
+==Contact:==
+/31/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly AST:  Tanks Database Aboveground storage tank site locations.
+==Contact:==
-TC3220399.2s     Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011
+/13/2012 Data Release Frequency: Quarterly INDIAN LUST R4: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Florida, Mississippi and North Carolina.
+Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 32 Source: EPA Region 4 Telephone: 404-562-8677 Last EDR
-Date Made Active in Reports: 10/13/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Number of Days to Update: 21 Source:  Department of Commerce Telephone:  608-266-7874
+==Contact:==
+/13/2012 Data Release Frequency: Semi-Annually TC3220399.2s Page GR-5 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Last EDR Contact: 09/22/2011
+INDIAN LUST R10: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Alaska, Idaho, Oregon and Washington.
+Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 7 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR
-Next Scheduled EDR Contact: 01/02/2012
+==Contact:==
+/31/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly INDIAN UST R9:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/13/2012 Data Release Frequency: Quarterly INDIAN LUST R1: Leaking Underground Storage Tanks on Indian Land A listing of leaking underground storage tank locations on Indian Land.
+Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 10 Source: EPA Region 1 Telephone: 617-918-1313 Last EDR
-land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations).
+==Contact:==
-Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 08/05/2011
+/01/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/13/2012 Data Release Frequency: Varies INDIAN LUST R6: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in New Mexico and Oklahoma.
+Date of Government Version: 09/12/2011 Date Data Arrived at EDR: 09/13/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 59 Source: EPA Region 6 Telephone: 214-665-6597 Last EDR
-Number of Days to Update: 39 Source:  EPA Region 9 Telephone:  415-972-3368
+==Contact:==
+/31/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/13/2012 Data Release Frequency: Varies INDIAN LUST R7: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Iowa, Kansas, and Nebraska Date of Government Version: 02/16/2011 Date Data Arrived at EDR: 06/02/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 103 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/31/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly INDIAN UST R8:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/13/2012 Data Release Frequency: Varies INDIAN LUST R8: Leaking Underground Storage Tanks on Indian Land LUSTs on Indian land in Colorado, Montana, North Dakota, South Dakota, Utah and Wyoming.
+Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 25 Source: EPA Region 8 Telephone: 303-312-6271 Last EDR
-land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations).
+==Contact:==
-Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011
+/31/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/13/2012 Data Release Frequency: Quarterly State and tribal registered storage tank lists UST: Registered Underground Storage Tanks Registered Underground Storage Tanks. USTs are regulated under Subtitle I of the Resource Conservation and Recovery Act (RCRA) and must be registered with the state department responsible for administering the UST program. Available information varies by state program.
+Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011 Date Made Active in Reports: 10/13/2011 Number of Days to Update: 21 Source: Department of Commerce Telephone: 608-266-7874 Last EDR
-Number of Days to Update: 25 Source:  EPA Region 8 Telephone:  303-312-6137
+==Contact:==
+/22/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/02/2012 Data Release Frequency: Quarterly AST: Tanks Database Aboveground storage tank site locations.
+TC3220399.2s Page GR-6 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Next Scheduled EDR Contact: 02/13/2012
+Date of Government Version: 09/16/2011 Date Data Arrived at EDR: 09/22/2011 Date Made Active in Reports: 10/13/2011 Number of Days to Update: 21 Source: Department of Commerce Telephone: 608-266-7874 Last EDR
-Data Release Frequency: Quarterly INDIAN UST R7:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/22/2011 Next Scheduled EDR
-land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations).
+==Contact:==
-Date of Government Version: 04/01/2011 Date Data Arrived at EDR: 06/01/2011
+/02/2012 Data Release Frequency: Quarterly INDIAN UST R9: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 9 (Arizona, California, Hawaii, Nevada, the Pacific Islands, and Tribal Nations).
+Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 08/05/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 39 Source: EPA Region 9 Telephone: 415-972-3368 Last EDR
-Date Made Active in Reports: 06/14/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Number of Days to Update: 13 Source:  EPA Region 7 Telephone:  913-551-7003
+==Contact:==
+/13/2012 Data Release Frequency: Quarterly INDIAN UST R8: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 8 (Colorado, Montana, North Dakota, South Dakota, Utah, Wyoming and 27 Tribal Nations).
+Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 08/19/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 25 Source: EPA Region 8 Telephone: 303-312-6137 Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/13/2012 Data Release Frequency: Quarterly INDIAN UST R7: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 7 (Iowa, Kansas, Missouri, Nebraska, and 9 Tribal Nations).
+Date of Government Version: 04/01/2011 Date Data Arrived at EDR: 06/01/2011 Date Made Active in Reports: 06/14/2011 Number of Days to Update: 13 Source: EPA Region 7 Telephone: 913-551-7003 Last EDR
-Data Release Frequency: Varies INDIAN UST R10:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/31/2011 Next Scheduled EDR
-land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations).
+==Contact:==
-Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011
+/13/2012 Data Release Frequency: Varies INDIAN UST R10: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 10 (Alaska, Idaho, Oregon, Washington, and Tribal Nations).
+Date of Government Version: 11/02/2011 Date Data Arrived at EDR: 11/04/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 7 Source: EPA Region 10 Telephone: 206-553-2857 Last EDR
-Date Made Active in Reports: 11/11/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Number of Days to Update: 7 Source:  EPA Region 10 Telephone:  206-553-2857
+==Contact:==
+/13/2012 Data Release Frequency: Quarterly INDIAN UST R1: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal Nations).
+Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 10 Source: EPA, Region 1 Telephone: 617-918-1313 Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/13/2012 Data Release Frequency: Varies INDIAN UST R4: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee and Tribal Nations)
+TC3220399.2s Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Data Release Frequency: Quarterly INDIAN UST R1:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 32 Source: EPA Region 4 Telephone: 404-562-9424 Last EDR
-land in EPA Region 1 (Connecticut, Maine, Massachusetts, New Hampshire, Rhode Island, Vermont and ten Tribal
+==Contact:==
+/31/2011 Next Scheduled EDR
-Nations).
+==Contact:==
-Date of Government Version: 10/01/2011 Date Data Arrived at EDR: 11/01/2011
+/13/2012 Data Release Frequency: Semi-Annually INDIAN UST R5: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations).
+Date of Government Version: 07/01/2011 Date Data Arrived at EDR: 08/26/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 18 Source: EPA Region 5 Telephone: 312-886-6136 Last EDR
-Date Made Active in Reports: 11/11/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Number of Days to Update: 10 Source:  EPA, Region 1 Telephone:  617-918-1313
+==Contact:==
+/13/2012 Data Release Frequency: Varies INDIAN UST R6: Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes).
+Date of Government Version: 05/10/2011 Date Data Arrived at EDR: 05/11/2011 Date Made Active in Reports: 06/14/2011 Number of Days to Update: 34 Source: EPA Region 6 Telephone: 214-665-7591 Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/31/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/13/2012 Data Release Frequency: Semi-Annually FEMA UST: Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks.
+Date of Government Version: 01/01/2010 Date Data Arrived at EDR: 02/16/2010 Date Made Active in Reports: 04/12/2010 Number of Days to Update: 55 Source: FEMA Telephone: 202-646-5797 Last EDR
-Data Release Frequency: Varies INDIAN UST R4:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/17/2011 Next Scheduled EDR
-land in EPA Region 4 (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, Tennessee
+==Contact:==
+/30/2012 Data Release Frequency: Varies State and tribal institutional control / engineering control registries CRS: Closed Remediation Sites A Closed Remediation Site is parcel of land at which the groundwater has become contaminated and which is affected by a particular type of legal restriction. Specifically, certain steps have been taken to stabilize/remediate the contamination, and the state is satisfied that no further efforts are necessary provided that the property is not used for certain purposes.
+Date of Government Version: 08/23/2011 Date Data Arrived at EDR: 08/25/2011 Date Made Active in Reports: 09/14/2011 Number of Days to Update: 20 Source: Department of Natural Resources Telephone: 608-267-0554 Last EDR
-and Tribal Nations)
+==Contact:==
-TC3220399.2s     Page GR-7 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/12/2011
+/24/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/05/2012 Data Release Frequency: Semi-Annually AUL: Deed Restriction at Closeout Sites Date a deed restriction is recorded at the Register of Deeds office for a property. Extent of soil contamination is known but impracticable to remove now or an engineering control is required to be maintained or NR720 industrial stds are applied. Restricts property use or requires future actions.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Number of Days to Update: 32 Source:  EPA Region 4 Telephone:  404-562-9424
+==Contact:==
+/03/2011 Next Scheduled EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly State and tribal voluntary cleanup sites TC3220399.2s Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Next Scheduled EDR Contact: 02/13/2012
+INDIAN VCP R1: Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1.
+Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 10/04/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 38 Source: EPA, Region 1 Telephone: 617-918-1102 Last EDR
-Data Release Frequency: Semi-Annually INDIAN UST R5:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/04/2011 Next Scheduled EDR
-land in EPA Region 5 (Michigan, Minnesota and Wisconsin and Tribal Nations).
+==Contact:==
-Date of Government Version: 07/01/2011 Date Data Arrived at EDR: 08/26/2011
+/16/2012 Data Release Frequency: Varies VCP: Voluntary Party Liability Exemption Sites The Voluntary Party Liability Exemption is an elective environmental cleanup program. Interested persons who meet the definition of "voluntary party" are eligible to apply. A "voluntary party" is any person who submits an application and pays all the necessary fees.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Date Made Active in Reports: 09/13/2011
+==Contact:==
+/03/2011 Next Scheduled EDR
-Number of Days to Update: 18 Source:  EPA Region 5 Telephone:  312-886-6136
+==Contact:==
+/23/2012 Data Release Frequency: Varies INDIAN VCP R7: Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7.
+Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008 Date Made Active in Reports: 05/19/2008 Number of Days to Update: 27 Source: EPA, Region 7 Telephone: 913-551-7365 Last EDR
-Last EDR Contact: 10/31/2011
+==Contact:==
+/20/2009 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/20/2009 Data Release Frequency: Varies State and tribal Brownfields sites BEAP: Brownfields Environmental Assessment Program The Brownfields Environmental Assessment Program (BEAP) was a federal program that assisted municipalities with Environmental Site Assessments (ESAs) for tax delinquent or bankrupt properties, or properties a local government acquired for redevelopment. Using federal dollars, site assessments were conducted by Department of Natural Resources (DNR) staff to determine if the properties were contaminated.
+Date of Government Version: 12/31/2000 Date Data Arrived at EDR: 05/29/2001 Date Made Active in Reports: 06/29/2001 Number of Days to Update: 31 Source: Department of Natural Resources Telephone: 608-266-1618 Last EDR
-Data Release Frequency: Varies INDIAN UST R6:  Underground Storage Tanks on Indian Land The Indian Underground Storage Tank (UST) database provides information about underground storage tanks on Indian
+==Contact:==
+/17/2009 Next Scheduled EDR
-land in EPA Region 6 (Louisiana, Arkansas, Oklahoma, New Mexico, Texas and 65 Tribes).
+==Contact:==
-Date of Government Version: 05/10/2011 Date Data Arrived at EDR: 05/11/2011
+/16/2009 Data Release Frequency: No Update Planned BROWNFIELDS: Brownfields Site Locations Listing A listing of brownfields sites included in the BRRTS database. Brownfields are abandoned, idle or underused commercial or industrial properties, where the expansion or redevelopment is hindered by real or perceived contamination.
+Brownfields vary in size, location, age, and past use -- they can be anything from a five-hundred acre automobile assembly plant to a small, abandoned corner gas station.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-266-3084 Last EDR
-Date Made Active in Reports: 06/14/2011
+==Contact:==
+/03/2011 Next Scheduled EDR
-Number of Days to Update: 34 Source:  EPA Region 6 Telephone:  214-665-7591
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS: A Listing of Brownfields Sites TC3220399.2s Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Last EDR Contact: 10/31/2011
+Included in the listing are brownfields properties addresses by Cooperative Agreement Recipients and brownfields properties addressed by Targeted Brownfields Assessments. Targeted Brownfields Assessments-EPAs Targeted Brownfields Assessments (TBA) program is designed to help states, tribes, and municipalities--especially those without EPA Brownfields Assessment Demonstration Pilots--minimize the uncertainties of contamination often associated with brownfields. Under the TBA program, EPA provides funding and/or technical assistance for environmental assessments at brownfields sites throughout the country. Targeted Brownfields Assessments supplement and work with other efforts under EPAs Brownfields Initiative to promote cleanup and redevelopment of brownfields. Cooperative Agreement Recipients-States, political subdivisions, territories, and Indian tribes become Brownfields Cleanup Revolving Loan Fund (BCRLF) cooperative agreement recipients when they enter into BCRLF cooperative agreements with the U.S. EPA. EPA selects BCRLF cooperative agreement recipients based on a proposal and application process. BCRLF cooperative agreement recipients must use EPA funds provided through BCRLF cooperative agreement for specified brownfields-related cleanup activities.
+Date of Government Version: 06/27/2011 Date Data Arrived at EDR: 06/27/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 78 Source: Environmental Protection Agency Telephone: 202-566-2777 Last EDR
-Next Scheduled EDR Contact: 02/13/2012
+==Contact:==
+/28/2011 Next Scheduled EDR
-Data Release Frequency: Semi-Annually FEMA UST:  Underground Storage Tank Listing A listing of all FEMA owned underground storage tanks.
+==Contact:==
-Date of Government Version: 01/01/2010 Date Data Arrived at EDR: 02/16/2010
+/09/2012 Data Release Frequency: Semi-Annually Local Lists of Landfill / Solid Waste Disposal Sites ODI: Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258 Subtitle D Criteria.
+Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004 Date Made Active in Reports: 09/17/2004 Number of Days to Update: 39 Source: Environmental Protection Agency Telephone: 800-424-9346 Last EDR
-Date Made Active in Reports: 04/12/2010
+==Contact:==
+/09/2004 Next Scheduled EDR
-Number of Days to Update: 55 Source:  FEMA Telephone:  202-646-5797
+==Contact:==
+N/A Data Release Frequency: No Update Planned DEBRIS REGION 9: Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside County and northern Imperial County, California.
+Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009 Date Made Active in Reports: 09/21/2009 Number of Days to Update: 137 Source: EPA, Region 9 Telephone: 415-947-4219 Last EDR
-Last EDR Contact: 10/17/2011
+==Contact:==
+/26/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/30/2012
+==Contact:==
+/09/2012 Data Release Frequency: No Update Planned SWRCY: Recycling Center Listing A listing of recycling center locations.
+Date of Government Version: 09/14/2011 Date Data Arrived at EDR: 09/16/2011 Date Made Active in Reports: 10/14/2011 Number of Days to Update: 28 Source: Solid & Hazardous Waste Education center Telephone: 608-262-0936 Last EDR
-Data Release Frequency: Varies State and tribal institutional control / engineering control registries
+==Contact:==
+/28/2011 Next Scheduled EDR
-CRS:  Closed Remediation Sites A Closed Remediation Site is parcel of land at which the groundwater has become contaminated and which is affected
+==Contact:==
+/30/2012 Data Release Frequency: Varies INDIAN ODI: Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land.
+Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007 Date Made Active in Reports: 01/24/2008 Number of Days to Update: 52 Source: Environmental Protection Agency Telephone: 703-308-8245 Last EDR
-by a particular type of legal restriction. Specifically, certain steps have been taken to stabilize/remediate
+==Contact:==
+/07/2011 Next Scheduled EDR
-the contamination, and the state is satisfied that no further efforts are necessary provided that the property
+==Contact:==
+/20/2012 Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites TC3220399.2s Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-is not used for certain purposes.
+US CDL: Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this web site as a public service. It contains addresses of some locations where law enforcement agencies reported they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
-Date of Government Version: 08/23/2011 Date Data Arrived at EDR: 08/25/2011
+In most cases, the source of the entries is not the Department, and the Department has not verified the entry and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example, contacting local law enforcement and local health departments.
+Date of Government Version: 06/08/2011 Date Data Arrived at EDR: 09/16/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 13 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR
-Date Made Active in Reports: 09/14/2011
+==Contact:==
+/05/2011 Next Scheduled EDR
-Number of Days to Update: 20 Source:  Department of Natural Resources Telephone:  608-267-0554
-Last EDR Contact: 11/24/2011
-Next Scheduled EDR Contact: 03/05/2012
-Data Release Frequency: Semi-Annually AUL:  Deed Restriction at Closeout Sites Date a deed restriction is recorded at the Register of Deeds office for a property. Extent of soil contamination
-is known but impracticable to remove now or an engineering control is required to be maintained or NR720 industrial
-stds are applied. Restricts property use or requires future actions.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
-Date Made Active in Reports: 08/01/2011
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
-Last EDR Contact: 11/03/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly State and tribal voluntary cleanup sites TC3220399.2s     Page GR-8 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT INDIAN VCP R1:  Voluntary Cleanup Priority Listing A listing of voluntary cleanup priority sites located on Indian Land located in Region 1.
-Date of Government Version: 08/04/2011 Date Data Arrived at EDR: 10/04/2011
-Date Made Active in Reports: 11/11/2011
-Number of Days to Update: 38 Source:  EPA, Region 1 Telephone:  617-918-1102
-Last EDR Contact: 10/04/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Varies VCP:  Voluntary Party Liability Exemption Sites The Voluntary Party Liability Exemption is an elective environmental cleanup program. Interested persons who meet
-the definition of "voluntary party" are eligible to apply. A "voluntary party" is any person who submits an application
-and pays all the necessary fees.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
-Date Made Active in Reports: 08/01/2011
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
-Last EDR Contact: 11/03/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Varies INDIAN VCP R7:  Voluntary Cleanup Priority Lisitng A listing of voluntary cleanup priority sites located on Indian Land located in Region 7.
-Date of Government Version: 03/20/2008 Date Data Arrived at EDR: 04/22/2008
-Date Made Active in Reports: 05/19/2008
-Number of Days to Update: 27 Source:  EPA, Region 7 Telephone:  913-551-7365
-Last EDR Contact: 04/20/2009
-Next Scheduled EDR Contact: 07/20/2009
-Data Release Frequency: Varies State and tribal Brownfields sites
-BEAP:  Brownfields Environmental Assessment Program The Brownfields Environmental Assessment Program (BEAP) was a federal program that assisted municipalities with
-Environmental Site Assessments (ESA's) for tax delinquent or bankrupt properties, or properties a local government
-acquired for redevelopment. Using federal dollars, site assessments were conducted by Department of Natural Resources
-(DNR) staff to determine if the properties were contaminated.
-Date of Government Version: 12/31/2000 Date Data Arrived at EDR: 05/29/2001
-Date Made Active in Reports: 06/29/2001
-Number of Days to Update: 31 Source:  Department of Natural Resources Telephone:  608-266-1618
-Last EDR Contact: 08/17/2009
-Next Scheduled EDR Contact: 11/16/2009
-Data Release Frequency: No Update Planned BROWNFIELDS:  Brownfields Site Locations Listing A listing of brownfields sites included in the BRRTS database. Brownfields are abandoned, idle or underused commercial
-or industrial properties, where the expansion or redevelopment is hindered by real or perceived contamination.
-Brownfields vary in size, location, age, and past use -- they can be anything from a five-hundred acre automobile
-assembly plant to a small, abandoned corner gas station.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
-Date Made Active in Reports: 08/01/2011
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-266-3084
-Last EDR Contact: 11/03/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly ADDITIONAL ENVIRONMENTAL RECORDS Local Brownfield lists US BROWNFIELDS:  A Listing of Brownfields Sites TC3220399.2s     Page GR-9 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Included in the listing are brownfields properties addresses by Cooperative Agreement Recipients and brownfields properties addressed by Targeted Brownfields Assessments. Targeted Brownfields Assessments-EPA's Targeted Brownfields
-Assessments (TBA) program is designed to help states, tribes, and municipalities--especially those without EPA
-Brownfields Assessment Demonstration Pilots--minimize the uncertainties of contamination often associated with
-brownfields. Under the TBA program, EPA provides funding and/or technical assistance for environmental assessments
-at brownfields sites throughout the country. Targeted Brownfields Assessments supplement and work with other efforts
-under EPA's Brownfields Initiative to promote cleanup and redevelopment of brownfields. Cooperative Agreement
-Recipients-States, political subdivisions, territories, and Indian tribes become Brownfields Cleanup Revolving
-Loan Fund (BCRLF) cooperative agreement recipients when they enter into BCRLF cooperative agreements with the
-U.S. EPA. EPA selects BCRLF cooperative agreement recipients based on a proposal and application process. BCRLF
-cooperative agreement recipients must use EPA funds provided through BCRLF cooperative agreement for specified
-brownfields-related cleanup activities.
-Date of Government Version: 06/27/2011 Date Data Arrived at EDR: 06/27/2011
-Date Made Active in Reports: 09/13/2011
-Number of Days to Update: 78 Source:  Environmental Protection Agency Telephone:  202-566-2777
-Last EDR Contact: 09/28/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Semi-Annually Local Lists of Landfill / Solid Waste Disposal Sites
-ODI:  Open Dump Inventory An open dump is defined as a disposal facility that does not comply with one or more of the Part 257 or Part 258
-Subtitle D Criteria.
-Date of Government Version: 06/30/1985 Date Data Arrived at EDR: 08/09/2004
-Date Made Active in Reports: 09/17/2004
-Number of Days to Update: 39 Source:  Environmental Protection Agency Telephone:  800-424-9346
-Last EDR Contact: 06/09/2004
-Next Scheduled EDR Contact: N/A
-Data Release Frequency: No Update Planned DEBRIS REGION 9:  Torres Martinez Reservation Illegal Dump Site Locations A listing of illegal dump sites location on the Torres Martinez Indian Reservation located in eastern Riverside
-County and northern Imperial County, California.
-Date of Government Version: 01/12/2009 Date Data Arrived at EDR: 05/07/2009
-Date Made Active in Reports: 09/21/2009
-Number of Days to Update: 137 Source:  EPA, Region 9 Telephone:  415-947-4219
-Last EDR Contact: 09/26/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: No Update Planned SWRCY:  Recycling Center Listing A listing of recycling center locations.
-Date of Government Version: 09/14/2011 Date Data Arrived at EDR: 09/16/2011
-Date Made Active in Reports: 10/14/2011
-Number of Days to Update: 28 Source:  Solid & Hazardous Waste Education center Telephone:  608-262-0936
-Last EDR Contact: 11/28/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Varies INDIAN ODI:  Report on the Status of Open Dumps on Indian Lands Location of open dumps on Indian land.
-Date of Government Version: 12/31/1998 Date Data Arrived at EDR: 12/03/2007
-Date Made Active in Reports: 01/24/2008
-Number of Days to Update: 52 Source:  Environmental Protection Agency Telephone:  703-308-8245
-Last EDR Contact: 11/07/2011
-Next Scheduled EDR Contact: 02/20/2012
-Data Release Frequency: Varies Local Lists of Hazardous waste / Contaminated Sites TC3220399.2s     Page GR-10 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT US CDL:  Clandestine Drug Labs A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this
-web site as a public service. It contains addresses of some locations where law enforcement agencies reported
-they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
-In most cases, the source of the entries is not the Department, and the Department has not verified the entry
-and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,
-contacting local law enforcement and local health departments.
-Date of Government Version: 06/08/2011 Date Data Arrived at EDR: 09/16/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 13 Source:  Drug Enforcement Administration Telephone:  202-307-1000
-Last EDR Contact: 12/05/2011
-Next Scheduled EDR Contact: 03/19/2012
-Data Release Frequency: Quarterly ERP:  Environmental Repair Program Database Environmental Repair Program sites are sites other than LUST's that have contaminated soil and/or groundwater.
+==Contact:==
+/19/2012 Data Release Frequency: Quarterly ERP: Environmental Repair Program Database Environmental Repair Program sites are sites other than LUSTs that have contaminated soil and/or groundwater.
 Often, these are old historic releases to the environment.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Date Made Active in Reports: 08/01/2011
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
-Last EDR Contact: 11/03/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly CDL:  Clandestine Drug Lab Listing A listing of clandestine drug lab locations in the state.
+==Contact:==
-Date of Government Version: 10/11/2011 Date Data Arrived at EDR: 10/21/2011
+/03/2011 Next Scheduled EDR
-Date Made Active in Reports: 11/22/2011
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly CDL: Clandestine Drug Lab Listing A listing of clandestine drug lab locations in the state.
+Date of Government Version: 10/11/2011 Date Data Arrived at EDR: 10/21/2011 Date Made Active in Reports: 11/22/2011 Number of Days to Update: 32 Source: Department of Justice Telephone: 920-832-2751 Last EDR
-Number of Days to Update: 32 Source:  Department of Justice Telephone:  920-832-2751
+==Contact:==
+/15/2011 Next Scheduled EDR
-Last EDR Contact: 11/15/2011
+==Contact:==
+/27/2012 Data Release Frequency: Varies US HIST CDL: National Clandestine Laboratory Register A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this web site as a public service. It contains addresses of some locations where law enforcement agencies reported they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
+In most cases, the source of the entries is not the Department, and the Department has not verified the entry and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example, contacting local law enforcement and local health departments.
+Date of Government Version: 09/01/2007 Date Data Arrived at EDR: 11/19/2008 Date Made Active in Reports: 03/30/2009 Number of Days to Update: 131 Source: Drug Enforcement Administration Telephone: 202-307-1000 Last EDR
-Next Scheduled EDR Contact: 02/27/2012
+==Contact:==
+/23/2009 Next Scheduled EDR
-Data Release Frequency: Varies US HIST CDL:  National Clandestine Laboratory Register A listing of clandestine drug lab locations. The U.S. Department of Justice ("the Department") provides this
-web site as a public service. It contains addresses of some locations where law enforcement agencies reported
-they found chemicals or other items that indicated the presence of either clandestine drug laboratories or dumpsites.
-In most cases, the source of the entries is not the Department, and the Department has not verified the entry
-and does not guarantee its accuracy. Members of the public must verify the accuracy of all entries by, for example,
-contacting local law enforcement and local health departments.
-Date of Government Version: 09/01/2007 Date Data Arrived at EDR: 11/19/2008
-Date Made Active in Reports: 03/30/2009
-Number of Days to Update: 131 Source:  Drug Enforcement Administration Telephone:  202-307-1000
-Last EDR Contact: 03/23/2009
-Next Scheduled EDR Contact: 06/22/2009
-Data Release Frequency: No Update Planned Local Land Records
-LIENS 2:  CERCLA Lien Information A Federal CERCLA ('Superfund') lien can exist by operation of law at any site or property at which EPA has spent
-Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination.
+==Contact:==
+/22/2009 Data Release Frequency: No Update Planned Local Land Records LIENS 2: CERCLA Lien Information A Federal CERCLA (Superfund) lien can exist by operation of law at any site or property at which EPA has spent Superfund monies. These monies are spent to investigate and address releases and threatened releases of contamination.
 CERCLIS provides information as to the identity of these sites and properties.
-Date of Government Version: 09/09/2011 Date Data Arrived at EDR: 09/16/2011
+Date of Government Version: 09/09/2011 Date Data Arrived at EDR: 09/16/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 13 Source: Environmental Protection Agency Telephone: 202-564-6023 Last EDR
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 13 Source:  Environmental Protection Agency Telephone:  202-564-6023
-Last EDR Contact: 10/31/2011
-Next Scheduled EDR Contact: 02/13/2012
-Data Release Frequency: Varies TC3220399.2s     Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT LUCIS:  Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure
-properties.
-Date of Government Version: 12/09/2005 Date Data Arrived at EDR: 12/11/2006
-Date Made Active in Reports: 01/11/2007
-Number of Days to Update: 31 Source:  Department of the Navy Telephone:  843-820-7326
-Last EDR Contact: 11/22/2011
-Next Scheduled EDR Contact: 03/05/2012
-Data Release Frequency: Varies Records of Emergency Release Reports
-HMIRS:  Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT.
-Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/04/2011
-Date Made Active in Reports: 11/11/2011
-Number of Days to Update: 38 Source:  U.S. Department of Transportation Telephone:  202-366-4555
-Last EDR Contact: 10/04/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Annually SPILLS:  Spills Database A discharge of a hazardous substance that may adversely impact, or threaten to adversely impact public health,
-welfare or the environment. Spills are usually cleaned up quickly.
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
-Date Made Active in Reports: 08/01/2011
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
-Last EDR Contact: 11/03/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly AG SPILLS:  Agricultural Spill Cases Spills reported to the Department of Agriculture, Trade & Consumer Protection. There are two types of spills.
-Long-term: These are mainly pesticide and fertilizer cases. Some might include other contaminants at the same
-site. Some might involve wood-treaters - which use pesticides. All of them involve spills of products, but these
-spills generally result from day to day use (chronic spills) rather than accidental spills (acute). Accidental:
-These are the acute spills of pesticides and fertilizers and only involve pesticides and fertilizers. Most of
-these are cleaned up and closed within 3 to 6 months.
-Date of Government Version: 08/15/2011 Date Data Arrived at EDR: 08/19/2011
-Date Made Active in Reports: 10/10/2011
-Number of Days to Update: 52 Source:  Department of Agriculture, Trade & Consumer Protection Telephone:  608-224-5058
-Last EDR Contact: 11/14/2011
-Next Scheduled EDR Contact: 02/27/2012
-Data Release Frequency: Varies Other Ascertainable Records
-RCRA-NonGen:  RCRA - Non Generators RCRAInfo is EPA's comprehensive information system, providing access to data supporting the Resource Conservation
-and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database
-includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste
-as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous
-waste.Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011
-Date Made Active in Reports: 08/08/2011
-Number of Days to Update: 32 Source:  Environmental Protection Agency Telephone:  312-886-6186
-Last EDR Contact: 10/05/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Varies TC3220399.2s     Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT DOT OPS:  Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data.
-Date of Government Version: 07/29/2011 Date Data Arrived at EDR: 08/09/2011
-Date Made Active in Reports: 11/11/2011
-Number of Days to Update: 94 Source:  Department of Transporation, Office of Pipeline Safety Telephone:  202-366-4595
-Last EDR Contact: 11/08/2011
-Next Scheduled EDR Contact: 02/20/2012
-Data Release Frequency: Varies DOD:  Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that
-have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands.
-Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006
-Date Made Active in Reports: 01/11/2007
-Number of Days to Update: 62 Source:  USGS Telephone:  888-275-8747
-Last EDR Contact: 10/20/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Semi-Annually FUDS:  Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers
-is actively working or will take necessary cleanup actions.
-Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/12/2010
-Date Made Active in Reports: 12/02/2010
-Number of Days to Update: 112 Source:  U.S. Army Corps of Engineers Telephone:  202-528-4285
-Last EDR Contact: 09/12/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Varies CONSENT:  Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released
-periodically by United States District Courts after settlement by parties to litigation matters.
-Date of Government Version: 06/01/2011 Date Data Arrived at EDR: 08/19/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 41 Source:  Department of Justice, Consent Decree Library Telephone:  Varies
-Last EDR Contact: 10/03/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Varies ROD:  Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical
-and health information to aid in the cleanup.
-Date of Government Version: 07/31/2011 Date Data Arrived at EDR: 09/14/2011
-Date Made Active in Reports: 09/29/2011
-Number of Days to Update: 15 Source:  EPA Telephone:  703-416-0223
-Last EDR Contact: 09/14/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Annually UMTRA:  Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills
-shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings
-were used as construction materials before the potential health hazards of the tailings were recognized.
+==Contact:==
-Date of Government Version: 09/14/2010 Date Data Arrived at EDR: 10/21/2010
+/31/2011 Next Scheduled EDR
-Date Made Active in Reports: 01/28/2011
+==Contact:==
+/13/2012 Data Release Frequency: Varies TC3220399.2s Page GR-11 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Number of Days to Update: 99 Source:  Department of Energy Telephone:  505-845-0011
+LUCIS: Land Use Control Information System LUCIS contains records of land use control information pertaining to the former Navy Base Realignment and Closure properties.
+Date of Government Version: 12/09/2005 Date Data Arrived at EDR: 12/11/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 31 Source: Department of the Navy Telephone: 843-820-7326 Last EDR
-Last EDR Contact: 11/29/2011
+==Contact:==
+/22/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/05/2012 Data Release Frequency: Varies Records of Emergency Release Reports HMIRS: Hazardous Materials Information Reporting System Hazardous Materials Incident Report System. HMIRS contains hazardous material spill incidents reported to DOT.
+Date of Government Version: 10/04/2011 Date Data Arrived at EDR: 10/04/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 38 Source: U.S. Department of Transportation Telephone: 202-366-4555 Last EDR
-Data Release Frequency: Varies TC3220399.2s     Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT MINES:  Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes
+==Contact:==
+/04/2011 Next Scheduled EDR
-violation information.
+==Contact:==
-Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 09/08/2011
+/16/2012 Data Release Frequency: Annually SPILLS: Spills Database A discharge of a hazardous substance that may adversely impact, or threaten to adversely impact public health, welfare or the environment. Spills are usually cleaned up quickly.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Date Made Active in Reports: 09/29/2011
+==Contact:==
+/03/2011 Next Scheduled EDR
-Number of Days to Update: 21 Source:  Department of Labor, Mine Safety and Health Administration Telephone:  303-231-5959
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly AG SPILLS: Agricultural Spill Cases Spills reported to the Department of Agriculture, Trade & Consumer Protection. There are two types of spills.
+Long-term: These are mainly pesticide and fertilizer cases. Some might include other contaminants at the same site. Some might involve wood-treaters - which use pesticides. All of them involve spills of products, but these spills generally result from day to day use (chronic spills) rather than accidental spills (acute). Accidental:
+These are the acute spills of pesticides and fertilizers and only involve pesticides and fertilizers. Most of these are cleaned up and closed within 3 to 6 months.
+Date of Government Version: 08/15/2011 Date Data Arrived at EDR: 08/19/2011 Date Made Active in Reports: 10/10/2011 Number of Days to Update: 52 Source: Department of Agriculture, Trade & Consumer Protection Telephone: 608-224-5058 Last EDR
-Last EDR Contact: 12/07/2011
+==Contact:==
+/14/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/19/2012
+==Contact:==
+/27/2012 Data Release Frequency: Varies Other Ascertainable Records RCRA-NonGen: RCRA - Non Generators RCRAInfo is EPAs comprehensive information system, providing access to data supporting the Resource Conservation and Recovery Act (RCRA) of 1976 and the Hazardous and Solid Waste Amendments (HSWA) of 1984. The database includes selective information on sites which generate, transport, store, treat and/or dispose of hazardous waste as defined by the Resource Conservation and Recovery Act (RCRA). Non-Generators do not presently generate hazardous waste.
+Date of Government Version: 06/15/2011 Date Data Arrived at EDR: 07/07/2011 Date Made Active in Reports: 08/08/2011 Number of Days to Update: 32 Source: Environmental Protection Agency Telephone: 312-886-6186 Last EDR
-Data Release Frequency: Semi-Annually TRIS:  Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and
+==Contact:==
+/05/2011 Next Scheduled EDR
-land in reportable quantities under SARA Title III Section 313.
+==Contact:==
-Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/17/2010
+/16/2012 Data Release Frequency: Varies TC3220399.2s Page GR-12 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Date Made Active in Reports: 03/21/2011
+DOT OPS: Incident and Accident Data Department of Transporation, Office of Pipeline Safety Incident and Accident data.
+Date of Government Version: 07/29/2011 Date Data Arrived at EDR: 08/09/2011 Date Made Active in Reports: 11/11/2011 Number of Days to Update: 94 Source: Department of Transporation, Office of Pipeline Safety Telephone: 202-366-4595 Last EDR
-Number of Days to Update: 94 Source:  EPA Telephone:  202-566-0250
+==Contact:==
+/08/2011 Next Scheduled EDR
-Last EDR Contact: 12/02/2011
+==Contact:==
+/20/2012 Data Release Frequency: Varies DOD: Department of Defense Sites This data set consists of federally owned or administered lands, administered by the Department of Defense, that have any area equal to or greater than 640 acres of the United States, Puerto Rico, and the U.S. Virgin Islands.
+Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 11/10/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 62 Source: USGS Telephone: 888-275-8747 Last EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/20/2011 Next Scheduled EDR
-Data Release Frequency: Annually TSCA:  Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the
+==Contact:==
+/30/2012 Data Release Frequency: Semi-Annually FUDS: Formerly Used Defense Sites The listing includes locations of Formerly Used Defense Sites properties where the US Army Corps of Engineers is actively working or will take necessary cleanup actions.
+Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/12/2010 Date Made Active in Reports: 12/02/2010 Number of Days to Update: 112 Source: U.S. Army Corps of Engineers Telephone: 202-528-4285 Last EDR
-TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant
+==Contact:==
+/12/2011 Next Scheduled EDR
-site.Date of Government Version: 12/31/2006 Date Data Arrived at EDR: 09/29/2010
+==Contact:==
+/26/2011 Data Release Frequency: Varies CONSENT: Superfund (CERCLA) Consent Decrees Major legal settlements that establish responsibility and standards for cleanup at NPL (Superfund) sites. Released periodically by United States District Courts after settlement by parties to litigation matters.
+Date of Government Version: 06/01/2011 Date Data Arrived at EDR: 08/19/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 41 Source: Department of Justice, Consent Decree Library Telephone: Varies Last EDR
-Date Made Active in Reports: 12/02/2010
+==Contact:==
+/03/2011 Next Scheduled EDR
-Number of Days to Update: 64 Source:  EPA Telephone:  202-260-5521
+==Contact:==
+/16/2012 Data Release Frequency: Varies ROD: Records Of Decision Record of Decision. ROD documents mandate a permanent remedy at an NPL (Superfund) site containing technical and health information to aid in the cleanup.
+Date of Government Version: 07/31/2011 Date Data Arrived at EDR: 09/14/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 15 Source: EPA Telephone: 703-416-0223 Last EDR
-Last EDR Contact: 09/27/2011
+==Contact:==
+/14/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/09/2012
+==Contact:==
+/26/2011 Data Release Frequency: Annually UMTRA: Uranium Mill Tailings Sites Uranium ore was mined by private companies for federal government use in national defense programs. When the mills shut down, large piles of the sand-like material (mill tailings) remain after uranium has been extracted from the ore. Levels of human exposure to radioactive materials from the piles are low; however, in some cases tailings were used as construction materials before the potential health hazards of the tailings were recognized.
+Date of Government Version: 09/14/2010 Date Data Arrived at EDR: 10/21/2010 Date Made Active in Reports: 01/28/2011 Number of Days to Update: 99 Source: Department of Energy Telephone: 505-845-0011 Last EDR
-Data Release Frequency: Every 4 Years FTTS:  FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control A ct)FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA,
+==Contact:==
+/29/2011 Next Scheduled EDR
-TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the
+==Contact:==
+/12/2012 Data Release Frequency: Varies TC3220399.2s Page GR-13 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Agency on a quarterly basis.
+MINES: Mines Master Index File Contains all mine identification numbers issued for mines active or opened since 1971. The data also includes violation information.
-Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009
+Date of Government Version: 08/18/2011 Date Data Arrived at EDR: 09/08/2011 Date Made Active in Reports: 09/29/2011 Number of Days to Update: 21 Source: Department of Labor, Mine Safety and Health Administration Telephone: 303-231-5959 Last EDR
-Date Made Active in Reports: 05/11/2009
+==Contact:==
+/07/2011 Next Scheduled EDR
-Number of Days to Update: 25 Source:  EPA/Office of Prevention, Pesticides and Toxic Substances Telephone:  202-566-1667
+==Contact:==
+/19/2012 Data Release Frequency: Semi-Annually TRIS: Toxic Chemical Release Inventory System Toxic Release Inventory System. TRIS identifies facilities which release toxic chemicals to the air, water and land in reportable quantities under SARA Title III Section 313.
+Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/17/2010 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 94 Source: EPA Telephone: 202-566-0250 Last EDR
-Last EDR Contact: 11/28/2011
+==Contact:==
+/02/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/12/2012 Data Release Frequency: Annually TSCA: Toxic Substances Control Act Toxic Substances Control Act. TSCA identifies manufacturers and importers of chemical substances included on the TSCA Chemical Substance Inventory list. It includes data on the production volume of these substances by plant site.
+Date of Government Version: 12/31/2006 Date Data Arrived at EDR: 09/29/2010 Date Made Active in Reports: 12/02/2010 Number of Days to Update: 64 Source: EPA Telephone: 202-260-5521 Last EDR
-Data Release Frequency: Quarterly FTTS INSP:  FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Cont rol Act)A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements.
+==Contact:==
-Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009
+/27/2011 Next Scheduled EDR
-Date Made Active in Reports: 05/11/2009
+==Contact:==
+/09/2012 Data Release Frequency: Every 4 Years FTTS: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act)
+FTTS tracks administrative cases and pesticide enforcement actions and compliance activities related to FIFRA, TSCA and EPCRA (Emergency Planning and Community Right-to-Know Act). To maintain currency, EDR contacts the Agency on a quarterly basis.
+Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA/Office of Prevention, Pesticides and Toxic Substances Telephone: 202-566-1667 Last EDR
-Number of Days to Update: 25 Source:  EPA Telephone:  202-566-1667
+==Contact:==
+/28/2011 Next Scheduled EDR
-Last EDR Contact: 11/28/2011
+==Contact:==
+/12/2012 Data Release Frequency: Quarterly FTTS INSP: FIFRA/ TSCA Tracking System - FIFRA (Federal Insecticide, Fungicide, & Rodenticide Act)/TSCA (Toxic Substances Control Act)
+A listing of FIFRA/TSCA Tracking System (FTTS) inspections and enforcements.
+Date of Government Version: 04/09/2009 Date Data Arrived at EDR: 04/16/2009 Date Made Active in Reports: 05/11/2009 Number of Days to Update: 25 Source: EPA Telephone: 202-566-1667 Last EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/28/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly HIST FTTS:  FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The
+==Contact:==
+/12/2012 Data Release Frequency: Quarterly HIST FTTS: FIFRA/TSCA Tracking System Administrative Case Listing A complete administrative case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated.
+TC3220399.2s Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA
+Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR
-(Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions
+==Contact:==
+/17/2007 Next Scheduled EDR
-are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters
+==Contact:==
+/17/2008 Data Release Frequency: No Update Planned HIST FTTS INSP: FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that may not be included in the newer FTTS database updates. This database is no longer updated.
+Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007 Date Made Active in Reports: 04/10/2007 Number of Days to Update: 40 Source: Environmental Protection Agency Telephone: 202-564-2501 Last EDR
-with updated records, it was decided to create a HIST FTTS database. It included records that may not be included
+==Contact:==
+/17/2008 Next Scheduled EDR
-in the newer FTTS database updates. This database is no longer updated.
+==Contact:==
-TC3220399.2s     Page GR-14 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007
+/17/2008 Data Release Frequency: No Update Planned SSTS: Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March 1st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices being produced, and those having been produced and sold or distributed in the past year.
+Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010 Date Made Active in Reports: 02/25/2011 Number of Days to Update: 77 Source: EPA Telephone: 202-564-4203 Last EDR
-Date Made Active in Reports: 04/10/2007
+==Contact:==
+/31/2011 Next Scheduled EDR
-Number of Days to Update: 40 Source:  Environmental Protection Agency Telephone:  202-564-2501
+==Contact:==
+/13/2012 Data Release Frequency: Annually ICIS: Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES) program.
+Date of Government Version: 01/07/2011 Date Data Arrived at EDR: 01/21/2011 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 59 Source: Environmental Protection Agency Telephone: 202-564-5088 Last EDR
-Last EDR Contact: 12/17/2007
+==Contact:==
+/26/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/17/2008
+==Contact:==
+/09/2012 Data Release Frequency: Quarterly PADS: PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers of PCBs who are required to notify the EPA of such activities.
+Date of Government Version: 11/01/2010 Date Data Arrived at EDR: 11/10/2010 Date Made Active in Reports: 02/16/2011 Number of Days to Update: 98 Source: EPA Telephone: 202-566-0500 Last EDR
-Data Release Frequency: No Update Planned HIST FTTS INSP:  FIFRA/TSCA Tracking System Inspection & Enforcement Case Listing A complete inspection and enforcement case listing from the FIFRA/TSCA Tracking System (FTTS) for all ten EPA
+==Contact:==
+/19/2011 Next Scheduled EDR
-regions. The information was obtained from the National Compliance Database (NCDB). NCDB supports the implementation
+==Contact:==
+/30/2012 Data Release Frequency: Annually MLTS: Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency, EDR contacts the Agency on a quarterly basis.
+Date of Government Version: 06/21/2011 Date Data Arrived at EDR: 07/15/2011 Date Made Active in Reports: 09/13/2011 Number of Days to Update: 60 Source: Nuclear Regulatory Commission Telephone: 301-415-7169 Last EDR
-of FIFRA (Federal Insecticide, Fungicide, and Rodenticide Act) and TSCA (Toxic Substances Control Act). Some
+==Contact:==
+/12/2011 Next Scheduled EDR
-EPA regions are now closing out records. Because of that, and the fact that some EPA regions are not providing
+==Contact:==
+/26/2011 Data Release Frequency: Quarterly TC3220399.2s Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-EPA Headquarters with updated records, it was decided to create a HIST FTTS database. It included records that
-may not be included in the newer FTTS database updates. This database is no longer updated.
-Date of Government Version: 10/19/2006 Date Data Arrived at EDR: 03/01/2007
-Date Made Active in Reports: 04/10/2007
-Number of Days to Update: 40 Source:  Environmental Protection Agency Telephone:  202-564-2501
-Last EDR Contact: 12/17/2008
-Next Scheduled EDR Contact: 03/17/2008
-Data Release Frequency: No Update Planned SSTS:  Section 7 Tracking Systems Section 7 of the Federal Insecticide, Fungicide and Rodenticide Act, as amended (92 Stat. 829) requires all
-registered pesticide-producing establishments to submit a report to the Environmental Protection Agency by March
-st each year. Each establishment must report the types and amounts of pesticides, active ingredients and devices
-being produced, and those having been produced and sold or distributed in the past year.
-Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 12/10/2010
-Date Made Active in Reports: 02/25/2011
-Number of Days to Update: 77 Source:  EPA Telephone:  202-564-4203
-Last EDR Contact: 10/31/2011
-Next Scheduled EDR Contact: 02/13/2012
-Data Release Frequency: Annually ICIS:  Integrated Compliance Information System The Integrated Compliance Information System (ICIS) supports the information needs of the national enforcement
-and compliance program as well as the unique needs of the National Pollutant Discharge Elimination System (NPDES)
-program.Date of Government Version: 01/07/2011 Date Data Arrived at EDR: 01/21/2011
-Date Made Active in Reports: 03/21/2011
-Number of Days to Update: 59 Source:  Environmental Protection Agency Telephone:  202-564-5088
-Last EDR Contact: 09/26/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Quarterly PADS:  PCB Activity Database System PCB Activity Database. PADS Identifies generators, transporters, commercial storers and/or brokers and disposers
-of PCB's who are required to notify the EPA of such activities.
-Date of Government Version: 11/01/2010 Date Data Arrived at EDR: 11/10/2010
-Date Made Active in Reports: 02/16/2011
-Number of Days to Update: 98 Source:  EPA Telephone:  202-566-0500
-Last EDR Contact: 10/19/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Annually MLTS:  Material Licensing Tracking System MLTS is maintained by the Nuclear Regulatory Commission and contains a list of approximately 8,100 sites which
-possess or use radioactive materials and which are subject to NRC licensing requirements. To maintain currency,
-EDR contacts the Agency on a quarterly basis.
-Date of Government Version: 06/21/2011 Date Data Arrived at EDR: 07/15/2011
-Date Made Active in Reports: 09/13/2011
-Number of Days to Update: 60 Source:  Nuclear Regulatory Commission Telephone:  301-415-7169
-Last EDR Contact: 09/12/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Quarterly TC3220399.2s     Page GR-15 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT RADINFO:  Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S.
+RADINFO: Radiation Information Database The Radiation Information Database (RADINFO) contains information about facilities that are regulated by U.S.
 Environmental Protection Agency (EPA) regulations for radiation and radioactivity.
-Date of Government Version: 01/11/2011 Date Data Arrived at EDR: 01/13/2011
+Date of Government Version: 01/11/2011 Date Data Arrived at EDR: 01/13/2011 Date Made Active in Reports: 02/16/2011 Number of Days to Update: 34 Source: Environmental Protection Agency Telephone: 202-343-9775 Last EDR
-Date Made Active in Reports: 02/16/2011
-Number of Days to Update: 34 Source:  Environmental Protection Agency Telephone:  202-343-9775
-Last EDR Contact: 10/13/2011
-Next Scheduled EDR Contact: 01/23/2012
-Data Release Frequency: Quarterly FINDS:  Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and 'pointers' to other sources that contain more
-detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric
-Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial
-enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal
-Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities
-Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System).
-Date of Government Version: 04/14/2010 Date Data Arrived at EDR: 04/16/2010
-Date Made Active in Reports: 05/27/2010
-Number of Days to Update: 41 Source:  EPA Telephone:  (312) 353-2000
+==Contact:==
+/13/2011 Next Scheduled EDR
-Last EDR Contact: 09/13/2011
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly FINDS: Facility Index System/Facility Registry System Facility Index System. FINDS contains both facility information and pointers to other sources that contain more detail. EDR includes the following FINDS databases in this report: PCS (Permit Compliance System), AIRS (Aerometric Information Retrieval System), DOCKET (Enforcement Docket used to manage and track information on civil judicial enforcement cases for all environmental statutes), FURS (Federal Underground Injection Control), C-DOCKET (Criminal Docket System used to track criminal enforcement actions for all environmental statutes), FFIS (Federal Facilities Information System), STATE (State Environmental Laws and Statutes), and PADS (PCB Activity Data System).
+Date of Government Version: 04/14/2010 Date Data Arrived at EDR: 04/16/2010 Date Made Active in Reports: 05/27/2010 Number of Days to Update: 41 Source: EPA Telephone: (312) 353-2000 Last EDR
-Next Scheduled EDR Contact: 12/26/2011
+==Contact:==
+/13/2011 Next Scheduled EDR
-Data Release Frequency: Quarterly RAATS:  RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA
+==Contact:==
+/26/2011 Data Release Frequency: Quarterly RAATS: RCRA Administrative Action Tracking System RCRA Administration Action Tracking System. RAATS contains records based on enforcement actions issued under RCRA pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources made it impossible to continue to update the information contained in the database.
+Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995 Date Made Active in Reports: 08/07/1995 Number of Days to Update: 35 Source: EPA Telephone: 202-564-4104 Last EDR
-pertaining to major violators and includes administrative and civil actions brought by the EPA. For administration
+==Contact:==
+/02/2008 Next Scheduled EDR
-actions after September 30, 1995, data entry in the RAATS database was discontinued. EPA will retain a copy of
+==Contact:==
+/01/2008 Data Release Frequency: No Update Planned BRS: Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG) and Treatment, Storage, and Disposal Facilities.
+Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 03/01/2011 Date Made Active in Reports: 05/02/2011 Number of Days to Update: 62 Source: EPA/NTIS Telephone: 800-424-9346 Last EDR
-the database for historical records. It was necessary to terminate RAATS because a decrease in agency resources
+==Contact:==
+/30/2011 Next Scheduled EDR
-made it impossible to continue to update the information contained in the database.
+==Contact:==
-Date of Government Version: 04/17/1995 Date Data Arrived at EDR: 07/03/1995
+/12/2012 Data Release Frequency: Biennially BRRTS: Bureau of Remediation & Redevelopment Tracking System TC3220399.2s Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Date Made Active in Reports: 08/07/1995
+BRRTS is a tracking system of contaminated sites. It holds key information for finding out more about a site or an activity. Activity types included are: Abandoned Container - An abandoned container with potentially hazardous contents recovered from a site. No discharge to the environment occurs. If the container did release a hazardous substance, a spill would be associated with the site. Superfund - is a federal program created by Congress in 1980 to finance cleanup of the nations worst hazardous waste sites. VPLE - Voluntary Property Liability Exemptions apply to sites in which a property owner conducts an environmental investigation and cleanup of an entire property and then receives limits on their future liability. General Property - Environmental actions which apply to the property as a whole, rather than a specific source of contamination, such as the LUST or environmental repair site. Examples would be off-site letters, municipal liability clarification letters, lease letters, voluntary party liability exemption actions, and general liability clarification letters.
+Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011 Date Made Active in Reports: 08/01/2011 Number of Days to Update: 11 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Number of Days to Update: 35 Source:  EPA Telephone:  202-564-4104
+==Contact:==
+/03/2011 Next Scheduled EDR
-Last EDR Contact: 06/02/2008
+==Contact:==
+/23/2012 Data Release Frequency: Quarterly NPDES: NPDES Permit Listing A listing of stormwater permit industrial facilities.
+Date of Government Version: 09/01/2011 Date Data Arrived at EDR: 09/01/2011 Date Made Active in Reports: 10/14/2011 Number of Days to Update: 43 Source: Department of Natural Resources Telephone: 608-264-8971 Last EDR
-Next Scheduled EDR Contact: 09/01/2008
+==Contact:==
+/30/2011 Next Scheduled EDR
-Data Release Frequency: No Update Planned BRS:  Biennial Reporting System The Biennial Reporting System is a national system administered by the EPA that collects data on the generation
+==Contact:==
+/12/2012 Data Release Frequency: Quarterly WI MANIFEST: Manifest Information Hazardous waste manifest information.
+Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/19/2011 Date Made Active in Reports: 09/15/2011 Number of Days to Update: 27 Source: Department of Natural Resources Telephone: N/A Last EDR
-and management of hazardous waste. BRS captures detailed data from two groups: Large Quantity Generators (LQG)
+==Contact:==
+/19/2011 Next Scheduled EDR
-and Treatment, Storage, and Disposal Facilities.
+==Contact:==
-Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 03/01/2011
+/02/2012 Data Release Frequency: Annually DRYCLEANERS: Five Star Recognition Program Sites Drycleaning facilities enrolled in the Five Star Recognition Program. The primary focus of the Five Star program is to encourage reductions in the use and emissions of perchloroethylene (perc), a common but potentially hazardous drycleaning solvent. Participating cleaners pursue recycling opportunities, spill prevention strategies, more efficient solvent use, and more wet cleaning to reduce their perc consumption.
+Date of Government Version: 10/05/2011 Date Data Arrived at EDR: 10/06/2011 Date Made Active in Reports: 10/25/2011 Number of Days to Update: 19 Source: Department of Natural Resources Telephone: 608-267-3125 Last EDR
-Date Made Active in Reports: 05/02/2011
+==Contact:==
+/23/2011 Next Scheduled EDR
-Number of Days to Update: 62 Source:  EPA/NTIS Telephone:  800-424-9346
+==Contact:==
+/02/2012 Data Release Frequency: Varies WRRSER: Wisconsin Remedial Response Site Evaluation Report The WRRSER provides information about location, status, and priority of sites or facilities in the state which are known to cause or have a high potential to cause environmental pollution.
+Date of Government Version: 10/01/1995 Date Data Arrived at EDR: 01/02/1996 Date Made Active in Reports: 02/01/1996 Number of Days to Update: 30 Source: Department of Natural Resources Telephone: 608-261-6422 Last EDR
-Last EDR Contact: 11/30/2011
+==Contact:==
+/03/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/16/2012 Data Release Frequency: No Update Planned AIRS: Air Permit Program Listing A listing of permits issued by the Air Permit Program.
+TC3220399.2s Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Data Release Frequency: Biennially BRRTS:  Bureau of Remediation & Redevelopment Tracking System TC3220399.2s     Page GR-16 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT BRRTS is a tracking system of contaminated sites. It holds key information for finding out more about a site or an activity. Activity types included are: Abandoned Container - An abandoned container with potentially hazardous
+Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/05/2011 Date Made Active in Reports: 09/15/2011 Number of Days to Update: 41 Source: Department of Natural Resources Telephone: 608-266-2621 Last EDR
-contents recovered from a site. No discharge to the environment occurs. If the container did release a hazardous
+==Contact:==
+/24/2011 Next Scheduled EDR
-substance, a spill would be associated with the site. Superfund - is a federal program created by Congress in
+==Contact:==
+/06/2012 Data Release Frequency: Annually TIER 2: Tier 2 Facility Listing A listing of facilities which store or manufacture hazardous materials that submit a chemical inventory report.
+Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/17/2010 Date Made Active in Reports: 09/29/2010 Number of Days to Update: 43 Source: Department of Natural Resources Telephone: 608-242-3225 Last EDR
-to finance cleanup of the nation's worst hazardous waste sites. VPLE - Voluntary Property Liability Exemptions
+==Contact:==
+/24/2011 Next Scheduled EDR
-apply to sites in which a property owner conducts an environmental investigation and cleanup of an entire property
+==Contact:==
+/06/2012 Data Release Frequency: Varies LEAD: Lead Inspection Data Lead inspection information.
+Date of Government Version: 04/29/2011 Date Data Arrived at EDR: 04/29/2011 Date Made Active in Reports: 06/06/2011 Number of Days to Update: 38 Source: Department of Health & Family Services Telephone: 608-267-0473 Last EDR
-and then receives limits on their future liability. General Property - Environmental actions which apply to the
+==Contact:==
+/25/2011 Next Scheduled EDR
-property as a whole, rather than a specific source of contamination, such as the LUST or environmental repair
+==Contact:==
+/09/2012 Data Release Frequency: Annually INDIAN RESERV: Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater than 640 acres.
+Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 12/08/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 34 Source: USGS Telephone: 202-208-3710 Last EDR
-site. Examples would be off-site letters, municipal liability clarification letters, lease letters, voluntary
+==Contact:==
+/20/2011 Next Scheduled EDR
-party liability exemption actions, and general liability clarification letters.
+==Contact:==
-Date of Government Version: 07/18/2011 Date Data Arrived at EDR: 07/21/2011
+/30/2012 Data Release Frequency: Semi-Annually SCRD DRYCLEANERS: State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas, Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin.
+Date of Government Version: 03/07/2011 Date Data Arrived at EDR: 03/09/2011 Date Made Active in Reports: 05/02/2011 Number of Days to Update: 54 Source: Environmental Protection Agency Telephone: 615-532-8599 Last EDR
-Date Made Active in Reports: 08/01/2011
+==Contact:==
+/24/2011 Next Scheduled EDR
-Number of Days to Update: 11 Source:  Department of Natural Resources Telephone:  608-261-6422
+==Contact:==
+/06/2012 Data Release Frequency: Varies FEDLAND: Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land, Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management, Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service.
+Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006 Date Made Active in Reports: 01/11/2007 Number of Days to Update: 339 Source: U.S. Geological Survey Telephone: 888-275-8747 Last EDR
-Last EDR Contact: 11/03/2011
+==Contact:==
+/20/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/23/2012
+==Contact:==
+/30/2012 Data Release Frequency: N/A COAL ASH EPA: Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings.
+TC3220399.2s Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Data Release Frequency: Quarterly NPDES:  NPDES Permit Listing A listing of stormwater permit industrial facilities.
+Date of Government Version: 08/17/2010 Date Data Arrived at EDR: 01/03/2011 Date Made Active in Reports: 03/21/2011 Number of Days to Update: 77 Source: Environmental Protection Agency Telephone: N/A Last EDR
-Date of Government Version: 09/01/2011 Date Data Arrived at EDR: 09/01/2011
-Date Made Active in Reports: 10/14/2011
+==Contact:==
+/16/2011 Next Scheduled EDR
-Number of Days to Update: 43 Source:  Department of Natural Resources Telephone:  608-264-8971
+==Contact:==
+/26/2011 Data Release Frequency: Varies FINANCIAL ASSURANCE 1: Financial Assurance Information Listing Financial Assurance information.
+Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 09/27/2011 Date Made Active in Reports: 10/14/2011 Number of Days to Update: 17 Source: Department of Natural Resources Telephone: 608-266-6965 Last EDR
-Last EDR Contact: 11/30/2011
+==Contact:==
+/26/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 03/12/2012
+==Contact:==
+/09/2012 Data Release Frequency: Varies COAL ASH: Coal Ash Disposal Site Listing A listing of coal combusion monofills.
+Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/18/2011 Date Made Active in Reports: 04/12/2011 Number of Days to Update: 25 Source: Deaprtment of Natural Resources Telephone: 608-267-3538 Last EDR
-Data Release Frequency: Quarterly WI MANIFEST:  Manifest Information Hazardous waste manifest information.
+==Contact:==
-Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/19/2011
+/03/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/15/2011
+==Contact:==
+/16/2012 Data Release Frequency: Varies PCB TRANSFORMER: PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals.
+Date of Government Version: 01/01/2008 Date Data Arrived at EDR: 02/18/2009 Date Made Active in Reports: 05/29/2009 Number of Days to Update: 100 Source: Environmental Protection Agency Telephone: 202-566-0517 Last EDR
-Number of Days to Update: 27 Source:  Department of Natural Resources Telephone:  N/A
+==Contact:==
+/04/2011 Next Scheduled EDR
-Last EDR Contact: 09/19/2011
+==Contact:==
+/13/2012 Data Release Frequency: Varies COAL ASH DOE: Sleam-Electric Plan Operation Data A listing of power plants that store ash in surface ponds.
+Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009 Date Made Active in Reports: 10/22/2009 Number of Days to Update: 76 Source: Department of Energy Telephone: 202-586-8719 Last EDR
-Next Scheduled EDR Contact: 01/02/2012
+==Contact:==
+/18/2011 Next Scheduled EDR
-Data Release Frequency: Annually DRYCLEANERS:  Five Star Recognition Program Sites Drycleaning facilities enrolled in the Five Star Recognition Program. The primary focus of the Five Star program
+==Contact:==
+/30/2012 Data Release Frequency: Varies FINANCIAL ASSURANCE 2: Financial Assurance Information Listing Information for underground storage tanks. Financial assurance is intended to ensure that resources are available to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated facility is unable or unwilling to pay.
+Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 10/19/2011 Date Made Active in Reports: 11/22/2011 Number of Days to Update: 34 Source: Department of Commerce Telephone: 608-266-0956 Last EDR
-is to encourage reductions in the use and emissions of perchloroethylene (perc), a common but potentially hazardous
+==Contact:==
+/26/2011 Next Scheduled EDR
-drycleaning solvent. Participating cleaners pursue recycling opportunities, spill prevention strategies, more
+==Contact:==
+/09/2012 Data Release Frequency: Varies EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas Plants: EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants) compiled by EDRs researchers. Manufactured gas sites were used in the United States from the 1800s to 1950s to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production, such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds are potentially hazardous to human health and the environment. The byproduct from this process was frequently disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil and groundwater contamination.
+TC3220399.2s Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-efficient solvent use, and more wet cleaning to reduce their perc consumption.
+Date of Government Version: N/A Date Data Arrived at EDR: N/A Date Made Active in Reports: N/A Number of Days to Update: N/A Source: EDR, Inc.
-Date of Government Version: 10/05/2011 Date Data Arrived at EDR: 10/06/2011
+Telephone: N/A Last EDR
-Date Made Active in Reports: 10/25/2011
+==Contact:==
+N/A Next Scheduled EDR
-Number of Days to Update: 19 Source:  Department of Natural Resources Telephone:  608-267-3125
+==Contact:==
+N/A Data Release Frequency: No Update Planned OTHER DATABASE(S)
+Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily mean that wetlands do not exist in the area covered by the report.
+CT MANIFEST: Hazardous Waste Manifest Data Facility and manifest data. Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a tsd facility.
+Date of Government Version: 12/31/2007 Date Data Arrived at EDR: 08/26/2009 Date Made Active in Reports: 09/11/2009 Number of Days to Update: 16 Source: Department of Environmental Protection Telephone: 860-424-3375 Last EDR
-Last EDR Contact: 09/23/2011
+==Contact:==
+/22/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/02/2012
+==Contact:==
+/05/2012 Data Release Frequency: Annually NJ MANIFEST: Manifest Information Hazardous waste manifest information.
+Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 07/20/2011 Date Made Active in Reports: 08/11/2011 Number of Days to Update: 22 Source: Department of Environmental Protection Telephone: N/A Last EDR
-Data Release Frequency: Varies WRRSER:  Wisconsin Remedial Response Site Evaluation Report The WRRSER provides information about location, status, and priority of sites or facilities in the state which
+==Contact:==
+/18/2011 Next Scheduled EDR
-are known to cause or have a high potential to cause environmental pollution.
+==Contact:==
-Date of Government Version: 10/01/1995 Date Data Arrived at EDR: 01/02/1996
+/30/2012 Data Release Frequency: Annually NY MANIFEST: Facility and Manifest Data Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a TSD facility.
+Date of Government Version: 08/01/2011 Date Data Arrived at EDR: 08/09/2011 Date Made Active in Reports: 09/16/2011 Number of Days to Update: 38 Source: Department of Environmental Conservation Telephone: 518-402-8651 Last EDR
-Date Made Active in Reports: 02/01/1996
+==Contact:==
+/08/2011 Next Scheduled EDR
-Number of Days to Update: 30 Source:  Department of Natural Resources Telephone:  608-261-6422
+==Contact:==
+/20/2012 Data Release Frequency: Annually PA MANIFEST: Manifest Information Hazardous waste manifest information.
+Date of Government Version: 12/31/2008 Date Data Arrived at EDR: 12/01/2009 Date Made Active in Reports: 12/14/2009 Number of Days to Update: 13 Source: Department of Environmental Protection Telephone: 717-783-8990 Last EDR
-Last EDR Contact: 10/03/2011
+==Contact:==
+/26/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 01/16/2012
+==Contact:==
+/09/2012 Data Release Frequency: Annually RI MANIFEST: Manifest information Hazardous waste manifest information Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 06/24/2011 Date Made Active in Reports: 06/30/2011 Number of Days to Update: 6 Source: Department of Environmental Management Telephone: 401-222-2797 Last EDR
-Data Release Frequency: No Update Planned AIRS:  Air Permit Program Listing A listing of permits issued by the Air Permit Program.
+==Contact:==
-TC3220399.2s     Page GR-17 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 08/05/2011
+/28/2011 Next Scheduled EDR
-Date Made Active in Reports: 09/15/2011
+==Contact:==
+/12/2012 Data Release Frequency: Annually TC3220399.2s Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Number of Days to Update: 41 Source:  Department of Natural Resources Telephone:  608-266-2621
+VT MANIFEST: Hazardous Waste Manifest Data Hazardous waste manifest information.
+Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/26/2011 Date Made Active in Reports: 09/14/2011 Number of Days to Update: 19 Source: Department of Environmental Conservation Telephone: 802-241-3443 Last EDR
-Last EDR Contact: 10/24/2011
+==Contact:==
+/24/2011 Next Scheduled EDR
-Next Scheduled EDR Contact: 02/06/2012
+==Contact:==
+/06/2012 Data Release Frequency: Annually Oil/Gas Pipelines:
-Data Release Frequency: Annually TIER 2:  Tier 2 Facility Listing A listing of facilities which store or manufacture hazardous materials that submit a chemical inventory report.
+This data was obtained by EDR from the USGS in 1994. It is referred to by USGS as GeoData Digital Line Graphs from 1:100,000-Scale Maps. It was extracted from the transportation category including some oil, but primarily gas pipelines.
-Date of Government Version: 12/31/2009 Date Data Arrived at EDR: 08/17/2010
+Electric Power Transmission Line Data Source: Rextag Strategies Corp.
+Telephone: (281) 769-2247 U.S. Electric Transmission and Power Plants Systems Digital GIS Data Sensitive Receptors:
-Date Made Active in Reports: 09/29/2010
+There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivity to environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the location of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers, and nursing homes - where individuals who are sensitive receptors are likely to be located.
-Number of Days to Update: 43 Source:  Department of Natural Resources Telephone:  608-242-3225
-Last EDR Contact: 10/24/2011
-Next Scheduled EDR Contact: 02/06/2012
-Data Release Frequency: Varies LEAD:  Lead Inspection Data Lead inspection information.
-Date of Government Version: 04/29/2011 Date Data Arrived at EDR: 04/29/2011
-Date Made Active in Reports: 06/06/2011
-Number of Days to Update: 38 Source:  Department of Health & Family Services Telephone:  608-267-0473
-Last EDR Contact: 10/25/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Annually INDIAN RESERV:  Indian Reservations This map layer portrays Indian administered lands of the United States that have any area equal to or greater
-than 640 acres.
-Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 12/08/2006
-Date Made Active in Reports: 01/11/2007
-Number of Days to Update: 34 Source:  USGS Telephone:  202-208-3710
-Last EDR Contact: 10/20/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Semi-Annually SCRD DRYCLEANERS:  State Coalition for Remediation of Drycleaners Listing The State Coalition for Remediation of Drycleaners was established in 1998, with support from the U.S. EPA Office
-of Superfund Remediation and Technology Innovation. It is comprised of representatives of states with established
-drycleaner remediation programs. Currently the member states are Alabama, Connecticut, Florida, Illinois, Kansas,
-Minnesota, Missouri, North Carolina, Oregon, South Carolina, Tennessee, Texas, and Wisconsin.
-Date of Government Version: 03/07/2011 Date Data Arrived at EDR: 03/09/2011
-Date Made Active in Reports: 05/02/2011
-Number of Days to Update: 54 Source:  Environmental Protection Agency Telephone:  615-532-8599
-Last EDR Contact: 10/24/2011
-Next Scheduled EDR Contact: 02/06/2012
-Data Release Frequency: Varies FEDLAND:  Federal and Indian Lands Federally and Indian administrated lands of the United States. Lands included are administrated by: Army Corps
-of Engineers, Bureau of Reclamation, National Wild and Scenic River, National Wildlife Refuge, Public Domain Land,
-Wilderness, Wilderness Study Area, Wildlife Management Area, Bureau of Indian Affairs, Bureau of Land Management,
-Department of Justice, Forest Service, Fish and Wildlife Service, National Park Service.
-Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 02/06/2006
-Date Made Active in Reports: 01/11/2007
-Number of Days to Update: 339 Source:  U.S. Geological Survey Telephone:  888-275-8747
-Last EDR Contact: 10/20/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: N/A COAL ASH EPA:  Coal Combustion Residues Surface Impoundments List A listing of coal combustion residues surface impoundments with high hazard potential ratings.
-TC3220399.2s     Page GR-18 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: 08/17/2010 Date Data Arrived at EDR: 01/03/2011
-Date Made Active in Reports: 03/21/2011
-Number of Days to Update: 77 Source:  Environmental Protection Agency Telephone:  N/A
-Last EDR Contact: 09/16/2011
-Next Scheduled EDR Contact: 12/26/2011
-Data Release Frequency: Varies FINANCIAL ASSURANCE 1:  Financial Assurance Information Listing Financial Assurance information.
-Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 09/27/2011
-Date Made Active in Reports: 10/14/2011
-Number of Days to Update: 17 Source:  Department of Natural Resources Telephone:  608-266-6965
-Last EDR Contact: 09/26/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Varies COAL ASH:  Coal Ash Disposal Site Listing A listing of coal combusion monofills.
-Date of Government Version: 03/16/2011 Date Data Arrived at EDR: 03/18/2011
-Date Made Active in Reports: 04/12/2011
-Number of Days to Update: 25 Source:  Deaprtment of Natural Resources Telephone:  608-267-3538
-Last EDR Contact: 10/03/2011
-Next Scheduled EDR Contact: 01/16/2012
-Data Release Frequency: Varies PCB TRANSFORMER:  PCB Transformer Registration Database The database of PCB transformer registrations that includes all PCB registration submittals.
-Date of Government Version: 01/01/2008 Date Data Arrived at EDR: 02/18/2009
-Date Made Active in Reports: 05/29/2009
-Number of Days to Update: 100 Source:  Environmental Protection Agency Telephone:  202-566-0517
-Last EDR Contact: 11/04/2011
-Next Scheduled EDR Contact: 02/13/2012
-Data Release Frequency: Varies COAL ASH DOE:  Sleam-Electric Plan Operation Data A listing of power plants that store ash in surface ponds.
-Date of Government Version: 12/31/2005 Date Data Arrived at EDR: 08/07/2009
-Date Made Active in Reports: 10/22/2009
-Number of Days to Update: 76 Source:  Department of Energy Telephone:  202-586-8719
-Last EDR Contact: 10/18/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Varies FINANCIAL ASSURANCE 2:  Financial Assurance Information Listing Information for underground storage tanks. Financial assurance is intended to ensure that resources are available
-to pay for the cost of closure, post-closure care, and corrective measures if the owner or operator of a regulated
-facility is unable or unwilling to pay.
-Date of Government Version: 09/26/2011 Date Data Arrived at EDR: 10/19/2011
-Date Made Active in Reports: 11/22/2011
-Number of Days to Update: 34 Source:  Department of Commerce Telephone:  608-266-0956
-Last EDR Contact: 09/26/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Varies EDR PROPRIETARY RECORDS EDR Proprietary Records Manufactured Gas Plants:  EDR Proprietary Manufactured Gas Plants The EDR Proprietary Manufactured Gas Plant Database includes records of coal gas plants (manufactured gas plants)
-compiled by EDR's researchers. Manufactured gas sites were used in the United States from the 1800's to 1950's
-to produce a gas that could be distributed and used as fuel. These plants used whale oil, rosin, coal, or a mixture
-of coal, oil, and water that also produced a significant amount of waste. Many of the byproducts of the gas production,
-such as coal tar (oily waste containing volatile and non-volatile chemicals), sludges, oils and other compounds
-are potentially hazardous to human health and the environment. The byproduct from this process was frequently
-disposed of directly at the plant site and can remain or spread slowly, serving as a continuous source of soil
-and groundwater contamination.
-TC3220399.2s     Page GR-19 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT Date of Government Version: N/A Date Data Arrived at EDR: N/A
-Date Made Active in Reports: N/A
-Number of Days to Update: N/A Source:  EDR, Inc.
-Telephone:  N/A
-Last EDR Contact: N/A
-Next Scheduled EDR Contact: N/A
-Data Release Frequency: No Update Planned OTHER DATABASE(S)
-Depending on the geographic area covered by this report, the data provided in these specialty databases may or may not be complete. For example, the existence of wetlands information data in a specific report does not mean that all wetlands in the
-area covered by the report are included. Moreover, the absence of any reported wetlands information does not necessarily
-mean that wetlands do not exist in the area covered by the report.
-CT MANIFEST:  Hazardous Waste Manifest Data Facility and manifest data. Manifest is a document that lists and tracks hazardous waste from the generator through
-transporters to a tsd facility.
-Date of Government Version: 12/31/2007 Date Data Arrived at EDR: 08/26/2009
-Date Made Active in Reports: 09/11/2009
-Number of Days to Update: 16 Source:  Department of Environmental Protection Telephone:  860-424-3375
-Last EDR Contact: 11/22/2011
-Next Scheduled EDR Contact: 03/05/2012
-Data Release Frequency: Annually NJ MANIFEST:  Manifest Information Hazardous waste manifest information.
-Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 07/20/2011
-Date Made Active in Reports: 08/11/2011
-Number of Days to Update: 22 Source:  Department of Environmental Protection Telephone:  N/A
-Last EDR Contact: 10/18/2011
-Next Scheduled EDR Contact: 01/30/2012
-Data Release Frequency: Annually NY MANIFEST:  Facility and Manifest Data Manifest is a document that lists and tracks hazardous waste from the generator through transporters to a TSD
-facility.
-Date of Government Version: 08/01/2011 Date Data Arrived at EDR: 08/09/2011
-Date Made Active in Reports: 09/16/2011
-Number of Days to Update: 38 Source:  Department of Environmental Conservation Telephone:  518-402-8651
-Last EDR Contact: 11/08/2011
-Next Scheduled EDR Contact: 02/20/2012
-Data Release Frequency: Annually PA MANIFEST:  Manifest Information Hazardous waste manifest information.
-Date of Government Version: 12/31/2008 Date Data Arrived at EDR: 12/01/2009
-Date Made Active in Reports: 12/14/2009
-Number of Days to Update: 13 Source:  Department of Environmental Protection Telephone:  717-783-8990
-Last EDR Contact: 09/26/2011
-Next Scheduled EDR Contact: 01/09/2012
-Data Release Frequency: Annually RI MANIFEST:  Manifest information Hazardous waste manifest information Date of Government Version: 12/31/2010 Date Data Arrived at EDR: 06/24/2011
-Date Made Active in Reports: 06/30/2011
-Number of Days to Update: 6 Source:  Department of Environmental Management Telephone:  401-222-2797
-Last EDR Contact: 11/28/2011
-Next Scheduled EDR Contact: 03/12/2012
-Data Release Frequency: Annually TC3220399.2s     Page GR-20 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT VT MANIFEST:  Hazardous Waste Manifest Data Hazardous waste manifest information.
-Date of Government Version: 08/11/2011 Date Data Arrived at EDR: 08/26/2011
-Date Made Active in Reports: 09/14/2011
-Number of Days to Update: 19 Source:  Department of Environmental Conservation Telephone:  802-241-3443
-Last EDR Contact: 10/24/2011
-Next Scheduled EDR Contact: 02/06/2012
-Data Release Frequency: AnnuallyOil/Gas Pipelines:This data was obtained by EDR from the USGS in 1994. It is referred to by USGS as GeoData Digital Line Graphs from 1:100,000-Scale Maps. It was extracted from the transportation category including some oil, but primarily
-gas pipelines.
-Electric Power Transmission Line Data Source:  Rextag Strategies Corp.
-Telephone: (281) 769-2247
-U.S. Electric Transmission and Power Plants Systems Digital GIS DataSensitive Receptors:There are individuals deemed sensitive receptors due to their fragile immune systems and special sensitivit yto environmental discharges. These sensitive receptors typically include the elderly, the sick, and children. While the locat ion of all sensitive receptors cannot be determined, EDR indicates those buildings and facilities - schools, daycares, hospitals, medical centers,and nursing homes - where individuals who are sensitive receptors are likely to be located.
 AHA Hospitals:
 Source: American Hospital Association, Inc.
+Telephone: 312-280-5991 The database includes a listing of hospitals based on the American Hospital Associations annual survey of hospitals.
+Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services Telephone: 410-786-3000 A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services, a federal agency within the U.S. Department of Health and Human Services.
+Nursing Homes Source: National Institutes of Health Telephone: 301-594-6248 Information on Medicare and Medicaid certified nursing homes in the United States.
+Public Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics primary database on elementary and secondary public education in the United States. It is a comprehensive, annual, national statistical database of all public elementary and secondary schools and school districts, which contains data that are comparable across all states.
+Private Schools Source: National Center for Education Statistics Telephone: 202-502-7300 The National Center for Education Statistics primary database on private school locations in the United States.
+Daycare Centers: Day Care Directory Source: Department of Health & Family Services Telephone: 608-266-9314 Flood Zone Data:
+This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.
+NWI:
+National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
+Scanned Digital USGS 7.5 Topographic Map (DRG)
+Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
+TC3220399.2s Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-Telephone: 312-280-5991
+STREET AND ADDRESS INFORMATION
+&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
+TC3220399.2s Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT
-The database includes a listing of hospitals based on the American Hospital Association's annual survey of hospitals.
+TC3220399.2s Page A-1 geologic strata.
-Medical Centers: Provider of Services Listing Source: Centers for Medicare & Medicaid Services
+of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics
-Telephone: 410-786-3000
-A listing of hospitals with Medicare provider number, produced by Centers of Medicare & Medicaid Services,
-a federal agency within the U.S. Department of Health and Human Services.
-Nursing Homes Source: National Institutes of Health
-Telephone: 301-594-6248
-Information on Medicare and Medicaid certified nursing homes in the United States.
-Public Schools Source: National Center for Education Statistics
-Telephone: 202-502-7300
-The National Center for Education Statistics' primary database on elementary
-and secondary public education in the United States. It is a comprehensive, annual, national statistical
-database of all public elementary and secondary schools and school districts, which contains data that are
-comparable across all states.
-Private Schools Source: National Center for Education Statistics
-Telephone: 202-502-7300
-The National Center for Education Statistics' primary database on private school locations in the United States.
-Daycare Centers: Day Care Directory Source: Department of Health & Family Services
-Telephone: 608-266-9314Flood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
-Scanned Digital USGS 7.5' Topographic Map (DRG)
-Source: United States Geologic Survey
-A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images
-are made by scanning published paper maps on high-resolution scanners. The raster image
-is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
-TC3220399.2s     Page GR-21 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT STREET AND ADDRESS INFORMATION
-&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
-TC3220399.2s     Page GR-22 GOVERNMENT RECORDS SEARCHED / DATA CURRENCY TRACKING DRAFT TC3220399.2s   Page A-1 geologic strata.
-of the soil, and nearby wells. Groundwater flow velocity is generally impacted by the nature of the
-Groundwater flow direction may be impacted by surface topography, hydrology, hydrogeology, characteristics
 : 2. Groundwater flow velocity.
 : 1. Groundwater flow direction, and Assessment of the impact of contaminant migration generally has two principle investigative components:
 forming an opinion about the impact of potential contaminant migration.
-EDR's GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1991Most Recent Revision:
+EDRs GeoCheck Physical Setting Source Addendum is provided to assist the environmental professional in 1991 Most Recent Revision:
 -E5 STEVENS POINT, WI West Map:
 Most Recent Revision:
 -D5 WHITING, WI Southwest Map:
 Most Recent Revision:
 -D4 ARNOTT, WI South Map:
 Most Recent Revision:
 -E4 POLONIA, WI Target Property Map:
 USGS TOPOGRAPHIC MAP 1113 ft. above sea level Elevation:
 4931000.0 UTM Y (Meters):
-.3UTM X (Meters):
+.3 UTM X (Meters):
-Zone 16Universal Tranverse Mercator:
+Zone 16 Universal Tranverse Mercator:
-.4959 - 89 29' 45.3''
+.4959 - 89 29 45.3 Longitude (West):
-Longitude (West):
+.50700 - 44 30 25.2 Latitude (North):
-.50700 - 44 30' 25.2''
+TARGET PROPERTY COORDINATES STEVENS POINT, WI 54482 LANDS END WAY, SHINE MEDICAL STEVENS POINT, WI TARGET PROPERTY ADDRESS
-Latitude (North):
-TARGET PROPERTY COORDINATES STEVENS POINT, WI 54482 LANDS END WAY,
-SHINE MEDICAL STEVENS POINT, WI TARGET PROPERTY ADDRESSGEOCHECK   - PHYSICAL SETTING SOURCE ADDENDUMDRAFT TC3220399.2s   Page A-2 should be field verified.
+GEOCHECK - PHYSICAL SETTING SOURCE ADDENDUM
-on a relative (not an absolute) basis. Relative elevation information between sites of close proximity
-Source: Topography has been determined from the USGS 7.5' Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)
+DRAFT
+TC3220399.2s Page A-2 should be field verified.
+on a relative (not an absolute) basis. Relative elevation information between sites of close proximity Source: Topography has been determined from the USGS 7.5 Digital Elevation Model and should be evaluated SURROUNDING TOPOGRAPHY: ELEVATION PROFILES Elevation (ft)
 Elevation (ft)
-TPTP01/21 MilesTarget Property Elevation: 1113 ft.NorthSouthWestEast1106110711081110 111011111111 111111111113 111311141115111411131113 1113111211121105110511071108110911101111 111111111113 111311141115111611181120112111241125General SW General Topographic Gradient:
+TP TP 0
+/2 1 Miles Target Property Elevation: 1113 ft.
+North South West East 1106 1107 1108 1110 1110 1111 1111 1111 1111 1113 1113 1114 1115 1114 1113 1113 1113 1112 1112 1105 1105 1107 1108 1109 1110 1111 1111 1111 1113 1113 1114 1115 1116 1118 1120 1121 1124 1125 General SW General Topographic Gradient:
 TARGET PROPERTY TOPOGRAPHY should contamination exist on the target property, what downgradient sites might be impacted.
-assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or,
+assist the environmental professional in forming an opinion about the impact of nearby contaminated properties or, Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).
+sources of information, such as surface topographic information, hydrologic information, hydrogeologic data using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATION
-Surface topography may be indicative of the direction of surficial groundwater flow. This information can be used to TOPOGRAPHIC INFORMATION collected on nearby properties, and regional groundwater flow information (from deep aquifers).
+GEOCHECK - PHYSICAL SETTING SOURCE
-sources of information, such as surface topographic information, hydrologic information, hydrogeologic data
+==SUMMARY==
+DRAFT
-using site-specific well data. If such data is not reasonably ascertainable, it may be necessary to rely on other
+TC3220399.2s Page A-3 Not Reported GENERAL DIRECTION LOCATION GROUNDWATER FLOW FROM TP MAP ID hydrogeologically, and the depth to water table.
+authorities at select sites and has extracted the date of the report, groundwater flow direction as determined flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW Search Radius: 1.000 Mile.
-Groundwater flow direction for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW DIRECTION INFORMATIONGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s   Page A-3 Not Reported GENERAL DIRECTION LOCATIONGROUNDWATER FLOW FROM TPMAP IDhydrogeologically, and the depth to water table.
-authorities at select sites and has extracted the date of the report, groundwater flow direction as determined
-flow at specific points. EDR has reviewed reports submitted by environmental professionals to regulatory
-EDR has developed the AQUIFLOW Information System to provide data on the general direction of groundwater AQUIFLOW Search Radius: 1.000 Mile.
 Not found Status:
 .25 miles Search Radius:
 Site-Specific Hydrogeological Data*:
-* &#xa9;1996 Sitespecific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the inform ation and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation.
+* &#xa9;1996 Site&#xed;specific hydrogeological data gathered by CERCLIS Alerts, Inc., Bainbridge Island, WA. All rights reserved. All of the information and opinions presented are those of the cited EPA report(s), which were completed under a Comprehensive Environmental Response Compensation and Liability Information System (CERCLIS) investigation.
 contamination exist on the target property, what downgradient sites might be impacted.
-environmental professional in forming an opinion about the impact of nearby contaminated properties or, should
+environmental professional in forming an opinion about the impact of nearby contaminated properties or, should of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail Map NOT AVAILABLE NATIONAL WETLAND INVENTORY NWI Electronic Data Coverage NWI Quad at Target Property Not Reported Additional Panels in search area:
+C - FEMA DFIRM Flood data Flood Plain Panel at Target Property:
-of groundwater flow direction in the immediate area. Such hydrogeologic information can be used to assist the
-Hydrogeologic information obtained by installation of wells on a specific site can often be an indicator HYDROGEOLOGIC INFORMATION YES - refer to the Overview Map and Detail Map NOT AVAILABLE NATIONAL WETLAND INVENTORY NWI Electronic Data Coverage NWI Quad at Target Property Not Reported Additional Panels in search area:
-C  - FEMA DFIRM Flood data Flood Plain Panel at Target Property:
 YES - refer to the Overview Map and Detail Map PORTAGE, WI FEMA FLOOD ZONE FEMA Flood Electronic Data Target Property County and bodies of water).
 Refer to the Physical Setting Source Map following this summary for hydrologic information (major waterways contamination exist on the target property, what downgradient sites might be impacted.
-the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should
+the environmental professional in forming an opinion about the impact of nearby contaminated properties or, should Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATION
+GEOCHECK - PHYSICAL SETTING SOURCE
-Surface water can act as a hydrologic barrier to groundwater flow. Such hydrologic information can be used to assist HYDROLOGIC INFORMATIONGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s   Page A-4 Map, USGS Digital Data Series DDS - 11 (1994).
+==SUMMARY==
-of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman
+DRAFT
-Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, GeologyROCK STRATIGRAPHIC UNITGEOLOGIC AGE IDENTIFICATION Stratified Sequence Category:
+TC3220399.2s Page A-4 Map, USGS Digital Data Series DDS - 11 (1994).
-Paleozoic Era:CambrianSystem:CambrianSeries:CCode:   (decoded above as Era, System & Series) at which contaminant migration may be occurring.
+of the Conterminous U.S. at 1:2,500,000 Scale - a digital representation of the 1974 P.B. King and H.M. Beikman Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology ROCK STRATIGRAPHIC UNIT GEOLOGIC AGE IDENTIFICATION Stratified Sequence Category:
+Paleozoic Era:
+Cambrian System:
+Cambrian Series:
+C Code:
+(decoded above as Era, System & Series) at which contaminant migration may be occurring.
 Geologic information can be used by the environmental professional in forming an opinion about the relative speed GEOLOGIC INFORMATION IN GENERAL AREA OF TARGET PROPERTY move more quickly through sandy-gravelly types of soils than silty-clayey types of soils.
+characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATION
-characteristics data collected on nearby properties and regional soil information. In general, contaminant plumes
+GEOCHECK - PHYSICAL SETTING SOURCE
-to rely on other sources of information, including geologic age identification, rock stratigraphic unit and soil
+==SUMMARY==
+DRAFT
-using site specific geologic and soil strata data. If such data are not reasonably ascertainable, it may be necessary
-Groundwater flow velocity information for a particular site is best determined by a qualified environmental professional GROUNDWATER FLOW VELOCITY INFORMATIONGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT EDR Inc.EDR Inc.
 EDR Inc.
 EDR Inc.
@@ Line 2,257: / Line 1,740: @@
 EDR Inc.
 EDR Inc.
-EDR Inc.1230  1/16  1/8 1/4 Miles DRAFT TC3220399.2s   Page A-6 Well drained Soil Drainage Class:
+EDR Inc.
+EDR Inc.
+EDR Inc.
+2
+0
+/16 1/8 1/4 Miles DRAFT
+TC3220399.2s Page A-6 Well drained Soil Drainage Class:
 textures.
-moderately well and well drained soils with moderately coarse
+moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
-Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
 sandy loam Soil Surface Texture:
-BillettSoil Component Name:
+Billett Soil Component Name:
-Soil Map ID: 2 Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sand59 inches 40 inches 5Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 40 inches 33 inches 4Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported sandy loam 33 inches 27 inches 3Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 27 inches 7 inches 2Min: 6.1Max: 7.3Min: 42Max: 141Not reported Not reported loamy sand 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
+Soil Map ID: 2 Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported sand 59 inches 40 inches 5
+Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 40 inches 33 inches 4
-conductivity
+Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported sandy loam 33 inches 27 inches 3
+Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 27 inches 7 inches 2
-micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
+Min: 6.1 Max: 7.3 Min: 42 Max: 141 Not reported Not reported loamy sand 7 inches 0 inches 1
+Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)
+> 0 inches Depth to Watertable Min:
 > 0 inches Depth to Bedrock Min:
-LowCorrosion Potential - Uncoated Steel:
+Low Corrosion Potential - Uncoated Steel:
 Hydric Status: Not hydric Somewhat excessively drained Soil Drainage Class:
 excessively drained sands and gravels.
 Class A - High infiltration rates. Soils are deep, well drained to Hydrologic Group:
 loamy sand Soil Surface Texture:
-RichfordSoil Component Name:
+Richford Soil Component Name:
 Soil Map ID: 1 in a landscape. The following information is based on Soil Conservation Service SSURGO data.
-for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns
+for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information The U.S. Department of Agricultures (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTY
-Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information
+GEOCHECK - PHYSICAL SETTING SOURCE
-The U.S. Department of Agriculture's (USDA) Soil Conservation Service (SCS) leads the National Cooperative Soil DOMINANT SOIL COMPOSITION IN GENERAL AREA OF TARGET PROPERTYGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s   Page A-7 Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported loam 7 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
+==SUMMARY==
+DRAFT
-conductivity
+TC3220399.2s Page A-7 Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported loam 7 inches 0 inches 1
+Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)
-micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
+> 0 inches Depth to Watertable Min:
 > 0 inches Depth to Bedrock Min:
-LowCorrosion Potential - Uncoated Steel:
+Low Corrosion Potential - Uncoated Steel:
 Hydric Status: Not hydric Well drained Soil Drainage Class:
 textures.
-moderately well and well drained soils with moderately coarse
+moderately well and well drained soils with moderately coarse Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
+loam Soil Surface Texture:
+Rosholt Soil Component Name:
+Soil Map ID: 3 Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported loamy sand 59 inches 33 inches 4
+Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported loamy sand 33 inches 27 inches 3
+Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported sandy loam 27 inches 9 inches 2
+Min: 5.1 Max: 7.8 Min: 42 Max: 141 Not reported Not reported sandy loam 9 inches 0 inches 1
+Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)
+> 0 inches Depth to Watertable Min:
+> 0 inches Depth to Bedrock Min:
+Low Corrosion Potential - Uncoated Steel:
+Hydric Status: Not hydric
+GEOCHECK - PHYSICAL SETTING SOURCE
+==SUMMARY==
+DRAFT
+TC3220399.2s Page A-8 1/2 - 1 Mile SSW USGS2429210 16 1/2 - 1 Mile South USGS2429203 15 1/2 - 1 Mile WSW USGS2429044 14 1/2 - 1 Mile South USGS2429204 13 1/2 - 1 Mile NE USGS2429102 12 1/2 - 1 Mile WNW USGS2429076 11 1/2 - 1 Mile West USGS2429070 10 1/2 - 1 Mile West USGS2429067 9
+/2 - 1 Mile SSE USGS2429032 A7 1/2 - 1 Mile SSE USGS2429033 A6 1/2 - 1 Mile SE USGS2429047 5
+/2 - 1 Mile North USGS2429094 4
+/2 - 1 Mile ENE USGS2429073 3
+/2 - 1 Mile West USGS2429066 2
+/4 - 1/2 Mile SSW USGS2429048 1
+FEDERAL USGS WELL INFORMATION LOCATION FROM TP WELL ID MAP ID 1.000 State Database Nearest PWS within 1 mile Federal FRDS PWS 1.000 Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)
+DATABASE opinion about the impact of contaminant migration on nearby drinking water wells.
+professional in assessing sources that may impact ground water flow direction, and in forming an EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported to gravel stratified sand 59 inches 33 inches 5
+Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported sand gravelly loamy 33 inches 27 inches 4
+Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported sandy loam gravelly fine 27 inches 12 inches 3
+Min: 5.1 Max: 6.5 Min: 42 Max: 141 Not reported Not reported fine sandy loam 12 inches 7 inches 2
+Soil Layer Information Boundary Classification Saturated hydraulic conductivity micro m/sec Layer Upper Lower Soil Texture Class AASHTO Group Unified Soil Soil Reaction (pH)
-Class B - Moderate infiltration rates. Deep and moderately deep, Hydrologic Group:
+GEOCHECK - PHYSICAL SETTING SOURCE
-loamSoil Surface Texture:
-RosholtSoil Component Name:
-Soil Map ID: 3 Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 59 inches 33 inches 4Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported loamy sand 33 inches 27 inches 3Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 27 inches 9 inches 2Min: 5.1Max: 7.8Min: 42Max: 141Not reported Not reported sandy loam 9 inches 0 inches 1Soil Layer InformationBoundaryClassification Saturated hydraulic
-conductivity
+==SUMMARY==
+DRAFT
-micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)> 0 inches Depth to Watertable Min:
+TC3220399.2s Page A-9 1/2 - 1 Mile WSW WI3000000008386 8
-> 0 inches Depth to Bedrock Min:
+STATE DATABASE WELL INFORMATION LOCATION FROM TP WELL ID MAP ID Note: PWS System location is not always the same as well location.
-LowCorrosion Potential - Uncoated Steel:
+No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATION FROM TP WELL ID MAP ID 1/2 - 1 Mile SSW USGS2429138 20 1/2 - 1 Mile ENE USGS2429081 B19 1/2 - 1 Mile ENE USGS2429083 B18 1/2 - 1 Mile ENE USGS2429082 B17 FEDERAL USGS WELL INFORMATION LOCATION FROM TP WELL ID MAP ID
-Hydric Status: Not hydricGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s   Page A-8 1/2 - 1 Mile SSW USGS2429210 161/2 - 1 Mile South USGS2429203 151/2 - 1 Mile WSW USGS2429044 141/2 - 1 Mile South USGS2429204 131/2 - 1 Mile NE USGS2429102 121/2 - 1 Mile WNW USGS2429076 111/2 - 1 Mile West USGS2429070 101/2 - 1 Mile West USGS2429067 91/2 - 1 Mile SSE USGS2429032 A71/2 - 1 Mile SSE USGS2429033 A61/2 - 1 Mile SE USGS2429047 51/2 - 1 Mile North USGS2429094 41/2 - 1 Mile ENE USGS2429073 31/2 - 1 Mile West USGS2429066 21/4 - 1/2 Mile SSW USGS2429048 1FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP ID1.000State Database Nearest PWS within 1 mile Federal FRDS PWS 1.000Federal USGS WELL SEARCH DISTANCE INFORMATION SEARCH DISTANCE (miles)
-DATABASEopinion about the impact of contaminant migration on nearby drinking water wells.
-professional in assessing sources that may impact ground water flow direction, and in forming an
-EDR Local/Regional Water Agency records provide water well information to assist the environmental LOCAL / REGIONAL WATER AGENCY RECORDS Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported to gravel stratified sand 59 inches 33 inches 5Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandgravelly loamy 33 inches 27 inches 4Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported sandy loam gravelly fine 27 inches 12 inches 3Min: 5.1Max: 6.5Min: 42Max: 141Not reported Not reported fine sandy loam 12 inches 7 inches 2Soil Layer InformationBoundaryClassification Saturated hydraulic
+GEOCHECK - PHYSICAL SETTING SOURCE
-conductivity
+==SUMMARY==
+DRAFT
-micro m/secLayerUpperLowerSoil Texture ClassAASHTO GroupUnified SoilSoil Reaction (pH)GEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT TC3220399.2s   Page A-9 1/2 - 1 Mile WSW WI3000000008386 8STATE DATABASE WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDNote: PWS System location is not always the same as well location.
+PHYSICAL SETTING SOURCE MAP-3220399.2s N County Boundary N
-No PWS System Found FEDERAL FRDS PUBLIC WATER SUPPLY SYSTEM INFORMATION LOCATIONFROM TPWELL IDMAP ID1/2 - 1 Mile SSW USGS2429138 201/2 - 1 Mile ENE USGS2429081 B191/2 - 1 Mile ENE USGS2429083 B181/2 - 1 Mile ENE USGS2429082 B17FEDERAL USGS WELL INFORMATION LOCATIONFROM TPWELL IDMAP IDGEOCHECK   - PHYSICAL SETTING SOURCE SUMMARYDRAFT PHYSICAL SETTING SOURCE MAP-3220399.2s N County Boundary N Major Roads N Contour Lines @ Earthquake epicenter, Richw 5 or greater  Wa1BI'Wells Public Water Supply W*lls Cluster of Multiple Icons SITE NAME: SHINE Medical Stevens Point, WI ADDRESS: Lands End Way, Stevens Point WI 54482 LAT/LONG: 44.5070/89.4959 0 1/4 112 + Groundwater Flow Direction
+Major Roads N
+Contour Lines
+@ Earthquake epicenter, Richw 5 or greater Wa1BI'Wells Public Water Supply W*lls
+~ Cluster of Multiple Icons SITE NAME: SHINE Medical Stevens Point, WI ADDRESS:
+Lands End Way, Stevens Point WI 54482 LAT/LONG: 44.5070/89.4959 0
+/4 112
++ Groundwater Flow Direction
 @I) lndetarrninata Groundwa1ar Flow at Location (ill Grol.ndwatlr Flow Varies at Location
-<HID Closest Hydrogeological Data ' i:l : Golder Associates CONTACT:
+<HID Closest Hydrogeological Data
-INQUIRY II: 3220399.2s DATE: December 07, 2011 11:47 am TC3220399.2s   Page A-11 2West 1/2 - 1 Mile
+' i:l Golder Associates CONTACT:
+INQUIRY II: 3220399.2s DATE:
+December 07, 2011 11:47 am
-LowerUSGS2429066 FED USGS1964-06-0712.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+TC3220399.2s Page A-11 2
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
+West 1/2 - 1 Mile Lower USGS2429066 FED USGS 1964-06-07 12.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
+Ground water data count:
 -06-07 Ground water data end date:
-Ground water data begin date: 1964-06-07 0Water quality data count:
+Ground water data begin date: 1964-06-07 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,344: / Line 1,872: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-POLONIALocation map:
+POLONIA Location map:
 NESWS01 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.49872787 Dec lon:44.50135807 Dec lat:0892955Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.49872787 Dec lon:
+.50135807 Dec lat:
+0892955 Longitude:
 USGS2429048 EDR Site id:
 Latitude:
 PT-23/08E/01-0511 Site name:
-443005089295501 Site no:USGSAgency cd:
+443005089295501 Site no:
-SSW 1/4 - 1/2 Mile
+USGS Agency cd:
+SSW 1/4 - 1/2 Mile Lower USGS2429048 FED USGS Map ID Direction Distance Elevation EDR ID Number Database
-LowerUSGS2429048 FED USGSMap IDDirection
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
-Distance Elevation EDR ID Number DatabaseGEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-12 CSTMean greenwich time offset:
+DRAFT
-19870429Date inventoried:
-19850618Date construction:
+TC3220399.2s Page A-12 CST Mean greenwich time offset:
+19870429 Date inventoried:
+19850618 Date construction:
 Ground-water other than Spring Site type:
 Not Reported Topographic:
 Not Reported Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
 Altitude:
 Map scale:
-POLONIALocation map:
+POLONIA Location map:
-NWNWS06 T23N  R09E  4 Land net:
+NWNWS06 T23N R09E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.48650552 Dec lon:44.51052505 Dec lat:0892911Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.48650552 Dec lon:
+.51052505 Dec lat:
+0892911 Longitude:
 USGS2429073 EDR Site id:
 Latitude:
 PT-23/09E/06-1157 Site name:
-443038089291101 Site no:USGSAgency cd:
+443038089291101 Site no:
-ENE 1/2 - 1 Mile
+USGS Agency cd:
+ENE 1/2 - 1 Mile Higher USGS2429073 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
-HigherUSGS2429073 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 2,405: / Line 1,945: @@
 Not Reported Hole depth:
 Not Reported Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,422: / Line 1,963: @@
 Not Reported Location map:
 Not Reported Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-MCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.50622809 Dec lon:44.50746908 Dec lat:0893022Longitude:
+NAD27 Latlong datum:
+M Coor accr:
+M Coor meth:
+-89.50622809 Dec lon:
+.50746908 Dec lat:
+0893022 Longitude:
 USGS2429066 EDR Site id:
 Latitude:
 PERM 24126 Site name:
-443027089302201 Site no:WI001Agency cd:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-13 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
+443027089302201 Site no:
+WI001 Agency cd:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-13 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 2,447: / Line 2,000: @@
 Not Reported Hole depth:
 Not Reported Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,464: / Line 2,018: @@
 Not Reported Location map:
 Not Reported Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-MCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.49733911 Dec lon:44.51469148 Dec lat:0892950Longitude:
+NAD27 Latlong datum:
+M Coor accr:
+M Coor meth:
+-89.49733911 Dec lon:
+.51469148 Dec lat:
+0892950 Longitude:
 USGS2429094 EDR Site id:
 Latitude:
 PERM 24279 Site name:
-443053089295001 Site no:WI001Agency cd:
+443053089295001 Site no:
-North 1/2 - 1 Mile
+WI001 Agency cd:
+North 1/2 - 1 Mile Higher USGS2429094 FED USGS 1985-06-18 6.0 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
-HigherUSGS2429094 FED USGS1985-06-186.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+Ground water data count:
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
 -06-18 Ground water data end date:
-Ground water data begin date: 1985-06-18 0Water quality data count:
+Ground water data begin date: 1985-06-18 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 other government (other than USGS)
 Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
+SAND AND GRAVEL AQUIFER Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-14 A6SSE 1/2 - 1 Mile
+Y Local standard time flag:
-HigherUSGS2429033 FED USGS1963-04-0121.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
+DRAFT
+TC3220399.2s Page A-14 A6 SSE 1/2 - 1 Mile Higher USGS2429033 FED USGS 1963-04-01 21.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
+Ground water data count:
 -04-01 Ground water data end date:
-Ground water data begin date: 1963-04-01 0Water quality data count:
+Ground water data begin date: 1963-04-01 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 Not Reported Source of depth data:
 Hole depth:
 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,526: / Line 2,092: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-POLONIALocation map:
+POLONIA Location map:
 S06 T023N R009E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-TCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.48733876 Dec lon:44.50108056 Dec lat:0892914Longitude:
+NAD27 Latlong datum:
+T Coor accr:
+M Coor meth:
+-89.48733876 Dec lon:
+.50108056 Dec lat:
+0892914 Longitude:
 USGS2429047 EDR Site id:
 Latitude:
 PT-23/09E/06-0486 Site name:
-443004089291401 Site no:USGSAgency cd:
+443004089291401 Site no:
-SE 1/2 - 1 Mile
+USGS Agency cd:
+SE 1/2 - 1 Mile Higher USGS2429047 FED USGS Map ID Direction Distance Elevation EDR ID Number Database
-HigherUSGS2429047 FED USGSMap IDDirection
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
-Distance Elevation EDR ID Number DatabaseGEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-15 CSTMean greenwich time offset:
+DRAFT
+TC3220399.2s Page A-15 CST Mean greenwich time offset:
 Not Reported Date inventoried:
-19591113Date construction:
+19591113 Date construction:
 Ground-water other than Spring Site type:
 Flat surface Topographic:
@@ Line 2,554: / Line 2,128: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
-.1Altitude accuracy:
+.1 Altitude accuracy:
 Level or other surveying method Altitude method:
-.32Altitude:
+.32 Altitude:
 Map scale:
-ARNOTTLocation map:
+ARNOTT Location map:
 NENENES12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.48928325 Dec lon:
+.49830276 Dec lat:
+0892921 Longitude:
 USGS2429032 EDR Site id:
 Latitude:
 PT-23/08E/12-0361 Site name:
-442954089292101 Site no:USGSAgency cd:
+442954089292101 Site no:
-A7SSE 1/2 - 1 Mile
+USGS Agency cd:
+A7 SSE 1/2 - 1 Mile Higher USGS2429032 FED USGS 1959-10-16 13.83 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
-HigherUSGS2429032 FED USGS1959-10-1613.83 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+Ground water data count:
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
 -10-16 Ground water data end date:
-Ground water data begin date: 1959-10-16 2Water quality data count:
+Ground water data begin date: 1959-10-16 2
+Water quality data count:
 -07-12 Water quality data end date:
 -06-10 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
-drillerSource of depth data:
+driller Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.4Well depth:
+.4 Well depth:
-QUATERNARY Aquifer:Not Reported Aquifer Type:
+QUATERNARY Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
-19591016Date construction:
+19591016 Date construction:
 Ground-water other than Spring Site type:
 Flat surface Topographic:
@@ Line 2,600: / Line 2,180: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-ARNOTTLocation map:
+ARNOTT Location map:
 NENENES12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.48928325 Dec lon:44.49830276 Dec lat:0892921Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.48928325 Dec lon:
+.49830276 Dec lat:
+0892921 Longitude:
 USGS2429033 EDR Site id:
 Latitude:
 PT-23/08E/12-0360 Site name:
-442954089292102 Site no:USGSAgency cd:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-16 Not Reported Block no:
+442954089292102 Site no:
-Not Reported Lot no:Not Reported Subdivisio:
+USGS Agency cd:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-16 Not Reported Block no:
+Not Reported Lot no:
+Not Reported Subdivisio:
 Not Reported Well stree:
-Not Reported Fire:STEVENS POINT Municipal1:
+Not Reported Fire:
-CMunicipal:
+STEVENS POINT Municipal1:
-Construc 6:
+C Municipal:
-Construc 5:
+Construc 6:
-WIConstruc 4:
+Construc 5:
-PLOVERConstruc 3:
+WI Construc 4:
+PLOVER Construc 3:
 PO BOX 490 Construc 2:
 Construc 1:
 ROBERTS IRRIGATION CO INC Constructo:
 /03/2008 Dnr rece 2:
@@ Line 2,635: / Line 2,229: @@
 Not Reported Owner are:
 Not Reported Owner zip2:
 Owner zip1:
-WIOwner stat:
+WI Owner stat:
 STEVENS POINT Owner city:
 JOHN JOANIS DR Owner mail:
 ADVENTURE 2120 Owner name:
 Not Reported Tax parcel:
 District c:
-.0E+001County cod:
+.0E+001 County cod:
 Not Reported County wel:
-TY626Wi unique:
+TY626 Wi unique:
-WSW 1/2 - 1 Mile
+WSW 1/2 - 1 Mile Lower WI3000000008386 WI WELLS 1959-11-13 9.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
+Ground water data count:
-LowerWI3000000008386 WI WELLS1959-11-139.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
 -11-13 Ground water data end date:
-Ground water data begin date: 1959-11-13 1Water quality data count:
+Ground water data begin date: 1959-11-13 1
+Water quality data count:
 -06-10 Water quality data end date:
 -06-10 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
-drillerSource of depth data:
+driller Source of depth data:
-.3Hole depth:
+.3 Hole depth:
-.3Well depth:
+.3 Well depth:
-QUATERNARY Aquifer:Not Reported Aquifer Type:
+QUATERNARY Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-17 Not Reported Animal yar:
+Y Local standard time flag:
-Pav anim 1:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-17 Not Reported Animal yar:
+Pav anim 1:
 Not Reported Pav animal:
 Wastewtr a:
 Not Reported Wastewtr s:
 Clewtr amt:
 Not Reported Clewtr sum:
 Coll sew 1:
 Not Reported Coll sewer:
 Not Reported Build se 3:
 Not Reported Build se 2:
 Build se 1:
 Not Reported Build sewe:
 Not Reported Build dr 2:
 Build dr 1:
 Not Reported Build drai:
 Found dr 1:
 Not Reported Found drai:
 Found cl 1:
 Not Reported Found clwt:
 Privy amt:
 Not Reported Privy code:
 Dwnspot 1:
 Not Reported Dwnspot hy:
 Shorline p:
 Not Reported Shoreline:
 Buried p 1:
 Not Reported Buried pet:
 Buried o 1:
 Not Reported Buried oil:
 Nonconfo 1:
 Not Reported Nonconform:
 Sew abso 1:
 Not Reported Sew absorb:
 Septic t 1:
 Not Reported Septic tan:
-.4E+001Build oh a:
+.4E+001 Build oh a:
 Not Reported Build over:
 Landfill a:
 Not Reported Landfill q:
-NFlood plai:
+N Flood plai:
 Not Reported Highest po:
-NHicap prop:
+N Hicap prop:
-NHicap well:
+N Hicap well:
 IRRIGATION Facility t:
 Not Reported Service co:
-XWell categ:
+X Well categ:
 Not Reported Other expl:
 Well type:
 Not Reported New well i:
 Not Reported Prev well:
 Not Reported Replace re:
 Not Reported Orig year:
 Well statu:
-EE w:8.0E+000Range no:
+E E w:
-.3E+001Township n:
+.0E+000 Range no:
-.0E+000Section:NEQuar:SEQuar quar:
+.3E+001 Township n:
-Not Reported Govt lot:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-18 BStatic w 1:
+.0E+000 Section:
-.7E+001Static wtr:
+NE Quar:
-Not Reported Depth:SSacks ya 1:
+SE Quar quar:
+Not Reported Govt lot:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-18 B
+Static w 1:
+.7E+001 Static wtr:
+Not Reported Depth:
+S Sacks ya 1:
 Not Reported Seal num 1:
-.3E+001Seal to 1:
+.3E+001 Seal to 1:
-.1E+001Seal from1:
+.1E+001 Seal from1:
 #20 RED FLINT Seal kind1:
-SSacks yard:
+S Sacks yard:
 Not Reported Seal numbe:
-.1E+001Seal to am:
+.1E+001 Seal to am:
 Seal from:
 DRILL CUTTINGS Seal kind:
 Not Reported Seal metho:
-.3E+001Screen to:
+.3E+001 Screen to:
-.3E+001Screen fro:
+.3E+001 Screen fro:
 JOHNSON #20 GALV Screen Type:
-.0E+000Screen dia:
+.0E+000 Screen dia:
 Cls to a 3:
 Cls to a 2:
 Cls to a 1:
-.3E+001Cls to amt:
+.3E+001 Cls to amt:
 Cls from 3:
 Cls from 2:
 Cls from 1:
 Cls from a:
 Not Reported Cls desc 3:
 Not Reported Cls desc 2:
 Not Reported Cls desc 1:
-A53 BLACK NORTHWEST PIPE .280 WELDED Cls desc t:
+A53 BLACK NORTHWEST PIPE.280 WELDED Cls desc t:
 Cls dia 3:
 Cls dia 2:
 Cls dia 1:
-.0E+000Cls dia am:
+.0E+000 Cls dia am:
 Not Reported Other ex 1:
 Not Reported Other dril:
 Not Reported Remove exp:
 Not Reported Temp otr r:
 Dia temp a:
 Not Reported Tem otr ca:
 Cable bit1:
 Not Reported Cable bit:
 Not Reported Rev rot co:
 Not Reported Rot foam c:
 Not Reported Rot air co:
-XRot mud co:
+X Rot mud co:
 Dr4 to amt:
 Dr4 from a:
 Dr4 dia am:
 Dr3 to amt:
 Dr3 from a:
 Dr3 dia am:
 Dr2 to amt:
 Dr2 from a:
 Dr2 dia am:
-.3E+001Dr1 to amt:
+.3E+001 Dr1 to amt:
 Dr1 from a:
-.0E+000Dr1 dia am:
+.0E+000 Dr1 dia am:
 Not Reported Nr112 text:
 Nr 112 a 1:
 Not Reported Nr 112 amt:
 Not Reported Manure s 2:
 Manure s 1:
 Not Reported Manure sto:
 Not Reported Manure t 1:
 Not Reported Manure typ:
 Manure p 1:
 Not Reported Manure pip:
 Barn gut 1:
 Not Reported Barn gutte:
 Not Reported Silo type:
 Silo amt:
-Not Reported Silo:0Animal y 1:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-19 9West 1/2 - 1 Mile
+Not Reported Silo:
+Animal y 1:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
-LowerUSGS2429067 FED USGSWI3000000008386 Site id:Not Reported Empty gy:
+TC3220399.2s Page A-19 9
-26915464Notificati:
+West 1/2 - 1 Mile Lower USGS2429067 FED USGS WI3000000008386 Site id:
+Not Reported Empty gy:
+26915464 Notificati:
 WELL CONSTRUCTION Record sou:
-Batch:4Spec capac:
+Batch:
+Spec capac:
 /07/2006 Approval d:
 Not Reported Approval n:
-Not Reported Fid 1:Not Reported Common wel:
+Not Reported Fid 1:
+Not Reported Common wel:
 Not Reported Hicap no:
 Collet sew:
 Not Reported Collect se:
 Not Reported Varince is:
@@ Line 2,813: / Line 2,433: @@
 Not Reported Lower rota:
 Not Reported Drill casi:
-GPS008Lat long m:
+GPS008 Lat long m:
-.555Long minut:
+.555 Long minut:
 Long degre:
-.192Lat minute:
+.192 Lat minute:
 Lat degree:
-PORTAGECounty tex:
+PORTAGE County tex:
-.3E+001Bottom:05/22/2008 File creat:
+.3E+001 Bottom:
+/22/2008 File creat:
 Not Reported Shoreline1:
 Not Reported Septic typ:
 Ditch amt:
-YLabel sent:
+Y Label sent:
 Not Reported Comment fl:
 /15/2007 Ro sign da:
-PRRig op ini:
+PR Rig op ini:
 /15/2007 Wc sign da:
-JPWell cont:
+JP Well cont:
 Not Reported Proper s 1:
 Not Reported Proper sea:
-YWell cappe:
+Y Well cappe:
-YWell disin:
+Y Well disin:
-YWell dev c:
+Y Well dev c:
-AWell abvbe:
+A Well abvbe:
-.3E+001Well depth:
+.3E+001 Well depth:
-.0E+000Pump hrs t:
+.0E+000 Pump hrs t:
-MPump by co:
+M Pump by co:
-.0E+001Pump gals:
+.0E+001 Pump gals:
-.4E+001Pump wtr b:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-20 CSTMean greenwich time offset:
+.4E+001 Pump wtr b:
-19870422Date inventoried:
-19830603Date construction:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-20 CST Mean greenwich time offset:
+19870422 Date inventoried:
+19830603 Date construction:
 Ground-water other than Spring Site type:
 Not Reported Topographic:
 Not Reported Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
 Altitude:
 Map scale:
 STEVENS POINT Location map:
-NENWS01 T23N  R08E  4 Land net:
+NENWS01 T23N R08E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.51122822 Dec lon:44.50913568 Dec lat:0893040Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.51122822 Dec lon:
+.50913568 Dec lat:
+0893040 Longitude:
 USGS2429070 EDR Site id:
 Latitude:
 PT-23/08E/01-1125 Site name:
-443033089304001 Site no:USGSAgency cd:
+443033089304001 Site no:
-West 1/2 - 1 Mile
+USGS Agency cd:
+West 1/2 - 1 Mile Lower USGS2429070 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
-LowerUSGS2429070 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 2,878: / Line 2,509: @@
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,891: / Line 2,523: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
 STEVENS POINT Location map:
 NWSENES02 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.51095042 Dec lon:44.50746901 Dec lat:0893039Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.51095042 Dec lon:
+.50746901 Dec lat:
+0893039 Longitude:
 USGS2429067 EDR Site id:
 Latitude:
 PT-23/08E/02-0895 Site name:
-443027089303901 Site no:USGSAgency cd:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-21 1Ground water data count:
+443027089303901 Site no:
+USGS Agency cd:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-21 1
+Ground water data count:
 -05-05 Ground water data end date:
-Ground water data begin date: 1975-05-05 0Water quality data count:
+Ground water data begin date: 1975-05-05 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 2,933: / Line 2,580: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
 STEVENS POINT Location map:
 NENES02 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.51095046 Dec lon:44.51108014 Dec lat:0893039Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.51095046 Dec lon:
+.51108014 Dec lat:
+0893039 Longitude:
 USGS2429076 EDR Site id:
 Latitude:
 PT-23/08E/02-0875 Site name:
-443040089303901 Site no:USGSAgency cd:
+443040089303901 Site no:
-WNW1/2 - 1 Mile
+USGS Agency cd:
+WNW 1/2 - 1 Mile Lower USGS2429076 FED USGS 1983-06-03 7.0 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
-LowerUSGS2429076 FED USGS1983-06-037.0 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+Ground water data count:
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
 -06-03 Ground water data end date:
-Ground water data begin date: 1983-06-03 0Water quality data count:
+Ground water data begin date: 1983-06-03 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 other government (other than USGS)
 Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
+SAND AND GRAVEL AQUIFER Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-22 13South 1/2 - 1 Mile
+Y Local standard time flag:
-LowerUSGS2429204 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-22 13 South 1/2 - 1 Mile Lower USGS2429204 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 2,988: / Line 2,645: @@
 other government (other than USGS)
 Source of depth data:
 Hole depth:
 Well depth:
-SAND AND GRAVEL AQUIFER Aquifer:Not Reported Aquifer Type:
+SAND AND GRAVEL AQUIFER Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
-19870203Date inventoried:
+19870203 Date inventoried:
-19820512Date construction:
+19820512 Date construction:
 Ground-water other than Spring Site type:
 Not Reported Topographic:
 Not Reported Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
 Altitude:
 Map scale:
-POLONIALocation map:
+POLONIA Location map:
 NWSWS31 T024N R009E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-TCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.48678338 Dec lon:44.51663617 Dec lat:0892912Longitude:
+NAD27 Latlong datum:
+T Coor accr:
+M Coor meth:
+-89.48678338 Dec lon:
+.51663617 Dec lat:
+0892912 Longitude:
 USGS2429102 EDR Site id:
 Latitude:
 PT-24/09E/31-1076 Site name:
-443100089291201 Site no:USGSAgency cd:
+443100089291201 Site no:
-NE1/2 - 1 Mile
+USGS Agency cd:
+NE 1/2 - 1 Mile Higher USGS2429102 FED USGS 1975-05-05 23.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
-HigherUSGS2429102 FED USGS1975-05-0523.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+TC3220399.2s Page A-23 CST Mean greenwich time offset:
-Ground-water levels, Number of Measurements: 1GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-23 CSTMean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,027: / Line 2,694: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
-.5Altitude accuracy:
+.5 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-WHITINGLocation map:
+WHITING Location map:
 SESES02 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.51122811 Dec lon:44.49996898 Dec lat:0893040Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.51122811 Dec lon:
+.49996898 Dec lat:
+0893040 Longitude:
 USGS2429044 EDR Site id:
 Latitude:
 PT-23/08E/02-0593 Site name:
-443000089304001 Site no:USGSAgency cd:
+443000089304001 Site no:
-WSW 1/2 - 1 Mile
+USGS Agency cd:
+WSW 1/2 - 1 Mile Lower USGS2429044 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
-LowerUSGS2429044 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,059: / Line 2,730: @@
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,072: / Line 2,744: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-ARNOTTLocation map:
+ARNOTT Location map:
 NES12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.49345004 Dec lon:44.49413604 Dec lat:0892936Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.49345004 Dec lon:
+.49413604 Dec lat:
+0892936 Longitude:
 USGS2429204 EDR Site id:
 Latitude:
 PT-23/08E/12-1054 Site name:
-442939089293601 Site no:USGSAgency cd:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-24 4Ground water data count:
+442939089293601 Site no:
+USGS Agency cd:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-24 4
+Ground water data count:
 -10-14 Ground water data end date:
-Ground water data begin date: 1950-07-20 0Water quality data count:
+Ground water data begin date: 1950-07-20 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,114: / Line 2,801: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-ARNOTTLocation map:
+ARNOTT Location map:
 SWNES12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-SCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.49706122 Dec lon:44.49385818 Dec lat:0892949Longitude:
+NAD27 Latlong datum:
+S Coor accr:
+M Coor meth:
+-89.49706122 Dec lon:
+.49385818 Dec lat:
+0892949 Longitude:
 USGS2429203 EDR Site id:
 Latitude:
 PT-23/08E/12-0002 Site name:
-442938089294901 Site no:USGSAgency cd:
+442938089294901 Site no:
-South1/2 - 1 Mile
+USGS Agency cd:
+South 1/2 - 1 Mile Lower USGS2429203 FED USGS 1967-05-04 21.00 Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 1 1
-LowerUSGS2429203 FED USGS1967-05-0421.00 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+Ground water data count:
-Ground-water levels, Number of Measurements: 1 1Ground water data count:
 -05-04 Ground water data end date:
-Ground water data begin date: 1967-05-04 0Water quality data count:
+Ground water data begin date: 1967-05-04 0
+Water quality data count:
 -00-00 Water quality data end date:
 -00-00 Water quality data begin date:
 Peak flow data count:
 -00-00 Peak flow data end date:
 -00-00 Peak flow data begin date:
 Daily flow data count:
 -00-00 Daily flow data end date:
 -00-00 Daily flow data begin date:
 Real time data flag:
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-25 B17ENE 1/2 - 1 Mile
+Y Local standard time flag:
-HigherUSGS2429082 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-25 B17 ENE 1/2 - 1 Mile Higher USGS2429082 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,167: / Line 2,864: @@
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,180: / Line 2,878: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-WHITINGLocation map:
+WHITING Location map:
 NWNWS12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-SCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.50567249 Dec lon:44.49580245 Dec lat:0893020Longitude:
+NAD27 Latlong datum:
+S Coor accr:
+M Coor meth:
+-89.50567249 Dec lon:
+.49580245 Dec lat:
+0893020 Longitude:
 USGS2429210 EDR Site id:
 Latitude:
 PT-23/08E/12-0894 Site name:
-442945089302001 Site no:USGSAgency cd:
+442945089302001 Site no:
-SSW1/2 - 1 Mile
+USGS Agency cd:
+SSW 1/2 - 1 Mile Lower USGS2429210 FED USGS 1950-10-17 10.42 1950-07-20 10.03 1953-10-14 9.20 1950-11-25 10.91 Date Feet below Surface Feet to Sealevel Date Feet below Surface Feet to Sealevel Ground-water levels, Number of Measurements: 4
-LowerUSGS2429210 FED USGS1950-10-1710.421950-07-2010.031953-10-149.201950-11-2510.91 DateFeet below SurfaceFeet toSealevel-------------------------------------------------
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
-DateFeet below SurfaceFeet toSealevel-------------------------------------------------
-Ground-water levels, Number of Measurements: 4GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-26 CSTMean greenwich time offset:
+DRAFT
+TC3220399.2s Page A-26 CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,214: / Line 2,920: @@
 Not Reported Location map:
 Not Reported Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-MCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
+NAD27 Latlong datum:
+M Coor accr:
+M Coor meth:
+-89.47817205 Dec lon:
+.51191414 Dec lat:
+0892841 Longitude:
 USGS2429083 EDR Site id:
 Latitude:
 PERM 24110 Site name:
-443043089284103 Site no:WI001Agency cd:
+443043089284103 Site no:
-B18ENE 1/2 - 1 Mile
+WI001 Agency cd:
+B18 ENE 1/2 - 1 Mile Higher USGS2429083 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
-HigherUSGS2429083 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,242: / Line 2,952: @@
 Not Reported Hole depth:
 Not Reported Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,259: / Line 2,970: @@
 Not Reported Location map:
 Not Reported Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-MCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
+NAD27 Latlong datum:
+M Coor accr:
+M Coor meth:
+-89.47817205 Dec lon:
+.51191414 Dec lat:
+0892841 Longitude:
 USGS2429082 EDR Site id:
 Latitude:
 PERM 23908 Site name:
-443043089284102 Site no:WI001Agency cd:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-27 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
+443043089284102 Site no:
+WI001 Agency cd:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-27 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,282: / Line 3,005: @@
 Not Reported Project number:
 Not Reported Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,295: / Line 3,019: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-POLONIALocation map:
+POLONIA Location map:
 SESWS31 T024N R009E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-FCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.47817205 Dec lon:44.51191414 Dec lat:0892841Longitude:
+NAD27 Latlong datum:
+F Coor accr:
+M Coor meth:
+-89.47817205 Dec lon:
+.51191414 Dec lat:
+0892841 Longitude:
 USGS2429081 EDR Site id:
 Latitude:
 PT-24/09E/31-0828 Site name:
-443043089284101 Site no:USGSAgency cd:
+443043089284101 Site no:
-B19ENE 1/2 - 1 Mile
+USGS Agency cd:
+B19 ENE 1/2 - 1 Mile Higher USGS2429081 FED USGS Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
-HigherUSGS2429081 FED USGSGround-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,329: / Line 3,057: @@
 Not Reported Hole depth:
 Not Reported Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:GEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-28 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
+Y Local standard time flag:
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
+DRAFT
+TC3220399.2s Page A-28 Ground-water levels, Number of Measurements: 0 Not Reported Ground water data count:
 Not Reported Ground water data end date:
 Ground water data begin date: Not Reported Not Reported Water quality data count:
@@ Line 3,344: / Line 3,079: @@
 Not Reported Real time data flag:
 Not Reported Project number:
-drillerSource of depth data:
+driller Source of depth data:
-.0Hole depth:
+.0 Hole depth:
-.0Well depth:
+.0 Well depth:
-Not Reported Aquifer:Not Reported Aquifer Type:
+Not Reported Aquifer:
+Not Reported Aquifer Type:
 Single well, other than collector or Ranney type Type of ground water site:
-YLocal standard time flag:
+Y Local standard time flag:
-CSTMean greenwich time offset:
+CST Mean greenwich time offset:
 Not Reported Date inventoried:
 Not Reported Date construction:
@@ Line 3,358: / Line 3,094: @@
 Hydrologic:
 National Geodetic Vertical Datum of 1929 Altitude datum:
 Altitude accuracy:
 Interpolated from topographic map Altitude method:
-.00Altitude:
+.00 Altitude:
 Map scale:
-WHITINGLocation map:
+WHITING Location map:
 NWSENWS12 T023N R008E 4 Land net:
-USCountry:097County:55State:55District:
+US Country:
-NAD83Dec latlong datum:
+County:
-NAD27Latlong datum:
+State:
-SCoor accr:
+District:
-MCoor meth:
+NAD83 Dec latlong datum:
--89.50372802 Dec lon:44.49385806 Dec lat:0893013Longitude:
+NAD27 Latlong datum:
+S Coor accr:
+M Coor meth:
+-89.50372802 Dec lon:
+.49385806 Dec lat:
+0893013 Longitude:
 USGS2429138 EDR Site id:
 Latitude:
 PT-23/08E/12-0512 Site name:
-442838089301301 Site no:USGSAgency cd:
+442838089301301 Site no:
-SSW 1/2 - 1 Mile
+USGS Agency cd:
+SSW 1/2 - 1 Mile Lower USGS2429138 FED USGS Map ID Direction Distance Elevation EDR ID Number Database
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS
-LowerUSGS2429138 FED USGSMap IDDirection
+DRAFT
-Distance Elevation EDR ID Number DatabaseGEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGSDRAFT TC3220399.2s   Page A-29 0%33%67%4.258 pCi/L BasementNot Reported Not Reported Not Reported Not Reported Living Area - 2nd Floor 0%0%100%1.150 pCi/L Living Area - 1st Floor
+TC3220399.2s Page A-29 0%
+%
+%
+.258 pCi/L Basement Not Reported Not Reported Not Reported Not Reported Living Area - 2nd Floor 0%
+%
+%
+.150 pCi/L Living Area - 1st Floor
 % >20 pCi/L
 % 4-20 pCi/L
-% <4 pCi/L Average Activity AreaNumber of sites tested: 24
+% <4 pCi/L Average Activity Area Number of sites tested: 24 Federal Area Radon Information for PORTAGE COUNTY, WI
+: Zone 3 indoor average level < 2 pCi/L.
-Federal Area Radon Information for PORTAGE COUNTY, WI
+: Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L.
-             : Zone 3 indoor average level < 2 pCi/L.
-             : Zone 2 indoor average level >= 2 pCi/L and <= 4 pCi/L.
 Note: Zone 1 indoor average level > 4 pCi/L.
-Federal EPA Radon Zone for PORTAGE County:  1 AREA RADON INFORMATIONGEOCHECK   - PHYSICAL SETTING SOURCE MAP FINDINGS RADONDRAFT TOPOGRAPHIC INFORMATION USGS 7.5' Digital Elevation Model (DEM)
+Federal EPA Radon Zone for PORTAGE County: 1 AREA RADON INFORMATION
-Source: United States Geologic Survey
-EDR acquired the USGS 7.5' Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds
-to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data
-with consistent elevation units and projection.
-Scanned Digital USGS 7.5' Topographic Map (DRG)
-Source: United States Geologic Survey
-A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images
-are made by scanning published paper maps on high-resolution scanners. The raster image
-is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
-HYDROLOGIC INFORMATIONFlood Zone Data:This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.NWI:National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
-HYDROGEOLOGIC INFORMATION AQUIFLOW       Information System RSource:  EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has
-extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table
-information.
-GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital
-representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994).STATSGO:State Soil Geographic Database Source:  Department of Agriculture, Natural Resources Conservation Services
-The U.S. Department of Agriculture's (USDA) Natural Resources Conservation Service (NRCS) leads the national
-Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil
-survey information for privately owned lands in the United States. A soil map in a soil survey is a representation
-of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO)
-soil survey maps.
-SSURGO: Soil Survey Geographic Database Source:  Department of Agriculture, Natural Resources Conservation Services (NRCS)
-Telephone:  800-672-5559
-SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping
-scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to
-construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the
-original soil survey maps. This level of mapping is designed for use by landowners, townships and county
-natural resource planning and management.
-TC3220399.2s     Page A-30 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLSPWS:Public Water Systems Source:  EPA/Office of Drinking Water
-Telephone:  202-564-3750
-Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources.PWS ENF:Public Water Systems Violation and Enforcement Data Source:  EPA/Office of Drinking Water
-Telephone:  202-564-3750
-Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS).USGS Water Wells: USGS National Water Inventory System (NWIS)
-This database contains descriptive information on sites where the USGS collects or has collected data on surface
-water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater.
-STATE RECORDS
-Wisconsin Well Construction Report File Source:  Department of Natural Resources
-Telephone:  608-266-0153
-In the past, not all latitude/longitudes were accurate. Many were protracted from centroid (center of the quarter sections given in PLSS). The ones that were not accurate were removed from the well database.
-OTHER STATE DATABASE INFORMATION RADONState Database: WI Radon Source: Department of Health & Family Services
-Telephone: 608-266-1865
-Wisconsin Measurement Summary Area Radon Information Source: USGS
-Telephone:  703-356-4020
-The National Radon Database has been developed by the U.S. Environmental Protection Agency
-(USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey.
-The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at
+GEOCHECK - PHYSICAL SETTING SOURCE MAP FINDINGS RADON
-private sources such as universities and research institutions.
+DRAFT
-EPA Radon Zones Source:  EPA
-Telephone:  703-356-4020
+TOPOGRAPHIC INFORMATION USGS 7.5 Digital Elevation Model (DEM)
+Source: United States Geologic Survey EDR acquired the USGS 7.5 Digital Elevation Model in 2002 and updated it in 2006. The 7.5 minute DEM corresponds to the USGS 1:24,000- and 1:25,000-scale topographic quadrangle maps. The DEM provides elevation data with consistent elevation units and projection.
+Scanned Digital USGS 7.5 Topographic Map (DRG)
+Source: United States Geologic Survey A digital raster graphic (DRG) is a scanned image of a U.S. Geological Survey topographic map. The map images are made by scanning published paper maps on high-resolution scanners. The raster image is georeferenced and fit to the Universal Transverse Mercator (UTM) projection.
+HYDROLOGIC INFORMATION Flood Zone Data:
+This data, available in select counties across the country, was obtained by EDR in 2003 & 2011 from the Federal Emergency Management Agency (FEMA). Data depicts 100-year and 500-year flood zones as defined by FEMA.
+NWI:
+National Wetlands Inventory. This data, available in select counties across the country, was obtained by EDR in 2002 and 2005 from the U.S. Fish and Wildlife Service.
+HYDROGEOLOGIC INFORMATION AQUIFLOW Information System R
+Source: EDR proprietary database of groundwater flow information EDR has developed the AQUIFLOW Information System (AIS) to provide data on the general direction of groundwater flow at specific points. EDR has reviewed reports submitted to regulatory authorities at select sites and has extracted the date of the report, hydrogeologically determined groundwater flow direction and depth to water table information.
+GEOLOGIC INFORMATION Geologic Age and Rock Stratigraphic Unit Source: P.G. Schruben, R.E. Arndt and W.J. Bawiec, Geology of the Conterminous U.S. at 1:2,500,000 Scale - A digital representation of the 1974 P.B. King and H.M. Beikman Map, USGS Digital Data Series DDS - 11 (1994).
+STATSGO:
+State Soil Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services The U.S. Department of Agricultures (USDA) Natural Resources Conservation Service (NRCS) leads the national Conservation Soil Survey (NCSS) and is responsible for collecting, storing, maintaining and distributing soil survey information for privately owned lands in the United States. A soil map in a soil survey is a representation of soil patterns in a landscape. Soil maps for STATSGO are compiled by generalizing more detailed (SSURGO) soil survey maps.
+SSURGO: Soil Survey Geographic Database Source: Department of Agriculture, Natural Resources Conservation Services (NRCS)
+Telephone: 800-672-5559 SSURGO is the most detailed level of mapping done by the Natural Resources Conservation Services, mapping scales generally range from 1:12,000 to 1:63,360. Field mapping methods using national standards are used to construct the soil maps in the Soil Survey Geographic (SSURGO) database. SSURGO digitizing duplicates the original soil survey maps. This level of mapping is designed for use by landowners, townships and county natural resource planning and management.
+TC3220399.2s Page A-30 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT
-Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor
+LOCAL / REGIONAL WATER AGENCY RECORDS FEDERAL WATER WELLS PWS: Public Water Systems Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Public Water System data from the Federal Reporting Data System. A PWS is any water system which provides water to at least 25 people for at least 60 days annually. PWSs provide water from wells, rivers and other sources.
+PWS ENF: Public Water Systems Violation and Enforcement Data Source: EPA/Office of Drinking Water Telephone: 202-564-3750 Violation and Enforcement data for Public Water Systems from the Safe Drinking Water Information System (SDWIS) after August 1995. Prior to August 1995, the data came from the Federal Reporting Data System (FRDS).
+USGS Water Wells:
+USGS National Water Inventory System (NWIS)
+This database contains descriptive information on sites where the USGS collects or has collected data on surface water and/or groundwater. The groundwater data includes information on wells, springs, and other sources of groundwater.
+STATE RECORDS Wisconsin Well Construction Report File Source: Department of Natural Resources Telephone: 608-266-0153 In the past, not all latitude/longitudes were accurate. Many were protracted from centroid (center of the quarter sections given in PLSS). The ones that were not accurate were removed from the well database.
+OTHER STATE DATABASE INFORMATION RADON State Database: WI Radon Source: Department of Health & Family Services Telephone: 608-266-1865 Wisconsin Measurement Summary Area Radon Information Source: USGS Telephone: 703-356-4020 The National Radon Database has been developed by the U.S. Environmental Protection Agency (USEPA) and is a compilation of the EPA/State Residential Radon Survey and the National Residential Radon Survey.
+The study covers the years 1986 - 1992. Where necessary data has been supplemented by information collected at private sources such as universities and research institutions.
+EPA Radon Zones Source: EPA Telephone: 703-356-4020 Sections 307 & 309 of IRAA directed EPA to list and identify areas of U.S. with the potential for elevated indoor radon levels.
+OTHER Airport Landing Facilities:
+Private and public use landing facilities Source: Federal Aviation Administration, 800-457-6656 Epicenters:
+World earthquake epicenters, Richter 5 or greater Source: Department of Commerce, National Oceanic and Atmospheric Administration TC3220399.2s Page A-31 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT
-radon levels.
+STREET AND ADDRESS INFORMATION
-OTHERAirport Landing Facilities:Private and public use landing facilities Source:  Federal Aviation Administration, 800-457-6656Epicenters:World earthquake epicenters, Richter 5 or greater Source:  Department of Commerce, National Oceanic and Atmospheric Administration TC3220399.2s     Page A-31 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT STREET AND ADDRESS INFORMATION
+&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protection and other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subject to the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
-&#xa9; 2010 Tele Atlas North America, Inc. All rights reserved. This material is proprietary and the subject of copyright protectio nand other intellectual property rights owned by or licensed to Tele Atlas North America, Inc. The use of this material is subj ectto the terms of a license agreement. You will be held liable for any unauthorized copying or disclosure of this material.
+TC3220399.2s Page A-32 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT}}
-TC3220399.2s     Page A-32 PHYSICAL SETTING SOURCE RECORDS SEARCHED DRAFT}}

Shine Medical Technologies, Inc., Application for Construction Permit Response to Environmental Requests for Additional Information, Enclosure 2 Attachment 19 - Draft Phase I Environmental Site Assessment (Stevens Point, Wi) (Part 1 of 9)
Person / Time
ML13309B013
Site:	SHINE Medical Technologies
Issue date:	02/10/2012
From:	SHINE Medical Technologies
To:	Office of Nuclear Reactor Regulation
Shared Package
ML13303A887	List: ML13302C044 ML13309A984 ML13309A987 ML13309A988 ML13309A989 ML13309A990 ML13309A991 ML13309A992 ML13309A993 ML13309A994 ML13309A995 ML13309A996 ML13309B005 ML13309B006 ML13309B007 ML13309B008 ML13309B009 ML13309B010 ML13309B012 ML13309B013 ML13309B014 ML13309B016 ML13309B032 ML13309B033 ML13309B034 ML13309B035 ML13309B036 ML13309B037 ML13309B038 ML13309B039 ML13309B040 ML13309B041 ML13309B618 ML13309B619 ML13309B621 ML13309B622 ML13309B623 ML13309B624 ML13309B625 ML13309B626 ML13309B627 ML13309B628 ML13309B629 ML13309B630 ML13309B631 ML13309B632 ML13309B633 ML13309B634
References
113-81093, SMT-2013-034
Download: ML13309B013 (111)
v • d • e

ML13309B013: Difference between revisions

Latest revision as of 03:42, 11 January 2025

Text

Dear Dr. Piefer:

SUMMARY

1.0 INTRODUCTION

8.0 CONCLUSION

10.0REFERENCES

SUMMARY

1.0 INTRODUCTION

8.0 CONCLUSION

10.0 REFERENCES

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

SUMMARY

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact:

Contact: