ML17292B658: Difference between revisions

From kanterella
Jump to navigation Jump to search
(Created page by program invented by StriderTol)
 
(Created page by program invented by StriderTol)
Line 17: Line 17:


=Text=
=Text=
{{#Wiki_filter:SUPPLEMENTAL INFORMATION ANALYTICAL EVALUATION OFINSERVICE INSPECTION EXAMINATION RESULTSAttachment ACalculation ME-02-98-04, "Fracture Mechanics Evaluation ofNlSafeEnd,"Revision09905i30i7i
{{#Wiki_filter:SUPPLEMENTAL INFORMATION ANALYTICAL EVALUATION OF INSERVICE INSPECTION EXAMINATION RESULTS Attachment A Calculation ME-02-98-04,"Fracture Mechanics Evaluation of Nl Safe End," Revision 0 9905i30i7i
'990429PDRADOCK050003978PDR WA5HINGTON PtMICFOWRRk9SUPPLYSYSTEMCALCULATION COVERSHEETBDCPageEquipment PieceNo.MS-RPV-3ProjectDiscipline WNP-2PageQooCalculation No.ME-02-98-04 Cont'donPage0CIMATERIALANDWELDINGRemarksQualityClass1i"k":TiUe/Subject FRACTUREMECHANICS EVALUATION OFN1SAFEENDPurposeAfracturemechanics evaluation wasperformed toevaluateaplanarindication foundduringin-service inspection ofISIweldnumber24RRC(2)A-1.
'990429 PDR ADOCK 05000397 8 PDR WA5HINGTON PtMIC FOWRR k9 SUPPLY SYSTEM CALCULATION COVER SHEET BDC Page Equipment Piece No.MS-RPV-3 Project Discipline WNP-2 Page Qoo Calculation No.ME-02-98-04 Cont'd on Page 0 CI MATERIAL AND WELDING Remarks Quality Class 1 i"k": TiUe/Subject FRACTURE MECHANICS EVALUATION OF N1 SAFE END Purpose A fracture mechanics evaluation was performed to evaluate a planar indication found during in-service inspection of ISI weld number 24RRC(2)A-1.
Theindication isontheinsidesurfaceofthesafe-endandIslocatedat5:00o'lockwhenlookingdownstream.
The indication is on the inside surface of the safe-end and Is located at 5:00 o'lock when looking downstream.
Theindication measures3.52inchesinlengthand0.29inchesdeepinapipewallthatis2.0inchesthick.Theindication existsinSA336ClassF8forgedtype304stainless steelsafe-end.
The indication measures 3.52 inches in length and 0.29 inches deep in a pipe wall that is 2.0 inches thick.The indication exists in SA 336 Class F8 forged type 304 stainless steel safe-end.The size of the defect exceeds the ASME Code Section XI Table IWB 3514-2 allowable and thus requires an evaluation per paragraph IWB 3640 of the Code.The following calculation provides a comprehensive presentation of the fracture mechanics model, applied loads (stresses), and Code evaluations
ThesizeofthedefectexceedstheASMECodeSectionXITableIWB3514-2allowable andthusrequiresanevaluation perparagraph IWB3640oftheCode.Thefollowing calculation providesacomprehensive presentation ofthefracturemechanics model,appliedloads(stresses),
/Wwc-opc-<0 C IN//r a,a5 0 I Q.lcd&~o~REV NO.0 STATUS/F,P,ORS F Initial Issue REVISION DESCRIPTION INITIATING DOCUMENTS PER 298-0600 TRANSMITTAL NO./7ws";;~X@5$~~~~N~PRVNN!'%'%&#xc3;4o-".NN%-:K%%8PERFOR MAMCENERIFICATIOM!RECORD."'~%5~.';.ANNPAN%%%""':R~%%FN."N&%@5%%
andCodeevaluations
REV NO.0 PERFORMED BY/DATE Tom Erwin VERIFIED BY/DATE 5 gv APPROVED BY/DATE 6-'3>-g Study Calculations shall be used only for the purpose of evaluating alternate design options or assisting the engineer in performing assessments.
/Wwc-opc-<0CIN//ra,a50IQ.lcd&~o~REVNO.0STATUS/F,P,ORSFInitialIssueREVISIONDESCRIPTION INITIATING DOCUMENTS PER298-0600TRANSMITTAL NO./7ws";;~X@5$~~~~N~PRVNN!'%'%&#xc3;4o-".NN%-:K%%8PERFOR MAMCENERIFICATIOM!RECORD."'~%5~.';.ANNPAN%%%""':R~%%FN."N&%@5%%
968-1 8645 R4 (6/98)  
REVNO.0PERFORMED BY/DATETomErwinVERIFIEDBY/DATE5gvAPPROVEDBY/DATE6-'3>-gStudyCalculations shallbeusedonlyforthepurposeofevaluating alternate designoptionsorassisting theengineerinperforming assessments.
968-18645R4(6/98)  


WA58lNGTON tURLlCtOWER:43SUPPLYSYSTEMCALCULATION INDEXPageCalculation No.ME-02-98-04 RevisionNo.0Cont'donPageITEMPAGENO.SEQUENCECalculation CoverSheetCalculation IndexVerification Checklist forCalculation andCMR'sCalculation Reference ListCalculation OutputInterface DocumentRevisionIndexCalculation.
WA58lNGTON tURLlC tOWER:43 SUPPLY SYSTEM CALCULATION INDEX Page Calculation No.ME-02-98-04 Revision No.0 Cont'd on Page ITEM PAGE NO.SEQUENCE Calculation Cover Sheet Calculation Index Verification Checklist for Calculation and CMR's Calculation Reference List Calculation Output Interface Document Revision Index Calculation.
OutputSummaryCalculation MethodSketchesManualCalculation 1.000-1.100-1.200-1.300-1.400-2.000-3.000-4.000-Q,~095000-g0i~APPENDICES:
Output Summary Calculation Method Sketches Manual Calculation 1.000-1.100-1.200-1.300-1.400-2.000-3.000-4.000-Q,~0 9 5000-g 0 i~APPENDICES:
AppendixAPagesAppendixBPagesAppendixCPagesAppendixDPagesAppendixAppendixAppendixAppendixPagesPagesPagesPages96S.25278 R2(3/SS)
Appendix A Pages Appendix B Pages Appendix C Pages Appendix D Pages Appendix Appendix Appendix Appendix Pages Pages Pages Pages 96S.25278 R2 (3/SS)
WA5HINGTON PlSLICl'OWaa..~3SUPPLYSYSTEMVERIFICATION CHECKLIST FORCALCULATIONS ANDCMRsPageCont'dOnPage/,3QQCalculation/CMR ME-02-98-04 verifiedusingthefollowing methods:Checklist BelowRevision0wasQAlternate Calculations Checklist ItemClearStatement ofpurposeofanalysisMethodology clearlystatedandsufficiently detailedandappropriate toproposedapplication Logicalconsistency ofanalysis~Completeness ofdocumenting references
WA5HINGTON PlSLIC l'OWaa..~3 SUPPLY SYSTEM VERIFICATION CHECKLIST FOR CALCULATIONS AND CMRs Page Cont'd On Page/,3QQ Calculation/CMR ME-02-98-04 verified using the following methods: Checklist Below Revision 0 was Q Alternate Calculations Checklist Item Clear Statement of purpose of analysis Methodology clearly stated and sufficiently detailed and appropriate to proposed application Logical consistency of analysis~Completeness of documenting references
~Completeness ofdocumenting andupdatingoutputinterface documents Completeness ofinputAccuracyofinputdataConsistency ofinputdatawithapprovedcriteriaCompleteness instatingassumptions Validityofassumptions Calculation sufficiently detailed~Arithmetical accuracy~Physicalunitsspecified andcorrectly usedReasonableness ofoutputconclusion Supervisor independency check(IfactingasVerifier)
~Completeness of documenting and updating output interface documents Completeness of input Accuracy of input data Consistency of input data with approved criteria Completeness in stating assumptions Validity of assumptions Calculation sufficiently detailed~Arithmetical accuracy~Physical units specified and correctly used Reasonableness of output conclusion Supervisor independency check (If acting as Verifier)-Did not specify analysis approach-Did not rule out specific analysis options-Did not establish analysis inputs Initial~If a computer program was used:-Is the program appropriate for the proposed application?
-Didnotspecifyanalysisapproach-Didnotruleoutspecificanalysisoptions-Didnotestablish analysisinputsInitial~Ifacomputerprogramwasused:-Istheprogramappropriate fortheproposedapplication?
-Have the program error notices been reviewed to determine If they pose any limitations for this application?
-Havetheprogramerrornoticesbeenreviewedtodetermine Iftheyposeanylimitations forthisapplication?
-Is the program name, revision number and date of run inscribed on the output?-Is the program identified on the Calculation Method form?If so, is it listed in chapter 10 of the Engineering Standards Manual?Other Elements Considered
-Istheprogramname,revisionnumberanddateofruninscribed ontheoutput?-Istheprogramidentified ontheCalculation Methodform?Ifso,isitlistedinchapter10oftheEngineering Standards Manual?OtherElementsConsidered
~If a separate verifier was used for validating these functions or a portion of these functions, sign and'initial below.Based on the foregoing, the calculation is adequate for the purpose intended.Verifier Signature s)/Date Verifier Initials 968-2528O R1 (3I98)
~Ifaseparateverifierwasusedforvalidating thesefunctions oraportionofthesefunctions, signand'initial below.Basedontheforegoing, thecalculation isadequateforthepurposeintended.
Qg SUPFL~SYSTEM CALCULATION REFERENCE LIST PAGE 00 CONT'D ON PAGE CALCULATION NO o ME-02-98-04 REVISION NO.0 SEQUENCE NO.AUTHOR Failure Analysis Associates Supply System EPRI NRC ASME Burns 6 Roe ASME ISSUE DATEg EDZTIONi OR REVZSZO 2.23 5-14-98 1986 1988 1990 5/7/76 1989 TITLE NASCRAC Manual Ultrasonic Examination Data Sheet Evaluation of Flaws in Austenitic Steel Piping Technical Report on Material Selection and Processing Guidelines for BWR Coolant Pressure Boundary Piping ASME Section XZ, Nonmandatory Appendix C Hanford ZZ 251" BWR Vessel Stress Report T9,S9,F9 Recirculation Outlet Nozzle ASME Section XI DOCUMENT NO~R-R13-031 NP-4690-SR NUREG-0313,Rev.2 Fig C-3210-1 T9,S9,F9 IWB-3640 10 S.T.Rolfe J.M.Barsom ASME Structural Integrity J.F.Harvey 1977 1986 March 1998 1985 Fracture and Fatigue Control in Structures ASME Section III, Appendices The Effect of Radiation on the Fracture Toughness of Austenitic Stainless Steel Base and Weld Material Theory and Design of Pressure Vessels Appendix I Table Z-2.2 SZR-97 095 pg 61 44458 t I 0/89)'
VerifierSignature s)/DateVerifierInitials968-2528O R1(3I98)
WA5BINGTON ttiaLIC?OW81 k9 SUPPLY SYSTEM Prepared By/Date Tom Etwin CALCULATION OUTPUT IN'IXRFACE DOCUMENT REVISION INDEX Verified by/0 te R Page 00c)Cont'd On Page Q,4 oo Cslculstion No.ME-02098-04 Revision No.0 The below listed output interface calculations and/or documents are impacted by the current revision of the subject calculation.
QgSUPFL~SYSTEMCALCULATION REFERENCE LISTPAGE00CONT'DONPAGECALCULATION NOoME-02-98-04 REVISIONNO.0SEQUENCENO.AUTHORFailureAnalysisAssociates SupplySystemEPRINRCASMEBurns6RoeASMEISSUEDATEgEDZTIONiORREVZSZO2.235-14-981986198819905/7/761989TITLENASCRACManualUltrasonic Examination DataSheetEvaluation ofFlawsinAustenitic SteelPipingTechnical ReportonMaterialSelection andProcessing Guidelines forBWRCoolantPressureBoundaryPipingASMESectionXZ,Nonmandatory AppendixCHanfordZZ251"BWRVesselStressReportT9,S9,F9Recirculation OutletNozzleASMESectionXIDOCUMENTNO~R-R13-031 NP-4690-SR NUREG-0313,Rev.2 FigC-3210-1T9,S9,F9IWB-364010S.T.RolfeJ.M.BarsomASMEStructural Integrity J.F.Harvey 19771986March19981985FractureandFatigueControlinStructures ASMESectionIII,Appendices TheEffectofRadiation ontheFractureToughness ofAustenitic Stainless SteelBaseandWeldMaterialTheoryandDesignofPressureVesselsAppendixITableZ-2.2SZR-97095pg6144458tI0/89)'
The listed output interfaces require revision as a result of this calculation.
WA5BINGTON ttiaLIC?OW81 k9SUPPLYSYSTEMPreparedBy/DateTomEtwinCALCULATION OUTPUTIN'IXRFACE DOCUMENTREVISIONINDEXVerifiedby/0teRPage00c)Cont'dOnPageQ,4ooCslculstion No.ME-02098-04 RevisionNo.0Thebelowlistedoutputinterface calculations and/ordocuments areimpactedbythecurrentrevisionofthesubjectcalculation.
The documents have been revised, or the revision deferred with Manager approval, as indicated below.AFFECTED DOCUMENT NO.None CHANGED BY (e.g., BDC, SCN, CMR, Rev.)CHANGED DEFERRED (e.g., RFTS, LETTER NO.)DEPT.MANAGER'equired for deferred changes only.968-25285 R1 (3ISS)
Thelistedoutputinterfaces requirerevisionasaresultofthiscalculation.
WA58INGTON tulLlC tOWRR I>SUPPLY SYSPIM CALCULATION OUTPUT
Thedocuments havebeenrevised,ortherevisiondeferredwithManagerapproval, asindicated below.AFFECTEDDOCUMENTNO.NoneCHANGEDBY(e.g.,BDC,SCN,CMR,Rev.)CHANGEDDEFERRED(e.g.,RFTS,LETTERNO.)DEPT.MANAGER'equired fordeferredchangesonly.968-25285 R1(3ISS)
WA58INGTON tulLlCtOWRRI>SUPPLYSYSPIMCALCULATION OUTPUTSUMMARYPage,OOVCalculation No.ME-02-98-04 Cont'dOnPageQOQRevisionNo.0N1nozzlesafe-end.
ThefirstmodeledthDiscussion ofResultsThreecomputerrunswereusedtoevaluatetheindication intheeindication usingthenormaloperational loadsofthesystem.Thesecondmodelusedthreetransients thatcouldpossiblyoccurinoneyearinterval.
Thesetransients werethethermaldiscontinuity stress,OBEandSSE.Thismodelwasusedtodetermine thecrackgrowthexpectedfromthefatigueloadingatdifferent crackdepthsallowingdetermination ofwhenthecrackingwouldbecomeasignificant contributor tocrackgrowth.Thisallowedthedetermination thatthecrackgrowthwouldonlybecomesignificant attheendoftheintervalselectedforthenextinspection.
Thethirdmodelusedtheadjustedcracklength(20:1ratio)asrequiredbyNUREG0313Rev.2fortheendoftheIGSCCcrackgrowthatR16asinput.TherequiredfatiguecyclesforOBEandSSEwerethanappliedtothiscrackdimension todetermine acceptability fortheinterval.
REV.BARTheresultsofthecomputerrunsareasfollows:Theindication willgrowtoadepthof0.983"byR16ifIGSCCisactiveandthefatiguecyclesareexperienced Incomparing theresultstothe1989ASMESectionXICodeTablesIWB-3641-5 and-.6.Indication isacceptable forcontinued operation untilR16.Theweldwillbereinspected priortoR16,seePERA298-0600CAP1PTLA149503.Conclusions Takingintoaccountthefollowing conservatism's:
1.Theweldresidualstressdistribution usedisforanasweldedcomponent.
Thestainless steelsafe-endtonozzleweldhadMSIPperformed onitduringR9.Thedistribution shouldbecompressive attheID.2.Thestressesareconservatively highduetotheuseofOBEstressesforsteadystatethermal.Alsothepressurestressusedisthehoopstressnottheaxialpressurestress.3.Nofaucetareevidentduringtheweldexamination thatwouldindicateIGSCCisactive.Ithasbeendetermined thatWNP-2mayoperateuntilR16beforereexamination ofthenozzletosafe-endweldhastooccur.Theevaluation demonstrates undertheworstimposedloadingconditions theflawmeetstheacceptance criteriaoftheASMESectionXIIWB-'3641-5 and3641-6.Themainfracturemechanism thatwillpropagate theflawisintergranular stresscorrosion cracking.
IftheIGSCCphenomena.
isactivetheindication willincreaseindepthto0.983byR16.whichislessthantheASMECodeallowable.
968-18652R2(3/98)
WA5HINGTON tUSL1CtoWaa4JSUPPLYSYSTEMPreparedBy/DateT.M.Erwin AnalysisMethod(Checkappropriate boxes)O'.AT,C".T JT,ATTONMFTRODVerifiedby/DePageoOCalculation No.ME-02-98-04 RevisionNo.0Cont'dQnPage7.ooIHManual(Asrequired, documentsourceofequations inReference List)HComputerHIn-HouseProgramMainFrameHPersonalQComputerServiceBureauProgramQBCSQCDCQPCCQOTHERHVerifiedProgram:Codename/Revision NASCRAC2.23QUnverified Program:DocumentinAppendixBApproach/Methodology FlawEvaluation ProblemDuringtheperformance ofInservice Inspection ofthereactorvesselRRCAloopanindication was.discovered intheheataffectedzoneofthe24inchRRCsuctionnozzle(N1A)tosafe-endweld24RRC(2)A-1.Theindication isontheinsidesurfaceofthesafe-endandislocatedat5:00o'lockwhenlookingdownstream.
Theindication measures3.52inchesinlengthand0.29inchesdeepinapipewallthatis2.0inchesthick.Theindication existsinductileSA336ClassFBforgedtype304stainless steel.Thedesignminimumwallbasedonfaultedpressureis1.01inches.Theremaining ligamentinthesafe-endis1.71inches.Theindication hasexistedforsometime.Duetochangesintheultrasonic techniques andtechnology theabilitytodetectmaterialvariations andconditions hasincreased.
Anexampleofthisincreaseinsensitivity.
isdemonstrated inthisexamination.
ThesameweldwasexaminedduringtheR9outageandnoindication wasdetectedatthattime.However,usingthenewGEultrasonic datasystemthesamedatatapewasreviewedfromtheR9outageanditwasdetermined thatthesameindication existedatthattime.ThenewR13dataoutputandtheR9dataoutputwerecomparedandtheindication showsnochangeindepthorlengththatisnotwithintheinaccuracies oftheequipment.
Theindication hasbeeninthesystemsinceatleastR9withnochangeindepthorlength.Theindication isrequiredtobeevaluated asanIGSCCindication eventhoughitshowsnoIGSCCcharactreistics.
FlawEvaluation Thelinearindication wasevaluated usingtheNASCRACcomputercodedeveloped byFailureAnalysisAssociates.
Thiscodeusesstressfieldinfluence functions asthebasisforflawpropagation.
TheNASCRACmodelselectedisashellelementcontaining anelliptically shapedcircumferential flaw.Themodelisidentified as703intheNASCRACmanual.Thisparticular modelincludesthreecrackgrowthdegreesoffreedomencompassing therespective circumferential andcrackdepthcoordinates.
Theevaluation wasperformed usingconservative linearelasticfracturemechanics principles.
WA58INGTON Pl/5LICPOW51'lY9SUPPLYSYSHMCALCULATION METHOCONTINVATION PAGECont'dOnPageRevisionNo.Page7~~lg.80&Calculation No.f='-OP?P-oYAllModelsThemaximumfracturetoughness usedforthestainless steelmaterialwas150ksi~in.Thevalueisconservative andisapproximately onehalfofthefracturetoughness valuethatisachievable forthistypeofstainless steelproductform.(BWRVIPReportSIR-97-095)
(10)LoadCombinations Theloadcombinations usedinthisevaluation areprovidedinsection5.0ofthiscalculation.
Thefollowing providesthecombinations usedbyeachofthemodels.N1IGSCC.IN TheIGSCCcalculation fornormaloperation wasperformed using11nodepointsfromtheI.D.toO.D.ForeachpointKminwascalculated bysettingthestressvalueequaltozero.Kmaxwasdetermined byconservatively combining theweldresidualstresses, circumferential pressurestress,deadweight andtheOBEstressthatincludesthermal(seesection5.0).Thenumberofcyclesusedis24sincetheParisequationcrackgrowthlawisinin/hour.Oneloadblockrepresents 24hoursoroneday.N1FAT.INN1FAT1.INThefatiguemodelsalsoused11nodesfromI.D.toO.D.Themodelsweresetupusingstressesinpsiinsteadofksi.TheParisequation(fatigue) wasestablished usingpsiinsteadofksi.TheKminforthefatiguemodelswascalculated usingthenormaloperational stressesusedintheIGSCCmodel.Thecyclicstressesweremadeupofcyclesfromthreetransients thatre-presentthepotential cyclicloadingthenozzlecouldexperience inoneyear.Thesetransients were:Onecycleofthermaldiscontinuity, 300cyclesOBE(contains SRV)andtencyclesSSE.968-25291 R1(3/98)
WA5HIHGIN kUaLlcFOWSRI>svppavsvsnmCALCULATION METHODCONTINUATION PAGEPageconrdonpage'3,UspWCalculation No.ME-02-98-04 RevisionNo.0IuatedThemodelingappliestherequirements identified inNRCGenericLetter88-01.Theflawwasevaasanintergranular stresscorrosion crackusingthecrackgrowthrateequationprovidedinthegenericletter.Theweldresidualstressdistribution providedintheletterwasalsousedeventhoughtheweldinquestionhadMechanical StressImprovement (MSIP)performed onitin1994.Theweldresidualstressesaredeveloped fromroomtemperature yieldfor304material(30ksi)asthenormalization stressoutlinedinthegenericletter.Theflawaspectratiowasreviewedandcomparedtotherequirements.
ofNUREG-0313, Rev.2.Theaspectratiowasdetermined tobe12:1whichrequirescorrection inlengthasthecrackgrowsuntilanaspectratioof20:1isexceeded.
Therefore, thefinalcrackgrowthaspectratiowascorrected manuallytocomplywiththerequirements ofNUREG-0313, Rev.2.Thecorrection foraspectratiowasperformed ateachRefueling outagetimeperiodbaseduponthecomputeroutputfortheIGSCCmodel.Theseintervals weredetermined asfollows:R14willoccurinapproximately 290days,withtwosubsequent 290dayintervals untilR16.ThefiawlengthanddepthfromtheR16corrected valuewasthenusedasinputintothefatiguemodel,Thefatiguemodelusedoneyearofexpectedupsetandfaultedconditions asrequiredbytheCodetoassurethatthecrackwillremainwithintheCodeallowable limitsandNRCrequirements.
ThreeinputfileswereusedtoperformtheIGSCCandfatigueevaluations.
Thesefileswere:N1IGSCC.IN IGSCCfornormaloperations N1FAT.INFatigueincluding oneyearofthermaldiscontinuity (1cycle),OBE(300cycles),SSE(10cycles)NlFAT1.INFatigueincorporating R16corrected cracklengthforNRC20:1ratioandthesamefatiguecyclesforN1FAT.INThefollowing assumptions andinputswereusedindeveloping eachofthemodels.AllModels:Theflawmodelusedwas703forasemi-elliptical (circumferential) surfacecrackinacylinder.
(1)FlawDimensions N1IGSCC.IN Thecrackusedwas3.52"longand0.29"deep.Thehalfcrackwascalculated taking3.52"andN1FAT.INdividingitby2toyield1.76".(2)N1FAT1.IN Thecracklengthforthismodelwastheresultsofthe20:1aspectratiorequiredbytheNRCforIGSCCcracks.Thevalueusedis&omthecrackdepthfor870daysofIGSCCgrowththatwouldoccurbyR16.Thevaluesusedinthemodelwerealengthof17.8ssandadepthof.0.89".Thehalfcrackwasdetermined bydividingthelengthby2thatresultsinavalueof8.9".CrackGrowthLawsN1IGSCC.IN TheParisequationusedforIGSCCgrowthwasthatprovidedinNUREG-0313 Rev.2.The(4)equationused:359E8(hK)'nksiWin-N1FAT.IN'hecrackgrowthrateforfatigueinBWRwaterenvironment wasdetermined usingthefollowing N1FAT1.IN Parisequation:
(3)6.155E-18(tK)
'npsiWinN1IGSCC.IN ThelK~valueusedwas10.0or10000forthefatigueN1FAT.INN1FAT1.IN
+
5IOINCONEI.182BUrrERINC'7/1637~21/32,./I/eIxI31/32'NCONEL 182OVERLAY3/1O.06CrrP)10'SAFE-NO~IIE0OEIALIS'e30ltKLOS0Nli180'00PlH)80Lm8022UIRC12)A-I 180'OOPl2USC12)8-I O'DOP80MlCIZ)i-2 180'CCPl2UIRC12)8-2 O'CCP8l.180NOZZI.E~IIELOOEDLSAFE-ENO(0.020'CrUAL CARBONCONIENr)I.383~~rt5/803/0R019/32Rl/IS~RPVIS'55CLAOOINCNOIE5CllB.OC>>ELHI)tllIONGUI-I)9NOZZLE'10S)ELLHELDG2Ul-101HOZZLE10SlFEEHOIEELD03Ul7SSFE-EHO10PIPE)EKLD0Ul-101SllEftOFORCIIXIIFEX)HIHEO) 05Ul-119HOZhEINHKRRlDIUSg)~~0t"<<It)0I/s~aIIOO,tPIPE2I/O911/16OZZLE/weeeeleolooeseeeeeeesI/elEIAIeeooeseeesE4loeoltoo flgpssloo~'lESDlltlw, eeftitlto SolesFEEoeeo.EA.129/32PIPIHC5fS'iftttl'tfCfit4$SlffIOOtlttftthf~aNlNOZZLEINCONEL82Roor/NOrINCONEL182BALA)ICE'17$~Slfos)EtSEOECE/S~1)HISCftlt)IN)
ISIH)ftf%0fORUSKINFFKSKRTICE ftf)INSERT)LE IHSPfCIICESSPRt)CR>ttS OtLT,C)LOLOC>>)CORER)IftdM5llfOE)tf)IftE)tftcttItkLit)lC>>KSStllIL1ffftt)EEOllIt>>ttZSt4tfRIOLSPECSS)5$CR)E)ECLISO))ttCLIRSOSCeCL7SOSX)M~CL1CSCSREFERENCESE CSIIR)CLElRCO.SNI<6RETiSHf47RET3SHI48RET4151ISOMEIAICS RRC101-1RETRRC102-)RfT205AE023NINOZZLEFORGIHCItlSlff-fHDFORCIIX'l NOZZLEXSSEIKILT PCCIRCSEC))tftti1MQhfllO'180')OLIlf CllSSAIJSFCCt)OKCLSSS~Ift>>RAItf)ELEIXEOWA>>ttclOSIEAS1079VSDIIHCIEOE fValCPOKRSN'PLYSYSIENOtte\Ieft.
SA)stolttottet)tEFEP-2KLDCCOEPOKHIICKHIIFIClllttt DI)CRlttEt7)I)RIMEACOfORIt)C~EtEASEC)COt))LSEr~fIff~fCOSOOOOODEERHORPV-105HKTI 5-545CrackGeometModeiLibraryinNASCRACSoftware5.1.26Semi-Elliptical (Circumferential)
SurfaceCrackinaCylinderModelFeatureFORTRANVariableOptionFeaturedModelIndexNumberKRKTYPNumberofDegreesofFreedomKRKDOFCrackFrontShapeFiniteWidthEffectsInQuenceFunctionVariableThickness EffectsIVTHICJ-Integral Solutions 7033Semi-Elliptical YesYesNoNoDataInputDescription InputDescription FORTRANInputVariableFormatRemarksVariableThickness InitialCrackSizeBodyWidthsCrackPositionCrackOrientation StressInputa1a2a3tW'gW3XcYc4~-(~)<-(~v)IVTHICAINITL(l)
AINITL(2)
AINITL(3)
WIDTHS(1)
WIDTHS(2)
WIDTHS(3)
WIDTHS(4)
CENTER(1)
CENTER(2)
CRKANGConstant-ConstantConstantConstantConstantConstantConstantConstantConstantEquational TabularEquational Tabular)Terminate
)AnalysisOnlyTabularNotApplicable Constant~HLimits:1<aq+as/aq<20;0.0<aq/t<1.0Accuracy:
approximately 10'or0.0<a,/t<0.8and1<a2+as/a><12HANItNOTOR fl&lICPO'N406$5UBKYSYFHMCALC:-Ov8Version2.2PAGE:.CSPl'souBY:DATE:SVERIFIED.
DATE


5.1LibrofK-andJ-Solutions
==SUMMARY==
-ModelDescritions5-55703Zcr(x,y)IIIIIIIXa2~/traa)XNASCRACUser'sManualVersion2:2 wA$HINGToNtuaLIGtowaa4$SUPPLYSYSTIMPtapd8/OatMkbtUALCALCULATION VetlliadBy/DataPago.00Cont'aOnPago5.CIg~Calculation No.-e-o/RevisionNoThepurposeofthecalculation istodetermine theboundingstressintheRecirculation outletnozzleN1atsafeendtonozzleweld.Actualloadsatthenozzleduetothepipearelowerthantheallowable loadsprovidedinthereference documents listedbelow.Actualpipeloadsareavailable incalculation 8.14.107.
Page ,OOV Calculation No.ME-02-98-04 Cont'd On Page Q OQ Revision No.0 N1 nozzle safe-end.The first modeled th Discussion of Results Three computer runs were used to evaluate the indication in the e indication using the normal operational loads of the system.The second model used three transients that could possibly occur in one year interval.These transients were the thermal discontinuity stress, OBE and SSE.This model was used to determine the crack growth expected from the fatigue loading at different crack depths allowing determination of when the cracking would become a significant contributor to crack growth.This allowed the determination that the crack growth would only become significant at the end of the interval selected for the next inspection.
The third model used the adjusted crack length (20:1 ratio)as required by NUREG 0313 Rev.2 for the end of the IGSCC crack growth at R 16 as input.The required fatigue cycles for OBE and SSE were than applied to this crack dimension to determine acceptability for the interval.REV.BAR The results of the computer runs are as follows: The indication will grow to a depth of 0.983" by R 16 if IGSCC is active and the fatigue cycles are experienced In comparing the results to the 1989 ASME Section XI Code Tables IWB-3641-5 and-.6.Indication is acceptable for continued operation until R 16.The weld will be reinspected prior to R16, see PERA 298-0600 CAP 1 PTL A149503.Conclusions Taking into account the following conservatism's:
1.The weld residual stress distribution used is for an as welded component.
The stainless steel safe-end to nozzle weld had MSIP performed on it during R 9.The distribution should be compressive at the ID.2.The stresses are conservatively high due to the use of OBE stresses for steady state thermal.Also the pressure stress used is the hoop stress not the axial pressure stress.3.No faucet are evident during the weld examination that would indicate IGSCC is active.It has been determined that WNP-2 may operate until R16 before reexamination of the nozzle to safe-end weld has to occur.The evaluation demonstrates under the worst imposed loading conditions the flaw meets the acceptance criteria of the ASME Section XI IWB-'3641-5 and 3641-6.The main fracture mechanism that will propagate the flaw is intergranular stress corrosion cracking.If the IGSCC phenomena.
is active the indication will increase in depth to 0.983 by R16.which is less than the ASME Code allowable.
968-1 8652 R2 (3/98)
WA5HINGTON tUSL1C toWaa 4J SUPPLY SYSTEM Prepared By/Date T.M.Erwin Analysis Method (Check appropriate boxes)O'.AT,C".T JT,ATTON MFTROD Verified by/D e Page oO Calculation No.ME-02-98-04 Revision No.0 Cont'd Qn Page 7.oo I H Manual (As required, document source of equations in Reference List)H Computer H In-House Program Main Frame H Personal Q Computer Service Bureau Program Q BCS Q CDC Q PCC Q OTHER H Verified Program: Code name/Revision NASCRAC 2.23 Q Unverified Program: Document in Appendix B Approach/Methodology Flaw Evaluation Problem During the performance of Inservice Inspection of the reactor vessel RRC A loop an indication was.discovered in the heat affected zone of the 24 inch RRC suction nozzle (N1A)to safe-end weld 24RRC(2)A-1.The indication is on the inside surface of the safe-end and is located at 5:00 o'lock when looking downstream.
The indication measures 3.52 inches in length and 0.29 inches deep in a pipe wall that is 2.0 inches thick.The indication exists in ductile SA 336 Class FB forged type 304 stainless steel.The design minimum wall based on faulted pressure is 1.01 inches.The remaining ligament in the safe-end is 1.71 inches.The indication has existed for some time.Due to changes in the ultrasonic techniques and technology the ability to detect material variations and conditions has increased.
An example of this increase in sensitivity.
is demonstrated in this examination.
The same weld was examined during the R9 outage and no indication was detected at that time.However, using the new GE ultrasonic data system the same data tape was reviewed from the R9 outage and it was determined that the same indication existed at that time.The new R13 data output and the R9 data output were compared and the indication shows no change in depth or length that is not within the inaccuracies of the equipment.
The indication has been in the system since at least R9 with no change in depth or length.The indication is required to be evaluated as an IGSCC indication even though it shows no IGSCC charactreistics.
Flaw Evaluation The linear indication was evaluated using the NASCRAC computer code developed by Failure Analysis Associates.
This code uses stress field influence functions as the basis for flaw propagation.
The NASCRAC model selected is a shell element containing an elliptically shaped circumferential flaw.The model is identified as 703 in the NASCRAC manual.This particular model includes three crack growth degrees of freedom encompassing the respective circumferential and crack depth coordinates.
The evaluation was performed using conservative linear elastic fracture mechanics principles.
WA58INGTON Pl/5LIC POW51'lY9 SUPPLY SYSHM CALCULATION METHO CONTINVATION PAGE Cont'd On Page Revision No.Page 7~~l g.80&Calculation No.f='-OP?P-o Y All Models The maximum fracture toughness used for the stainless steel material was 150ksi~in.The value is conservative and is approximately one half of the fracture toughness value that is achievable for this type of stainless steel product form.(BWRVIP Report SIR-97-095)
(10)Load Combinations The load combinations used in this evaluation are provided in section 5.0 of this calculation.
The following provides the combinations used by each of the models.N1IGSCC.IN The IGSCC calculation for normal operation was performed using 11 node points from the I.D.to O.D.For each point Kmin was calculated by setting the stress value equal to zero.Kmax was determined by conservatively combining the weld residual stresses, circumferential pressure stress, deadweight and the OBE stress that includes thermal (see section 5.0).The number of cycles used is 24 since the Paris equation crack growth law is in in/hour.One load block represents 24 hours or one day.N1 FAT.IN N1FAT1.IN The fatigue models also used 11 nodes from I.D.to O.D.The models were set up using stresses in psi instead of ksi.The Paris equation (fatigue)was established using psi instead of ksi.The Kmin for the fatigue models was calculated using the normal operational stresses used in the IGSCC model.The cyclic stresses were made up of cycles from three transients that re-present the potential cyclic loading the nozzle could experience in one year.These transients were: One cycle of thermal discontinuity, 300 cycles OBE (contains SRV)and ten cycles SSE.968-25291 R1 (3/98)
WA5HIHGIN kUaLlc FOWSR I>svppav svsnm CALCULATION METHOD CONTINUATION PAGE Page conrd on page'3, UspW Calculation No.ME-02-98-04 Revision No.0 Iuated The modeling applies the requirements identified in NRC Generic Letter 88-01.The flaw was eva as an intergranular stress corrosion crack using the crack growth rate equation provided in the generic letter.The weld residual stress distribution provided in the letter was also used even though the weld in question had Mechanical Stress Improvement (MSIP)performed on it in 1994.The weld residual stresses are developed from room temperature yield for 304 material (30 ksi)as the normalization stress outlined in the generic letter.The flaw aspect ratio was reviewed and compared to the requirements.
of NUREG-0313, Rev.2.The aspect ratio was determined to be 12:1 which requires correction in length as the crack grows until an aspect ratio of 20:1 is exceeded.Therefore, the final crack growth aspect ratio was corrected manually to comply with the requirements of NUREG-0313, Rev.2.The correction for aspect ratio was performed at each Refueling outage time period based upon the computer output for the IGSCC model.These intervals were determined as follows: R 14 will occur in approximately 290 days, with two subsequent 290 day intervals until R 16.The fiaw length and depth from the R16 corrected value was then used as input into the fatigue model, The fatigue model used one year of expected upset and faulted conditions as required by the Code to assure that the crack will remain within the Code allowable limits and NRC requirements.
Three input files were used to perform the IGSCC and fatigue evaluations.
These files were: N1IGSCC.IN IGSCC for normal operations N1FAT.IN Fatigue including one year of thermal discontinuity (1cycle), OBE (300 cycles), SSE (10 cycles)Nl FAT1.IN Fatigue incorporating R16 corrected crack length for NRC 20:1 ratio and the same fatigue cycles for N1FAT.IN The following assumptions and inputs were used in developing each of the models.All Models: The flaw model used was 703 for a semi-elliptical (circumferential) surface crack in a cylinder.(1)Flaw Dimensions N1IGSCC.IN The crack used was 3.52" long and 0.29" deep.The half crack was calculated taking 3.52" and N1FAT.IN dividing it by 2 to yield 1.76".(2)N1FAT1.IN The crack length for this model was the results of the 20:1 aspect ratio required by the NRC for IGSCC cracks.The value used is&om the crack depth for 870 days of IGSCC growth that would occur by R16.The values used in the model were a length of 17.8ss and a depth of.0.89".The half crack was determined by dividing the length by 2 that results in a value of 8.9".Crack Growth Laws N1IGSCC.IN The Paris equation used for IGSCC growth was that provided in NUREG-0313 Rev.2.The (4)equation used: 359E 8(hK)'n ksiWin-N1FAT.IN'he crack growth rate for fatigue in BWR water environment was determined using the following N1FAT1.IN Paris equation: (3)6.155E-18(tK)
'n psiWin N1IGSCC.IN The lK~value used was 10.0 or 10000 for the fatigue N1FAT.IN N1FAT1.IN+
5 IO INCONEI.182 BUrrER INC'7/16 37~21/32 ,./I/e Ix I 31/32'NCONEL 182 OVERLAY 3/1 O.06 CrrP)10'SAFE-NO~IIE 0 OEIA L IS'e30 ltKL OS 0 Nli 180'00P l H)8 0 Lm 8 0 2 2UIRC12)A-I 180'OOP l 2USC12)8-I O'DOP 8 0 MlCIZ)i-2 180'CCP l 2UIRC12)8-2 O'CCP 8 l.180 NOZZI.E~IIELO OED L SAFE-ENO (0.020'CrUAL CARBON CONIENr)I.383~~r t 5/8 0 3/0 R 0 19/32 R l/IS~RPV IS'55 CLAOOINC NOIE5 Cll B.OC>>ELHI)tll ION G UI-I)9 NOZZLE'10 S)ELL HELD G 2 Ul-101 HOZZLE 10 SlFE EHO IEELD 0 3 Ul 7 SSFE-EHO 10 PIPE)EKLD 0 Ul-101 SllE ftO FORCI IX IIF EX)HIHEO)0 5 Ul-119 HOZhE INHKR RlDIUS g)~~0 t"<<It)0 I/s~aI I O O,t PIPE 2 I/O 9 11/16 OZZLE/w eeeeleo lo oeseeeee ees I/el EIAI eeo oeseees E4loeoltoo fl gpss loo~'l ESDlltlw, eeftitlto Soles FEEoeeo.EA.1 29/32 PIPIHC 5 fS'iftt tl'tfC fit 4$Slff IOO tlt tftthf~a Nl NOZZLE INCONEL 82 Roor/NOr INCONEL 182 BALA)ICE'17$~Sl f os)Et SEOEC E/S~1)HIS Cftlt)IN)IS IH)ftf%0 fOR USK IN FFKSKRTICE ftf)INSERT)LE IHSPf C II CESS PRt)CR>ttS OtLT, C)L OLOC>>)CORER)If tdM5 llf OE)tf)If tE)tf tctt ItkL it)l C>>K SS tll I L 1fff tt)EE Oll It>>tt ZS t4tfRIOL SPEC SS)5$CR)E)E CL I SO))tt CL IR SO SCe CL 7 SO SX)M~CL 1 CS CS REFERENCESE CSI IR)CLElR CO.SNI<6 RET i SHf 47 RET 3 SHI 48 RET 4 151 ISOMEIAICS RRC 101-1 RET RRC 102-)Rf T 205 AE 023 NI NOZZLE FORGIHC Itl Slff-fHD FORCIIX'l NOZZLE XSSEIKILT PCCIRC SEC))tft ti1 MQhf ll O'180')OLIlf CllSSA I JSFC Ct)OK CLSSS~I ft>>RA I tf)ELE IXEOWA>>ttcl OSIEA S 10 79 VSDIIHCIEOE fValC POKR SN'PLY SYSIEN Otte\Ieft.
SA)stol ttot tet)t EFEP-2 KLD C COEPOKHI ICKHIIFIClllttt DI)CRltt Et 7)I)R IMEACO fOR It)C~Et EASE C)CO t))LSE r~f Iff~f COSO OOOO DEER HO RPV-105 HKT I 5-54 5 Crack Geomet Modei Library in NASCRAC Software 5.1.26 Semi-Elliptical (Circumferential)
Surface Crack in a Cylinder Model Feature FORTRAN Variable Option Featured Model Index Number KRKTYP Number of Degrees of Freedom KRKDOF Crack Front Shape Finite Width Effects InQuence Function Variable Thickness Effects IVTHIC J-Integral Solutions 703 3 Semi-Elliptical Yes Yes No No Data Input Description Input Description FORTRAN Input Variable Format Remarks Variable Thickness Initial Crack Size Body Widths Crack Position Crack Orientation Stress Input a1 a2 a3 t W'g W3 Xc Yc 4~-(~)<-(~v)IVTHIC AINITL(l)AINITL(2)AINITL(3)WIDTHS(1)WIDTHS(2)WIDTHS(3)WIDTHS(4)CENTER(1)CENTER(2)CRKANG Constant-Constant Constant Constant Constant Constant Constant Constant Constant Equational Tabular Equational Tabular)Terminate)Analysis Only Tabular Not Applicable Constant~H Limits: 1<aq+as/aq<20;0.0<aq/t<1.0 Accuracy: approximately 10'or 0.0<a,/t<0.8 and 1<a2+as/a><12 HANItNOTOR fl&lIC PO'N40 6$5UBKY SYFHM CALC:-Ov 8 Version 2.2 PAGE:.CSPl'sou BY: DATE: S VERIFIED.DATE
 
5.1 Libr of K-and J-Solutions
-Model Descri tions 5-55 703 Z cr (x,y)I I I I I I I X a2~/t r a a)X NASCRAC User's Manual Version 2:2 wA$HINGToN tuaLIG towaa 4$SUPPLY SYSTIM Ptap d 8/Oat MkbtUAL CALCULATION Vetlliad By/Data Pago.00 Cont'a On Pago 5.CI g~Calculation No.-e-o/Revision No The purpose of the calculation is to determine the bounding stress in the Recirculation outlet nozzle N1 at safe end to nozzle weld.Actual loads at the nozzle due to the pipe are lower than the allowable loads provided in the reference documents listed below.Actual pipe loads are available in calculation 8.14.107.


==References:==
==References:==


1.HanfordII-251nBWRVesselStressReportSectionsT9,S9,F9Recirculation OutletNozzle.2.Drawing732E143,PurchasepartReactorVesselMPL itemNo.B13-D0033.Drawing761E716,ReactorVesselLoadingsRecirculation Outlet:MaximumAllowable NozzleLoadsforEvaluation:
1.Hanford II-251 n BWR Vessel Stress Report Sections T9,S9,F9 Recirculation Outlet Nozzle.2.Drawing 732E143, Purchase part Reactor VesselMPL item No.B13-D003 3.Drawing 761E716, Reactor Vessel Loadings Recirculation Outlet: Maximum Allowable Nozzle Loads for Evaluation:
DesignMech.LoadDeadWt.SeismicPriSeismicRFEThermalRFEH(kips)0.058.50164164292M(inchkips)58501580295029507020Theabovemomentsare.appliedattheendofthesafeend.Theweldofconcernisthesafeendtonozzleweldwhichis9.75inches+/-
Design Mech.Load Dead Wt.Seismic Pri Seismic RFE Thermal RFE H (kips)0.0 58.50 164 164 292 M (inch kips)5850 1580 2950 2950 7020 The above moments are.applied at the end of the safe end.The weld of concern is the safe end to nozzle weld which is 9.75 inches+/-1/16 inch from the load application point.Nozzle Design Pressure: 1250 psi, Nozzle Faulted Pressure: 1375 psi Nozzle Loads for Recirculation Outlet Nozzle from Calculation 8.14.107 which includes power uprate and snubber optimization of the recirculation piping.Condition Primary Secondary Primary (Faulted)Force-Ibs 5552 34431 25481.Moment-inch kips 167.408 1805.391 1066.453 966.16694 Rl (6/93) waarrlrrGTorr ttraLIc towaa 4$suptLv sysrmr MAMJAL CALCULATION Pago.ao Calculation No Cont'a On Pago g 5 D Q Praparad 8/Dat Varifiod By/Data-eh'-ov Aevi~ion No.0 Safe end material is SA-336 F8 Sm pa 16.65 ksi O575 F Z:=9.75 inch Z is the offset distance from the application point of the loads.Pd:=1250 psi OD:=25.5 inch Pf pa 1375 psi ID:=21.6876 inch I mom.=9896 in" A no~:=141.292 In Calculate tangential Pressure Stresses using the thickwall formula from Theory'nd Design of Pressure Vessels, J.F.Harvey, 1985 pg 61 ID b OD r pa 10.84, 11.2..12.75 inch a Pd Op(r)pa b-a b2 1+-r2 psl Pressure Stress Variation with radius from ID to OD is shown below.a p(r)10.84 11.2 11.56 11.92 12.28 12.64 7.79 10 7.504 10 7.244 10 7.007.10 6.791~10 6.594 10 Since the range variable for r did not exactly match the outside diameter the following equation adjusts to the exact outside radius.r pa 12.75 968-'l 8694 Al i6/93)
1/16inchfromtheloadapplication point.NozzleDesignPressure:
IS sUPPLY sys'BM MAI'AJAL CALCULATION Pd go 0 Cont's On Paga g Praparad By ata y2C Vari/lad By/Data~/~/f~Calculation No.I=-0-Rh'-o"/Aavision No.a p(r)ps a Pd b2 2 b2 1+-r2 G p (I)6.536 1 0 3 PSI.Thus the tangential pressure stress varies from 7800 psi to 6530 psi.This stress is tensile around the circumference of the shell.Based on the orientation of the flaw the tangential stress would not be a tensile stress for a flaw in the tangential direction.
1250psi,NozzleFaultedPressure:
Reset the radius to vary from lD to OD and recalculate the radial pressure stress.r ps 10.84, 11.2..12.75 inch a Pd<pr(r)ps b2 2 b2 1--r2 a=10.844 b=12.75 a pr(r)-1.253 10-967.181-707.494-470.979'254.958-57.13 PSI 10.84 11.2 11.56 11.92 12.28 12.64 inches Calculate nozzle bending stresses at the safe end to nozzle weld by applying the moment plus the force times the offset to give a maximum bending moment Deadweight Loads: Mdwt pa 167.5+5.552 Z in-kips c ps 12.75 Mdwt=221.632 968.18694 Rl I6/93) wASNINOTON tlraLtc tow!a 4 SUPPLY SYSHM Prepared 8y/D a zs/~8 MAAUAL CALCULATION Verified 8y/Data S~/yg Page 0 Cont'a On Page g pa+Calculation No.--oQ-Y-o i-.Aewaron No Mdwt c c dWt'=l mom P'wt=0.286'si Upset Loads including Thermal The GE load combination for RPV nozzles takes the maximum of eight different combinations which include thermal, obe, obe displacements, turbine stop valve closure, srv, and srv inertia.M pbe:=1806+34.5'Z M pbe=2.142'10 3 in-kips Mpbe c~abc'=l mom<pbe=2.76 ksi Faulted Loads: The GE faulted loads combination does not include thermal bending on the nozzle.Since the upset load combination includes thermal, it is conservatively added to the faulted loading without removal of the dynamic upset loads.M sse.=1067+25.5 Z+M pbe sse-3.458 10 in-kip 3 M sse'~sse'=l mom cz=4.455 ksi 968.18694 Al{6/93)  
1375psiNozzleLoadsforRecirculation OutletNozzlefromCalculation 8.14.107whichincludespoweruprateandsnubberoptimization oftherecirculation piping.Condition PrimarySecondary Primary(Faulted)
@SUPPLY SYSIZM Prepared By/D a Y+8 MAMJAL CALCULATION Verified By/Date Page Or, Cont's On P9 S'-OOC REV.B/IR CelcUI ation No.--0)-tY-0 Revision No.Determine the discontinuity stresses due to the attachment of the stainless steel safe end to the carbon steel vessel nozzle.The vessel nozzle has a 3/8 in inconel butter on the surface and then is jointed to the safe end with an inconel weld.Thus there are three different materials to be evaluated for thermal growth.Nozzle Forging-SA-508 CL 2 (3/4NI-1/2Mo-CR-V)
Force-Ibs55523443125481.Moment-inchkips167.4081805.3911066.453966.16694 Rl(6/93) waarrlrrGTorr ttraLIctowaa4$suptLvsysrmrMAMJALCALCULATION Pago.aoCalculation NoCont'aOnPagog5DQPraparad8/DatVarifiodBy/Data-eh'-ovAevi~ionNo.0SafeendmaterialisSA-336F8Smpa16.65ksiO575FZ:=9.75inchZistheoffsetdistancefromtheapplication pointoftheloads.Pd:=1250psiOD:=25.5inchPfpa1375psiID:=21.6876inchImom.=9896in"Ano~:=141.292InCalculate tangential PressureStressesusingthethickwall formulafromTheory'nd DesignofPressureVessels,J.F.Harvey,1985pg61IDbODrpa10.84,11.2..12.75inchaPdOp(r)pab-ab21+-r2pslPressureStressVariation withradiusfromIDtoODisshownbelow.ap(r)10.8411.211.5611.9212.2812.647.79107.504107.244107.007.106.791~106.59410Sincetherangevariableforrdidnotexactlymatchtheoutsidediameterthefollowing equationadjuststotheexactoutsideradius.rpa12.75968-'l8694Ali6/93)
Coeffiecient of Thermal Expansion-Group A Materials at 550 F 7.34X1 0"-6in/in/F Modulus of Elasticity
ISsUPPLYsys'BMMAI'AJALCALCULATION Pdgo0Cont'sOnPagagPraparadByatay2CVari/ladBy/Data~/~/f~Calculation No.I=-0-Rh'-o"/AavisionNo.ap(r)psaPdb22b21+-r2Gp(I)6.536103PSI.Thusthetangential pressurestressvariesfrom7800psito6530psi.Thisstressistensilearoundthecircumference oftheshell.Basedontheorientation oftheflawthetangential stresswouldnotbeatensilestressforaflawinthetangential direction.
-27.0X10"6 psi Safe End-SA-336 F8-(18CR-8Ni)Group G Coefficient of Thermal Expansion-Group 9.45X1 0'-6 in/in/F Modulus of Elasticity
ResettheradiustovaryfromlDtoODandrecalculate theradialpressurestress.rps10.84,11.2..12.75inchaPd<pr(r)psb22b21--r2a=10.844b=12.75apr(r)-1.25310-967.181-707.494-470.979'254.958-57.13PSI10.8411.211.5611.9212.2812.64inchesCalculate nozzlebendingstressesatthesafeendtonozzleweldbyapplyingthemomentplustheforcetimestheoffsettogiveamaximumbendingmomentDeadweight Loads:Mdwtpa167.5+5.552Zin-kipscps12.75Mdwt=221.632968.18694 RlI6/93) wASNINOTON tlraLtctow!a4SUPPLYSYSHMPrepared8y/Dazs/~8MAAUALCALCULATION Verified8y/DataS~/ygPage0Cont'aOnPagegpa+Calculation No.--oQ-Y-oi-.AewaronNoMdwtccdWt'=lmomP'wt=0.286'siUpsetLoadsincluding ThermalTheGEloadcombination forRPVnozzlestakesthemaximumofeightdifferent combinations whichincludethermal,obe,obedisplacements, turbinestopvalveclosure,srv,andsrvinertia.Mpbe:=1806+34.5'ZMpbe=2.142'103in-kipsMpbec~abc'=lmom<pbe=2.76ksiFaultedLoads:TheGEfaultedloadscombination doesnotincludethermalbendingonthenozzle.Sincetheupsetloadcombination includesthermal,itisconservatively addedtothefaultedloadingwithoutremovalofthedynamicupsetloads.Msse.=1067+25.5Z+Mpbesse-3.45810in-kip3Msse'~sse'=lmomcz=4.455ksi968.18694 Al{6/93)  
-25.55X1 06 psi.Inconel Weld Metal: S8-167 N06690 (58 Ni-29Cr-9Fe)Coeffiecient of Thermal Expansion-8.13X1 0"-6in/in/F Modulus of Elasticity
@SUPPLYSYSIZMPreparedBy/DaY+8MAMJALCALCULATION VerifiedBy/DatePageOr,Cont'sOnP9S'-OOCREV.B/IRCelcUIationNo.--0)-tY-0RevisionNo.Determine thediscontinuity stressesduetotheattachment ofthestainless steelsafeendtothecarbonsteelvesselnozzle.Thevesselnozzlehasa3/8ininconelbutteronthesurfaceandthenisjointedtothesafeendwithaninconelweld.Thustherearethreedifferent materials tobeevaluated forthermalgrowth.NozzleForging-SA-508CL2(3/4NI-1/2Mo-CR-V)
-28.2X1 0"6psi Check nozzle to inconel thermal discontinuity.
Coeffiecient ofThermalExpansion
Eab'=27.0 10+28.2.10 E ab=2.76.10 7 psl ua.=734 10-6 u b.=8.13 10 T a.=550-70~tdis'=Eab'a Ta ub Tb Tb ps 550-70 a tdis=1.047.10 4 psl Nozzle to safe end Check the inconel weld to safe end discontinuity.
-GroupAMaterials at550F7.34X10"-6in/in/F ModulusofElasticity
Eab ps 25.5 10+28.2.10 E ab=2.685 10 7 u a.=9.45.10 u b: 8 13.10 966.18694 R1{6/93)
-27.0X10"6 psiSafeEnd-SA-336F8-(18CR-8Ni)GroupGCoefficient ofThermalExpansion
WA5rrlrlGTON tlraLIG toWSR 4 SUPPLY SYSI'EM Praparad By/ato MANUAL CALCULATION Varifiad By/Data Pago Cont'5 On Pago~Q)C ooc CaicUIatlon No.K-oa--0'/'aviaion No.Ta I=550-70 atdis Eab'xa Ta-abTb Tb Pa 550-70+tdis 1.701.10 Safe end to inconel weld.4 Thus the maximum discontinuity stress is between the stainless steel safe end and the inconel weld metal.The original vessel stress report provided calculation of the stress.concentration factors at the locations of tapered transitions in the nozzle.There was no stress concentration listed for the joint that we are evaluating.
-Group9.45X10'-6in/in/FModulusofElasticity
Since the weld joint between the safe end and the nozzle i's a flush weld between two equivalent diameter cylinders, we can use the stress indices from a flush weld in table NB-3683.2-1.The table lists C3 as 1.0 and K3 as 1.1.Thus for determining peak stress at the material discontinuity, the C3 and K3 indices are applied.1 a d Pa 1.0'1 1'o tdis'-1000+dis 18.713 ksi Summary of Safe end to nozzle stresses: Design Pressure Stress=7.790 ksi Deadweight Bending Stress o dwt=0.286 ksi Upset Primary plus Sec.Bending Stress o obe=2.76 ksi Faulted Bending Stress, includes thermal, deadweight, obe and sse.: 0 sse=4.455 ksi 966-16694 Ai (6/93) 4 sUPPLY SYSTtM Praparad B ata MAAUAL CALCULATION Vari/iad By/Data Pago.0 0 7 Cont's On Pago 5,~~g REV.Calculation No.--0-P&o~/Ravision No..Thermal Discontinuity Stress at the Carbon.To Stainless Steel Intersection:
-25.55X106psi.InconelWeldMetal:S8-167N06690(58Ni-29Cr-9Fe)Coeffiecient ofThermalExpansion
dis 18'713 ksi Stresses classified as bending stresses above are based on the outer fiber stress to maximize the magnitude.
-8.13X10"-6in/in/F ModulusofElasticity
Bending stress on the inner wall is obtained by factoring the stress by 10.84/12.75.
-28.2X10"6psiChecknozzletoinconelthermaldiscontinuity.
Stresses though the wall thickness are linear between the minimum on the inner wall to a maximum at the outer wall.966.t6694 Rt (6/93) 43 SUPPLY SYSIXM Prepared By/Date 7.M.ENvin MANUAL CALCULATIO Verified by/Date Page.VIZ Cont'd On Page G.oa Calculation No.ME-02-98-04 Revision No.0 FATIGUE CRACK GROWTH RATE BWR ENVIRONMENT da/dn~C a E a S e (hK)',n=Material constants, C=2.0 E-19,n=3.302 S=R-ratio correction factor=(1.0-0.5 Rs)" (3)E=Environmental factor (1.0, 2.0 and 10.0 for air,PWR, and BWR environments, respectively).
Eab'=27.010+28.2.10Eab=2.76.107pslua.=73410-6ub.=8.1310Ta.=550-70~tdis'=Eab'aTaubTbTbps550-70atdis=1.047.104pslNozzletosafeendChecktheinconelweldtosafeenddiscontinuity.
hK=Kmax-Kmin, psi in Assume R-ratio=.7 , C a E*S=2,0 E-19 a 10.0 f 1.0-0.5 (.7)s]~=2.0 E-18 a[1.0-0.5(.49)]
Eabps25.510+28.2.10Eab=2.685107ua.=9.45.10ub:813.10966.18694 R1{6/93)
=2.0 E-18 a[.755]=2.0 E-18*3.07=6.155 E-18 THEREFORE da/dn=6.155 E-18 (dK)'or psi~in WA5HINGTON tlQLIC POWKR k9 SUPPLY SYSIXM Prepared By/Date T.M.Erwin MANUAL CALCULATIO VenTied by/Date Page Cont'd On Page X.oa 8 C~oe CetcUIetion No.ME-02-98-04 Revision No.0 Weld Residual Stress Calculation for through wall thickness based on NuReg 0313 Rev 2 methodology.
WA5rrlrlGTON tlraLIGtoWSR4SUPPLYSYSI'EMPraparadBy/atoMANUALCALCULATION VarifiadBy/DataPagoCont'5OnPago~Q)CoocCaicUIatlon No.K-oa--0'/'aviaion No.TaI=550-70atdisEab'xaTa-abTbTbPa550-70+tdis1.701.10Safeendtoinconelweld.4Thusthemaximumdiscontinuity stressisbetweenthestainless steelsafeendandtheinconelweldmetal.Theoriginalvesselstressreportprovidedcalculation ofthestress.concentration factorsatthelocations oftaperedtransitions inthenozzle.Therewasnostressconcentration listedforthejointthatweareevaluating.
(4)Definition of terms: S=polynomial coefficients c=percent of through wall thickness x/t R=ratio of residual stress to room temperature yield of 30 ksi for stainless steel.x=Point measured through wall from ID to OD.t=Thickness of 2.00 0,=The room temperature yield strength of stainless steel 30 ksi.cr=The calculated residual stress at location x through wall cr,+R=cr.S:=1.0-6.910 8.687-.480-2.027 i=0 4 i=0 10 G=0.0 O.l 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1.0 R,:=ps,c,.R=f at the%thickness, ref G above and err=30 ksi.y 0/1.0 0.395-0.042-0.321-0.457-0.47-0.385-0.232-0.044 0.138 027 RES:=R 30ksi RESistheweldresidualstress WA5BINGTON tUlLlc?OWSR I>sUPPLy svsrim Prepared By/Date'T.M.Eiwin MANUAL CALCULATIO Verified by/Date Page a4 Cont'd On Page 5,]o Calculation No.ME-02-98-04 Revision No.0 Using the information developed on the previous pages the following table identifies the stresses used in performing the evaluations.
Sincetheweldjointbetweenthesafeendandthenozzlei'saflushweldbetweentwoequivalent diametercylinders, wecanusethestressindicesfromaflushweldintableNB-3683.2-1.The tablelistsC3as1.0andK3as1.1.Thusfordetermining peakstressatthematerialdiscontinuity, theC3andK3indicesareapplied.1adPa1.0'11'otdis'-1000+dis18.713ksiSummaryofSafeendtonozzlestresses:
The last column in Table 1 identifies the stresses used in the IGSCC calculation.
DesignPressureStress=7.790ksiDeadweight BendingStressodwt=0.286ksiUpsetPrimaryplusSec.BendingStressoobe=2.76ksiFaultedBendingStress,includesthermal,deadweight, obeandsse.:0sse=4.455ksi966-16694 Ai(6/93) 4sUPPLYSYSTtMPraparadBataMAAUALCALCULATION Vari/iadBy/DataPago.007Cont'sOnPago5,~~gREV.Calculation No.--0-P&o~/RavisionNo..ThermalDiscontinuity StressattheCarbon.To Stainless SteelIntersection:
Table 1 x=in.30 R=ksi pres.=ksi DWT=ksi OBE=ksi SSE=ksi 30'R+pressure+DWT+OBE=ksi 0.2 0.395 0.4-0.042 0.6-0.321 0.8-0.457-0.47 1.2-0.385 1.4-0.232 1.6-0.044 1.8 0.138 2 0.27 30 11.85-1.26-9.63-13.71-14.1-11.55-6.96-1.32 4.14 8.1 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455'0.83 22.68 9.57 1.2-2.87-3.26-0.71 3.87 9.51 14.97 18.93*SSE was used as input to table 4 and is a one time event of safe shutdown earthquake.
dis18'713ksiStressesclassified asbendingstressesabovearebasedontheouterfiberstresstomaximizethemagnitude.
The computer Code rounds these numbers up to the nearest third decimal in scientific notation.Table 2 contains the stresses used in developing the fatigue cycle for the thermal discontinuity stress.This occurs one time as the RRC system heats up.The minimum stress values used are the same for the lGSCC crack growth calculation for normal operation.
Bendingstressontheinnerwallisobtainedbyfactoring thestressby10.84/12.75.
The maximum stress is developed by conservatively adding the thermal discontinuity stress equally through wall to the normal operational stresses.x=in.ID-OD Thermal Discontinuity Stress ksi Table 2 Stress Min)Thermal dis)ksi Stress(Max)
Stressesthoughthewallthickness arelinearbetweentheminimumontheinnerwalltoamaximumattheouterwall.966.t6694 Rt(6/93) 43SUPPLYSYSIXMPreparedBy/Date7.M.ENvinMANUALCALCULATIO Verifiedby/DatePage.VIZCont'dOnPageG.oaCalculation No.ME-02-98-04 RevisionNo.0FATIGUECRACKGROWTHRATEBWRENVIRONMENT da/dn~CaEaSe(hK)',n=Materialconstants, C=2.0E-19,n=3.302S=R-ratiocorrection factor=(1.0-0.5Rs)"(3)E=Environmental factor(1.0,2.0and10.0forair,PWR,andBWRenvironments, respectively).
Thermal dis)ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 59.566 41.416 28.306 19.936 15.856 15.466 18.016 22.606 28.246 33.706 37.666 The number 18.73 ksi was conservatively used instead of 18.713 ksi.  
hK=Kmax-Kmin,psiinAssumeR-ratio=.7,CaE*S=2,0E-19a10.0f1.0-0.5(.7)s]~=2.0E-18a[1.0-0.5(.49)]
=2.0E-18a[.755]=2.0E-18*3.07=6.155E-18THEREFORE da/dn=6.155E-18(dK)'orpsi~in WA5HINGTON tlQLICPOWKRk9SUPPLYSYSIXMPreparedBy/DateT.M.ErwinMANUALCALCULATIO VenTiedby/DatePageCont'dOnPageX.oa8C~oeCetcUIetion No.ME-02-98-04 RevisionNo.0WeldResidualStressCalculation forthroughwallthickness basedonNuReg0313Rev2methodology.
(4)Definition ofterms:S=polynomial coefficients c=percentofthroughwallthickness x/tR=ratioofresidualstresstoroomtemperature yieldof30ksiforstainless steel.x=PointmeasuredthroughwallfromIDtoOD.t=Thickness of2.000,=Theroomtemperature yieldstrengthofstainless steel30ksi.cr=Thecalculated residualstressatlocationxthroughwallcr,+R=cr.S:=1.0-6.9108.687-.480-2.027i=04i=010G=0.0O.l0.20.30.40.50.60.70.80.91.0R,:=ps,c,
.R=fatthe%thickness, refGaboveanderr=30ksi.y0/1.00.395-0.042-0.321-0.457-0.47-0.385-0.232-0.0440.138027RES:=R30ksiRESistheweldresidualstress WA5BINGTON tUlLlc?OWSR I>sUPPLysvsrimPreparedBy/Date'T.M.EiwinMANUALCALCULATIO Verifiedby/DatePagea4Cont'dOnPage5,]oCalculation No.ME-02-98-04 RevisionNo.0Usingtheinformation developed onthepreviouspagesthefollowing tableidentifies thestressesusedinperforming theevaluations.
ThelastcolumninTable1identifies thestressesusedintheIGSCCcalculation.
Table1x=in.30R=ksipres.=ksi DWT=ksiOBE=ksiSSE=ksi30'R+pressure+DWT+OBE=ksi 0.20.3950.4-0.0420.6-0.3210.8-0.457-0.471.2-0.3851.4-0.2321.6-0.0441.80.13820.273011.85-1.26-9.63-13.71-14.1-11.55-6.96-1.324.148.17.797.797.797.797.797.797.797.797.797.797.790.2860.2860.2860.2860.2860.2860.2860.2860.2860.2860.2862.762.762.762.762.762.762.762.762.762.762.764.4554.4554.4554.4554.4554.4554.4554.4554.4554.4554.455'0.8322.689.571.2-2.87-3.26-0.713.879.5114.9718.93*SSEwasusedasinputtotable4andisaonetimeeventofsafeshutdownearthquake.
ThecomputerCoderoundsthesenumbersuptothenearestthirddecimalinscientific notation.
Table2containsthestressesusedindeveloping thefatiguecycleforthethermaldiscontinuity stress.ThisoccursonetimeastheRRCsystemheatsup.TheminimumstressvaluesusedarethesameforthelGSCCcrackgrowthcalculation fornormaloperation.
Themaximumstressisdeveloped byconservatively addingthethermaldiscontinuity stressequallythroughwalltothenormaloperational stresses.
x=in.ID-ODThermalDiscontinuity StressksiTable2StressMin)Thermaldis)ksiStress(Max)
Thermaldis)ksi0.20.40.60.81.21.41.61.818.7318.7318.7318.7318.7318.7318.7318.7318.7318.7318.7340.83622.6869.5761.206-2.874-3.264-0.7143.8769.51614.97618.93659.56641.41628.30619.93615.85615.46618.01622.60628.24633.70637.666Thenumber18.73ksiwasconservatively usedinsteadof18.713ksi.  


k3sUpPLYsYSIXMMANUALCALCULATIO Pagec~0Cont'dOnPageZo/Calculation No.ME-02-98-04 PreparedBy/Date='.M.EtwinVerifiedby/DatezeRevisionNo.0Table3containsthestressesusedinthefatigueevaluation fortheupsetloading(OBE).ThestressesforOBEwereconservatively cycledontopofthenormaloperating stressesthatalsocontained theOBEstresses.
k3 sUpPLY sYSIXM MANUAL CALCULATIO Page c~0 Cont'd On Page Zo/Calculation No.ME-02-98-04 Prepared By/Date='.M.Etwin Verified by/Date ze Revision No.0 Table 3 contains the stresses used in the fatigue evaluation for the upset loading (OBE).The stresses for OBE were conservatively cycled on top of the normal operating stresses that also contained the OBE stresses.For full stress reversal the minimum stresses used were calculated using the normal stresses and subtracting the OBE stress (Table 1).The maximum stress was developed using the normal stresses and adding the OBE stress.The number of cycles used in the fatigue evaluation was 300/year.Table 3 x=in 30 R+ressure+DWT+OBE=ksi Stress Min Fatigue OBE=ksi Stress (Max)Fatigue OBE=ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 38.076 19.926 6.816-1.554-5.634-6.024-3.474 1.116 6.756 12.216 16.176 43.596 25.446 12.336 3.966-0.114-0.504 2.046 6.636 12.276 17.736 21.696 Table 4 contains the stresses used in the fatigue evaluation for the faulted loading (SSE).The stresses for SSE were conservatively cycled on top of the normal operating stresses that also contained the OBE stresses.For full stress reversal the minimum stresses used were calculated using the normal stresses and subtracting the SSE stress (Table 1).The maximum stress was developed using the normal stresses and adding the SSE stress.The number of cycles used in the fatigue evaluation was 10/lifetime.
Forfullstressreversaltheminimumstressesusedwerecalculated usingthenormalstressesandsubtracting theOBEstress(Table1).Themaximumstresswasdeveloped usingthenormalstressesandaddingtheOBEstress.Thenumberofcyclesusedinthefatigueevaluation was300/year.
Table 4 x from I 30'R+pressure+DWT+OBE=ksi Stress (Min)Fatigue SSE=ksi Stress (Max)Fatigue SSE=ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 36.381 18.231 5.121-3.249-7.329-7.719-5.169-0.579 5.061 10.521 14.481 45.291 27.141 14.031 5.661 1.581 1.191 3.741 8.331 13.971 19.431 23.391 I'~k L WASHINGTON at/aLlC PGWR1 49 SUPPLY SYSTEM Prepared By/Date T.M.Erwin MANUAL CALCULATIO Verified by/Dat Cont'd On Page 0/Calculation No.ME-02-98-04 Revision No.0 Table 5 contains the crack growth adjustments made to the computer calculated values as required by NUREG 0310 Rev.2.For IGSCC crack growth the NRC requires an aspect ratio (crack length to depth)to be a minimum of 20:1.To calculate this new length the initial value as found during R13 was first multiplied by 20 to obtain the new crack length.This was repeated for subsequent outages and by reviewing the output data for the IGSCC crack growth depth for estimated operational days between outages.R 16 was the last interval prior to R 17 when the flaw length to depth ratio would exceed 33%of the circumference.
Table3x=in30R+ressure+DWT+OBE=ksi StressMinFatigueOBE=ksiStress(Max)FatigueOBE=ksi0.20.40.60.81.21.41.61.840.83622.6869.5761.206-2.874-3.264-0.7143.8769.51614.97618.93638.07619.9266.816-1.554-5.634-6.024-3.4741.1166.75612.21616.17643.59625.44612.3363.966-0.114-0.5042.0466.63612.27617.73621.696Table4containsthestressesusedinthefatigueevaluation forthefaultedloading(SSE).ThestressesforSSEwereconservatively cycledontopofthenormaloperating stressesthatalsocontained theOBEstresses.
This length would require the assumption that the flaw was the entire circumference of the pipe in accordance with NUREG 0313 Rev.2.Therefore, the maximum length and depth used to complete the fatigue evaluation was the R 16 value of 0.89 deep and 17.8 in length.Outage 13 14 15 16 Days 290 580 870 Table 5 Depth=in 0.29 0.544 0.746 0.89 New Crack Length=in.
Forfullstressreversaltheminimumstressesusedwerecalculated usingthenormalstressesandsubtracting theSSEstress(Table1).Themaximumstresswasdeveloped usingthenormalstressesandaddingtheSSEstress.Thenumberofcyclesusedinthefatigueevaluation was10/lifetime.
5.8 10.88 14.92 17.8 The Input file for N1FAT1.IN contains the flaw length of 17.8" and depth of 0.89".This flaw depth and length was then ran for one year of fatigue cycles due to discontinuity, OBE and SSE in accordance with ASME Code 1989 Section XI Rules.The final length was determined to be 17.81" and 0.983" deep.These values for Section XI Table IWB-3641-5 and IWB-3641-6 are: lf=17.81" af=0.983" To determine the Code acceptability of the flaws Tables IWB-3641-5 and-6 are used to determine aand a,.These are the maximum flaw depths for normal and faulted loading conditions.
Table4xfromI30'R+pressure+DWT+OBE=ksi Stress(Min)FatigueSSE=ksiStress(Max)FatigueSSE=ksi0.20.40.60.81.21.41.61.840.83622.6869.5761.206-2.874-3.264-0.7143.8769.51614.97618.93636.38118.2315.121-3.249-7.329-7.719-5.169-0.5795.06110.52114.48145.29127.14114.0315.6611.5811.1913.7418.33113.97119.43123.391 I'~k LWASHINGTON at/aLlCPGWR149SUPPLYSYSTEMPreparedBy/DateT.M.ErwinMANUALCALCULATIO Verifiedby/DatCont'dOnPage0/Calculation No.ME-02-98-04 RevisionNo.0Table5containsthecrackgrowthadjustments madetothecomputercalculated valuesasrequiredbyNUREG0310Rev.2.ForIGSCCcrackgrowththeNRCrequiresanaspectratio(cracklengthtodepth)tobeaminimumof20:1.Tocalculate thisnewlengththeinitialvalueasfoundduringR13wasfirstmultiplied by20toobtainthenewcracklength.Thiswasrepeatedforsubsequent outagesandbyreviewing theoutputdatafortheIGSCCcrackgrowthdepthforestimated operational daysbetweenoutages.R16wasthelastintervalpriortoR17whentheflawlengthtodepthratiowouldexceed33%ofthecircumference.
Acceptability is based on a<being less than these two values.The following calculations are used in conjunction with the referenced Section XI Tables to determined aand a<.The indication falls into what is classified as weld zone per Fig.IWB-3641-1.
Thislengthwouldrequiretheassumption thattheflawwastheentirecircumference ofthepipeinaccordance withNUREG0313Rev.2.Therefore, themaximumlengthanddepthusedtocompletethefatigueevaluation wastheR16valueof0.89deepand17.8inlength.Outage13141516Days290580870Table5Depth=in0.290.5440.7460.89NewCrackLength=in.
This requires the flaw to be evaluated using Tables IWB 3641-5 and-6.The use of these Tables requires the calculation of the defined stress ratio and the flaw length to circumference ratio to determine the allowable depth to thickness ratio.This value is used to determine the maximum flaw depth.
5.810.8814.9217.8TheInputfileforN1FAT1.IN containstheflawlengthof17.8"anddepthof0.89".Thisflawdepthandlengthwasthenranforoneyearoffatiguecyclesduetodiscontinuity, OBEandSSEinaccordance withASMECode1989SectionXIRules.Thefinallengthwasdetermined tobe17.81"and0.983"deep.ThesevaluesforSectionXITableIWB-3641-5 andIWB-3641-6 are:lf=17.81"af=0.983"Todetermine theCodeacceptability oftheflawsTablesIWB-3641-5 and-6areusedtodetermine aanda,.Thesearethemaximumflawdepthsfornormalandfaultedloadingconditions.
s kJ SUPPLY SYSI'EM Prepared By/Date~T.M.Etwin MANUAL CALCVLATION Verified by/0 t Page S.'o Cont'd On Page Cetculetion No.ME-02-98-04 Revision No.0 Circumference of the nozzle is equal to 24+3.14=75.36" (based on a nominal diameter of 24)Depth/Thickness ratio=0.983"/2.0=.492 I</Circumference ratio=17.81/75.36"=.236 NORMAL OPERATING (INCLUDING UPSET AND TEST)CONDITIONS For Table IWB-3641-5 the stress ratio is determined by the following equation: Stress Ratio=M(P+P,+P)I 277 I S(From the referenced Table)Using the previous define stresses and an M value of 1.0 (for shielded metal arc welds when OD<24')the above equation for normal operating and upset conditions is equal to: DWT+OBE+Pressure
Acceptability isbasedona<beinglessthanthesetwovalues.Thefollowing calculations areusedinconjunction withthereferenced SectionXITablestodetermined aanda<.Theindication fallsintowhatisclassified asweldzoneperFig.IWB-3641-1.
Thisrequirestheflawtobeevaluated usingTablesIWB3641-5and-6.TheuseoftheseTablesrequiresthecalculation ofthedefinedstressratioandtheflawlengthtocircumference ratiotodetermine theallowable depthtothickness ratio.Thisvalueisusedtodetermine themaximumflawdepth.
skJSUPPLYSYSI'EMPreparedBy/Date~T.M.EtwinMANUALCALCVLATION Verifiedby/0tPageS.'oCont'dOnPageCetculetion No.ME-02-98-04 RevisionNo.0Circumference ofthenozzleisequalto24+3.14=75.36"(basedonanominaldiameterof24)Depth/Thickness ratio=0.983"/2.0=.492I</Circumference ratio=17.81/75.36"=.236NORMALOPERATING (INCLUDING UPSETANDTEST)CONDITIONS ForTableIWB-3641-5 thestressratioisdetermined bythefollowing equation:
StressRatio=M(P+P,+P)I277IS(Fromthereferenced Table)UsingthepreviousdefinestressesandanMvalueof1.0(forshieldedmetalarcweldswhenOD<24')the aboveequationfornormaloperating andupsetconditions isequalto:DWT+OBE+Pressure
+OBE+Thermal Discontinuity 0.286+2.76+7.79+2.76+18.73
+OBE+Thermal Discontinuity 0.286+2.76+7.79+2.76+18.73
=32.326ksiNOTE:OBEisaddedtwiceconservatively toboundthenormaloperating andthermalstresses.
=32.326 ksi NOTE: OBE is added twice conservatively to bound the normal operating and thermal stresses.Stress Ratio=32.326/2.77/16.65
StressRatio=32.326/2.77/16.65
=.701 Using the Stress Ratio and the Circumferential Ratio the allowable Depth to thickness ratio from Table IWB-3641-5 is 0.6.Therefore the maximum flaw=2.0.6=1.2" deep since 0.983"<1.2 The flaw is acceptable per Table IWB-3641-5 EMERGENCY AND FAULTED CONDITIONS For Table IWB-3641-6 the stress ratio is determined using a similar equation as above with the exception of the SSE stress being substituted for one of the OBE and 2.77 being replace with 1.39.P)Stress Ratio=M(P+Ps+P)I 139 I S(From the referenced Table)Therefore:
=.701UsingtheStressRatioandtheCircumferential Ratiotheallowable Depthtothickness ratiofromTableIWB-3641-5is0.6.Therefore themaximumflaw=2.0.6=1.2"deepsince0.983"<1.2Theflawisacceptable perTableIWB-3641-5 EMERGENCY ANDFAULTEDCONDITIONS ForTableIWB-3641-6 thestressratioisdetermined usingasimilarequationasabovewiththeexception oftheSSEstressbeingsubstituted foroneoftheOBEand2.77beingreplacewith1.39.P)StressRatio=M(P+Ps+P)I139IS(Fromthereferenced Table)Therefore:
34.021/1.39/16.65
34.021/1.39/16.65
=1.47UsingtheStressRatioandtheCircumferential Ratiotheallowable Depthtothickness ratiofromTableIWB-3641-5is0.538Therefore thamaximumflaw=2.0*0.538=1.076"since0.983"<1.076'heflawisacceptable perTableIWB-3641-6 Conclusion TheflawmeetsalltheCodeSectionXIrequirements andtheN1nozzlesafe-endisacceptable forusewithoutexamination untilR16.}}
=1.47 Using the Stress Ratio and the Circumferential Ratio the allowable Depth to thickness ratio from Table IWB-3641-5 is 0.538 Therefore tha maximum flaw=2.0*0.538=1.076" since 0.983"<1.076'he flaw is acceptable per Table IWB-3641-6 Conclusion The flaw meets all the Code Section XI requirements and the N1 nozzle safe-end is acceptable for use without examination until R 16.}}

Revision as of 11:52, 6 July 2018

Rev 0 to ME-02-98-04, Fracture Mechanics Evaluation of N1 Safe End.
ML17292B658
Person / Time
Site: Columbia Energy Northwest icon.png
Issue date: 05/29/1998
From:
WASHINGTON PUBLIC POWER SUPPLY SYSTEM
To:
Shared Package
ML17292B657 List:
References
ME-02-98-04-01, ME-02-98-04-R00, ME-2-98-4-1, ME-2-98-4-R, NUDOCS 9905130171
Download: ML17292B658 (30)


Text

{{#Wiki_filter:SUPPLEMENTAL INFORMATION ANALYTICAL EVALUATION OF INSERVICE INSPECTION EXAMINATION RESULTS Attachment A Calculation ME-02-98-04,"Fracture Mechanics Evaluation of Nl Safe End," Revision 0 9905i30i7i '990429 PDR ADOCK 05000397 8 PDR WA5HINGTON PtMIC FOWRR k9 SUPPLY SYSTEM CALCULATION COVER SHEET BDC Page Equipment Piece No.MS-RPV-3 Project Discipline WNP-2 Page Qoo Calculation No.ME-02-98-04 Cont'd on Page 0 CI MATERIAL AND WELDING Remarks Quality Class 1 i"k": TiUe/Subject FRACTURE MECHANICS EVALUATION OF N1 SAFE END Purpose A fracture mechanics evaluation was performed to evaluate a planar indication found during in-service inspection of ISI weld number 24RRC(2)A-1. The indication is on the inside surface of the safe-end and Is located at 5:00 o'lock when looking downstream. The indication measures 3.52 inches in length and 0.29 inches deep in a pipe wall that is 2.0 inches thick.The indication exists in SA 336 Class F8 forged type 304 stainless steel safe-end.The size of the defect exceeds the ASME Code Section XI Table IWB 3514-2 allowable and thus requires an evaluation per paragraph IWB 3640 of the Code.The following calculation provides a comprehensive presentation of the fracture mechanics model, applied loads (stresses), and Code evaluations /Wwc-opc-<0 C IN//r a,a5 0 I Q.lcd&~o~REV NO.0 STATUS/F,P,ORS F Initial Issue REVISION DESCRIPTION INITIATING DOCUMENTS PER 298-0600 TRANSMITTAL NO./7ws";;~X@5$~~~~N~PRVNN!'%'%Ã4o-".NN%-:K%%8PERFOR MAMCENERIFICATIOM!RECORD."'~%5~.';.ANNPAN%%%""':R~%%FN."N&%@5%% REV NO.0 PERFORMED BY/DATE Tom Erwin VERIFIED BY/DATE 5 gv APPROVED BY/DATE 6-'3>-g Study Calculations shall be used only for the purpose of evaluating alternate design options or assisting the engineer in performing assessments. 968-1 8645 R4 (6/98)

WA58lNGTON tURLlC tOWER:43 SUPPLY SYSTEM CALCULATION INDEX Page Calculation No.ME-02-98-04 Revision No.0 Cont'd on Page ITEM PAGE NO.SEQUENCE Calculation Cover Sheet Calculation Index Verification Checklist for Calculation and CMR's Calculation Reference List Calculation Output Interface Document Revision Index Calculation. Output Summary Calculation Method Sketches Manual Calculation 1.000-1.100-1.200-1.300-1.400-2.000-3.000-4.000-Q,~0 9 5000-g 0 i~APPENDICES: Appendix A Pages Appendix B Pages Appendix C Pages Appendix D Pages Appendix Appendix Appendix Appendix Pages Pages Pages Pages 96S.25278 R2 (3/SS) WA5HINGTON PlSLIC l'OWaa..~3 SUPPLY SYSTEM VERIFICATION CHECKLIST FOR CALCULATIONS AND CMRs Page Cont'd On Page/,3QQ Calculation/CMR ME-02-98-04 verified using the following methods: Checklist Below Revision 0 was Q Alternate Calculations Checklist Item Clear Statement of purpose of analysis Methodology clearly stated and sufficiently detailed and appropriate to proposed application Logical consistency of analysis~Completeness of documenting references ~Completeness of documenting and updating output interface documents Completeness of input Accuracy of input data Consistency of input data with approved criteria Completeness in stating assumptions Validity of assumptions Calculation sufficiently detailed~Arithmetical accuracy~Physical units specified and correctly used Reasonableness of output conclusion Supervisor independency check (If acting as Verifier)-Did not specify analysis approach-Did not rule out specific analysis options-Did not establish analysis inputs Initial~If a computer program was used:-Is the program appropriate for the proposed application? -Have the program error notices been reviewed to determine If they pose any limitations for this application? -Is the program name, revision number and date of run inscribed on the output?-Is the program identified on the Calculation Method form?If so, is it listed in chapter 10 of the Engineering Standards Manual?Other Elements Considered ~If a separate verifier was used for validating these functions or a portion of these functions, sign and'initial below.Based on the foregoing, the calculation is adequate for the purpose intended.Verifier Signature s)/Date Verifier Initials 968-2528O R1 (3I98) Qg SUPFL~SYSTEM CALCULATION REFERENCE LIST PAGE 00 CONT'D ON PAGE CALCULATION NO o ME-02-98-04 REVISION NO.0 SEQUENCE NO.AUTHOR Failure Analysis Associates Supply System EPRI NRC ASME Burns 6 Roe ASME ISSUE DATEg EDZTIONi OR REVZSZO 2.23 5-14-98 1986 1988 1990 5/7/76 1989 TITLE NASCRAC Manual Ultrasonic Examination Data Sheet Evaluation of Flaws in Austenitic Steel Piping Technical Report on Material Selection and Processing Guidelines for BWR Coolant Pressure Boundary Piping ASME Section XZ, Nonmandatory Appendix C Hanford ZZ 251" BWR Vessel Stress Report T9,S9,F9 Recirculation Outlet Nozzle ASME Section XI DOCUMENT NO~R-R13-031 NP-4690-SR NUREG-0313,Rev.2 Fig C-3210-1 T9,S9,F9 IWB-3640 10 S.T.Rolfe J.M.Barsom ASME Structural Integrity J.F.Harvey 1977 1986 March 1998 1985 Fracture and Fatigue Control in Structures ASME Section III, Appendices The Effect of Radiation on the Fracture Toughness of Austenitic Stainless Steel Base and Weld Material Theory and Design of Pressure Vessels Appendix I Table Z-2.2 SZR-97 095 pg 61 44458 t I 0/89)' WA5BINGTON ttiaLIC?OW81 k9 SUPPLY SYSTEM Prepared By/Date Tom Etwin CALCULATION OUTPUT IN'IXRFACE DOCUMENT REVISION INDEX Verified by/0 te R Page 00c)Cont'd On Page Q,4 oo Cslculstion No.ME-02098-04 Revision No.0 The below listed output interface calculations and/or documents are impacted by the current revision of the subject calculation. The listed output interfaces require revision as a result of this calculation. The documents have been revised, or the revision deferred with Manager approval, as indicated below.AFFECTED DOCUMENT NO.None CHANGED BY (e.g., BDC, SCN, CMR, Rev.)CHANGED DEFERRED (e.g., RFTS, LETTER NO.)DEPT.MANAGER'equired for deferred changes only.968-25285 R1 (3ISS) WA58INGTON tulLlC tOWRR I>SUPPLY SYSPIM CALCULATION OUTPUT

SUMMARY

Page ,OOV Calculation No.ME-02-98-04 Cont'd On Page Q OQ Revision No.0 N1 nozzle safe-end.The first modeled th Discussion of Results Three computer runs were used to evaluate the indication in the e indication using the normal operational loads of the system.The second model used three transients that could possibly occur in one year interval.These transients were the thermal discontinuity stress, OBE and SSE.This model was used to determine the crack growth expected from the fatigue loading at different crack depths allowing determination of when the cracking would become a significant contributor to crack growth.This allowed the determination that the crack growth would only become significant at the end of the interval selected for the next inspection. The third model used the adjusted crack length (20:1 ratio)as required by NUREG 0313 Rev.2 for the end of the IGSCC crack growth at R 16 as input.The required fatigue cycles for OBE and SSE were than applied to this crack dimension to determine acceptability for the interval.REV.BAR The results of the computer runs are as follows: The indication will grow to a depth of 0.983" by R 16 if IGSCC is active and the fatigue cycles are experienced In comparing the results to the 1989 ASME Section XI Code Tables IWB-3641-5 and-.6.Indication is acceptable for continued operation until R 16.The weld will be reinspected prior to R16, see PERA 298-0600 CAP 1 PTL A149503.Conclusions Taking into account the following conservatism's: 1.The weld residual stress distribution used is for an as welded component. The stainless steel safe-end to nozzle weld had MSIP performed on it during R 9.The distribution should be compressive at the ID.2.The stresses are conservatively high due to the use of OBE stresses for steady state thermal.Also the pressure stress used is the hoop stress not the axial pressure stress.3.No faucet are evident during the weld examination that would indicate IGSCC is active.It has been determined that WNP-2 may operate until R16 before reexamination of the nozzle to safe-end weld has to occur.The evaluation demonstrates under the worst imposed loading conditions the flaw meets the acceptance criteria of the ASME Section XI IWB-'3641-5 and 3641-6.The main fracture mechanism that will propagate the flaw is intergranular stress corrosion cracking.If the IGSCC phenomena. is active the indication will increase in depth to 0.983 by R16.which is less than the ASME Code allowable. 968-1 8652 R2 (3/98) WA5HINGTON tUSL1C toWaa 4J SUPPLY SYSTEM Prepared By/Date T.M.Erwin Analysis Method (Check appropriate boxes)O'.AT,C".T JT,ATTON MFTROD Verified by/D e Page oO Calculation No.ME-02-98-04 Revision No.0 Cont'd Qn Page 7.oo I H Manual (As required, document source of equations in Reference List)H Computer H In-House Program Main Frame H Personal Q Computer Service Bureau Program Q BCS Q CDC Q PCC Q OTHER H Verified Program: Code name/Revision NASCRAC 2.23 Q Unverified Program: Document in Appendix B Approach/Methodology Flaw Evaluation Problem During the performance of Inservice Inspection of the reactor vessel RRC A loop an indication was.discovered in the heat affected zone of the 24 inch RRC suction nozzle (N1A)to safe-end weld 24RRC(2)A-1.The indication is on the inside surface of the safe-end and is located at 5:00 o'lock when looking downstream. The indication measures 3.52 inches in length and 0.29 inches deep in a pipe wall that is 2.0 inches thick.The indication exists in ductile SA 336 Class FB forged type 304 stainless steel.The design minimum wall based on faulted pressure is 1.01 inches.The remaining ligament in the safe-end is 1.71 inches.The indication has existed for some time.Due to changes in the ultrasonic techniques and technology the ability to detect material variations and conditions has increased. An example of this increase in sensitivity. is demonstrated in this examination. The same weld was examined during the R9 outage and no indication was detected at that time.However, using the new GE ultrasonic data system the same data tape was reviewed from the R9 outage and it was determined that the same indication existed at that time.The new R13 data output and the R9 data output were compared and the indication shows no change in depth or length that is not within the inaccuracies of the equipment. The indication has been in the system since at least R9 with no change in depth or length.The indication is required to be evaluated as an IGSCC indication even though it shows no IGSCC charactreistics. Flaw Evaluation The linear indication was evaluated using the NASCRAC computer code developed by Failure Analysis Associates. This code uses stress field influence functions as the basis for flaw propagation. The NASCRAC model selected is a shell element containing an elliptically shaped circumferential flaw.The model is identified as 703 in the NASCRAC manual.This particular model includes three crack growth degrees of freedom encompassing the respective circumferential and crack depth coordinates. The evaluation was performed using conservative linear elastic fracture mechanics principles. WA58INGTON Pl/5LIC POW51'lY9 SUPPLY SYSHM CALCULATION METHO CONTINVATION PAGE Cont'd On Page Revision No.Page 7~~l g.80&Calculation No.f='-OP?P-o Y All Models The maximum fracture toughness used for the stainless steel material was 150ksi~in.The value is conservative and is approximately one half of the fracture toughness value that is achievable for this type of stainless steel product form.(BWRVIP Report SIR-97-095) (10)Load Combinations The load combinations used in this evaluation are provided in section 5.0 of this calculation. The following provides the combinations used by each of the models.N1IGSCC.IN The IGSCC calculation for normal operation was performed using 11 node points from the I.D.to O.D.For each point Kmin was calculated by setting the stress value equal to zero.Kmax was determined by conservatively combining the weld residual stresses, circumferential pressure stress, deadweight and the OBE stress that includes thermal (see section 5.0).The number of cycles used is 24 since the Paris equation crack growth law is in in/hour.One load block represents 24 hours or one day.N1 FAT.IN N1FAT1.IN The fatigue models also used 11 nodes from I.D.to O.D.The models were set up using stresses in psi instead of ksi.The Paris equation (fatigue)was established using psi instead of ksi.The Kmin for the fatigue models was calculated using the normal operational stresses used in the IGSCC model.The cyclic stresses were made up of cycles from three transients that re-present the potential cyclic loading the nozzle could experience in one year.These transients were: One cycle of thermal discontinuity, 300 cycles OBE (contains SRV)and ten cycles SSE.968-25291 R1 (3/98) WA5HIHGIN kUaLlc FOWSR I>svppav svsnm CALCULATION METHOD CONTINUATION PAGE Page conrd on page'3, UspW Calculation No.ME-02-98-04 Revision No.0 Iuated The modeling applies the requirements identified in NRC Generic Letter 88-01.The flaw was eva as an intergranular stress corrosion crack using the crack growth rate equation provided in the generic letter.The weld residual stress distribution provided in the letter was also used even though the weld in question had Mechanical Stress Improvement (MSIP)performed on it in 1994.The weld residual stresses are developed from room temperature yield for 304 material (30 ksi)as the normalization stress outlined in the generic letter.The flaw aspect ratio was reviewed and compared to the requirements. of NUREG-0313, Rev.2.The aspect ratio was determined to be 12:1 which requires correction in length as the crack grows until an aspect ratio of 20:1 is exceeded.Therefore, the final crack growth aspect ratio was corrected manually to comply with the requirements of NUREG-0313, Rev.2.The correction for aspect ratio was performed at each Refueling outage time period based upon the computer output for the IGSCC model.These intervals were determined as follows: R 14 will occur in approximately 290 days, with two subsequent 290 day intervals until R 16.The fiaw length and depth from the R16 corrected value was then used as input into the fatigue model, The fatigue model used one year of expected upset and faulted conditions as required by the Code to assure that the crack will remain within the Code allowable limits and NRC requirements. Three input files were used to perform the IGSCC and fatigue evaluations. These files were: N1IGSCC.IN IGSCC for normal operations N1FAT.IN Fatigue including one year of thermal discontinuity (1cycle), OBE (300 cycles), SSE (10 cycles)Nl FAT1.IN Fatigue incorporating R16 corrected crack length for NRC 20:1 ratio and the same fatigue cycles for N1FAT.IN The following assumptions and inputs were used in developing each of the models.All Models: The flaw model used was 703 for a semi-elliptical (circumferential) surface crack in a cylinder.(1)Flaw Dimensions N1IGSCC.IN The crack used was 3.52" long and 0.29" deep.The half crack was calculated taking 3.52" and N1FAT.IN dividing it by 2 to yield 1.76".(2)N1FAT1.IN The crack length for this model was the results of the 20:1 aspect ratio required by the NRC for IGSCC cracks.The value used is&om the crack depth for 870 days of IGSCC growth that would occur by R16.The values used in the model were a length of 17.8ss and a depth of.0.89".The half crack was determined by dividing the length by 2 that results in a value of 8.9".Crack Growth Laws N1IGSCC.IN The Paris equation used for IGSCC growth was that provided in NUREG-0313 Rev.2.The (4)equation used: 359E 8(hK)'n ksiWin-N1FAT.IN'he crack growth rate for fatigue in BWR water environment was determined using the following N1FAT1.IN Paris equation: (3)6.155E-18(tK) 'n psiWin N1IGSCC.IN The lK~value used was 10.0 or 10000 for the fatigue N1FAT.IN N1FAT1.IN+ 5 IO INCONEI.182 BUrrER INC'7/16 37~21/32 ,./I/e Ix I 31/32'NCONEL 182 OVERLAY 3/1 O.06 CrrP)10'SAFE-NO~IIE 0 OEIA L IS'e30 ltKL OS 0 Nli 180'00P l H)8 0 Lm 8 0 2 2UIRC12)A-I 180'OOP l 2USC12)8-I O'DOP 8 0 MlCIZ)i-2 180'CCP l 2UIRC12)8-2 O'CCP 8 l.180 NOZZI.E~IIELO OED L SAFE-ENO (0.020'CrUAL CARBON CONIENr)I.383~~r t 5/8 0 3/0 R 0 19/32 R l/IS~RPV IS'55 CLAOOINC NOIE5 Cll B.OC>>ELHI)tll ION G UI-I)9 NOZZLE'10 S)ELL HELD G 2 Ul-101 HOZZLE 10 SlFE EHO IEELD 0 3 Ul 7 SSFE-EHO 10 PIPE)EKLD 0 Ul-101 SllE ftO FORCI IX IIF EX)HIHEO)0 5 Ul-119 HOZhE INHKR RlDIUS g)~~0 t"<<It)0 I/s~aI I O O,t PIPE 2 I/O 9 11/16 OZZLE/w eeeeleo lo oeseeeee ees I/el EIAI eeo oeseees E4loeoltoo fl gpss loo~'l ESDlltlw, eeftitlto Soles FEEoeeo.EA.1 29/32 PIPIHC 5 fS'iftt tl'tfC fit 4$Slff IOO tlt tftthf~a Nl NOZZLE INCONEL 82 Roor/NOr INCONEL 182 BALA)ICE'17$~Sl f os)Et SEOEC E/S~1)HIS Cftlt)IN)IS IH)ftf%0 fOR USK IN FFKSKRTICE ftf)INSERT)LE IHSPf C II CESS PRt)CR>ttS OtLT, C)L OLOC>>)CORER)If tdM5 llf OE)tf)If tE)tf tctt ItkL it)l C>>K SS tll I L 1fff tt)EE Oll It>>tt ZS t4tfRIOL SPEC SS)5$CR)E)E CL I SO))tt CL IR SO SCe CL 7 SO SX)M~CL 1 CS CS REFERENCESE CSI IR)CLElR CO.SNI<6 RET i SHf 47 RET 3 SHI 48 RET 4 151 ISOMEIAICS RRC 101-1 RET RRC 102-)Rf T 205 AE 023 NI NOZZLE FORGIHC Itl Slff-fHD FORCIIX'l NOZZLE XSSEIKILT PCCIRC SEC))tft ti1 MQhf ll O'180')OLIlf CllSSA I JSFC Ct)OK CLSSS~I ft>>RA I tf)ELE IXEOWA>>ttcl OSIEA S 10 79 VSDIIHCIEOE fValC POKR SN'PLY SYSIEN Otte\Ieft. SA)stol ttot tet)t EFEP-2 KLD C COEPOKHI ICKHIIFIClllttt DI)CRltt Et 7)I)R IMEACO fOR It)C~Et EASE C)CO t))LSE r~f Iff~f COSO OOOO DEER HO RPV-105 HKT I 5-54 5 Crack Geomet Modei Library in NASCRAC Software 5.1.26 Semi-Elliptical (Circumferential) Surface Crack in a Cylinder Model Feature FORTRAN Variable Option Featured Model Index Number KRKTYP Number of Degrees of Freedom KRKDOF Crack Front Shape Finite Width Effects InQuence Function Variable Thickness Effects IVTHIC J-Integral Solutions 703 3 Semi-Elliptical Yes Yes No No Data Input Description Input Description FORTRAN Input Variable Format Remarks Variable Thickness Initial Crack Size Body Widths Crack Position Crack Orientation Stress Input a1 a2 a3 t W'g W3 Xc Yc 4~-(~)<-(~v)IVTHIC AINITL(l)AINITL(2)AINITL(3)WIDTHS(1)WIDTHS(2)WIDTHS(3)WIDTHS(4)CENTER(1)CENTER(2)CRKANG Constant-Constant Constant Constant Constant Constant Constant Constant Constant Equational Tabular Equational Tabular)Terminate)Analysis Only Tabular Not Applicable Constant~H Limits: 1<aq+as/aq<20;0.0<aq/t<1.0 Accuracy: approximately 10'or 0.0<a,/t<0.8 and 1<a2+as/a><12 HANItNOTOR fl&lIC PO'N40 6$5UBKY SYFHM CALC:-Ov 8 Version 2.2 PAGE:.CSPl'sou BY: DATE: S VERIFIED.DATE

5.1 Libr of K-and J-Solutions -Model Descri tions 5-55 703 Z cr (x,y)I I I I I I I X a2~/t r a a)X NASCRAC User's Manual Version 2:2 wA$HINGToN tuaLIG towaa 4$SUPPLY SYSTIM Ptap d 8/Oat MkbtUAL CALCULATION Vetlliad By/Data Pago.00 Cont'a On Pago 5.CI g~Calculation No.-e-o/Revision No The purpose of the calculation is to determine the bounding stress in the Recirculation outlet nozzle N1 at safe end to nozzle weld.Actual loads at the nozzle due to the pipe are lower than the allowable loads provided in the reference documents listed below.Actual pipe loads are available in calculation 8.14.107.

References:

1.Hanford II-251 n BWR Vessel Stress Report Sections T9,S9,F9 Recirculation Outlet Nozzle.2.Drawing 732E143, Purchase part Reactor VesselMPL item No.B13-D003 3.Drawing 761E716, Reactor Vessel Loadings Recirculation Outlet: Maximum Allowable Nozzle Loads for Evaluation: Design Mech.Load Dead Wt.Seismic Pri Seismic RFE Thermal RFE H (kips)0.0 58.50 164 164 292 M (inch kips)5850 1580 2950 2950 7020 The above moments are.applied at the end of the safe end.The weld of concern is the safe end to nozzle weld which is 9.75 inches+/-1/16 inch from the load application point.Nozzle Design Pressure: 1250 psi, Nozzle Faulted Pressure: 1375 psi Nozzle Loads for Recirculation Outlet Nozzle from Calculation 8.14.107 which includes power uprate and snubber optimization of the recirculation piping.Condition Primary Secondary Primary (Faulted)Force-Ibs 5552 34431 25481.Moment-inch kips 167.408 1805.391 1066.453 966.16694 Rl (6/93) waarrlrrGTorr ttraLIc towaa 4$suptLv sysrmr MAMJAL CALCULATION Pago.ao Calculation No Cont'a On Pago g 5 D Q Praparad 8/Dat Varifiod By/Data-eh'-ov Aevi~ion No.0 Safe end material is SA-336 F8 Sm pa 16.65 ksi O575 F Z:=9.75 inch Z is the offset distance from the application point of the loads.Pd:=1250 psi OD:=25.5 inch Pf pa 1375 psi ID:=21.6876 inch I mom.=9896 in" A no~:=141.292 In Calculate tangential Pressure Stresses using the thickwall formula from Theory'nd Design of Pressure Vessels, J.F.Harvey, 1985 pg 61 ID b OD r pa 10.84, 11.2..12.75 inch a Pd Op(r)pa b-a b2 1+-r2 psl Pressure Stress Variation with radius from ID to OD is shown below.a p(r)10.84 11.2 11.56 11.92 12.28 12.64 7.79 10 7.504 10 7.244 10 7.007.10 6.791~10 6.594 10 Since the range variable for r did not exactly match the outside diameter the following equation adjusts to the exact outside radius.r pa 12.75 968-'l 8694 Al i6/93) IS sUPPLY sys'BM MAI'AJAL CALCULATION Pd go 0 Cont's On Paga g Praparad By ata y2C Vari/lad By/Data~/~/f~Calculation No.I=-0-Rh'-o"/Aavision No.a p(r)ps a Pd b2 2 b2 1+-r2 G p (I)6.536 1 0 3 PSI.Thus the tangential pressure stress varies from 7800 psi to 6530 psi.This stress is tensile around the circumference of the shell.Based on the orientation of the flaw the tangential stress would not be a tensile stress for a flaw in the tangential direction. Reset the radius to vary from lD to OD and recalculate the radial pressure stress.r ps 10.84, 11.2..12.75 inch a Pd<pr(r)ps b2 2 b2 1--r2 a=10.844 b=12.75 a pr(r)-1.253 10-967.181-707.494-470.979'254.958-57.13 PSI 10.84 11.2 11.56 11.92 12.28 12.64 inches Calculate nozzle bending stresses at the safe end to nozzle weld by applying the moment plus the force times the offset to give a maximum bending moment Deadweight Loads: Mdwt pa 167.5+5.552 Z in-kips c ps 12.75 Mdwt=221.632 968.18694 Rl I6/93) wASNINOTON tlraLtc tow!a 4 SUPPLY SYSHM Prepared 8y/D a zs/~8 MAAUAL CALCULATION Verified 8y/Data S~/yg Page 0 Cont'a On Page g pa+Calculation No.--oQ-Y-o i-.Aewaron No Mdwt c c dWt'=l mom P'wt=0.286'si Upset Loads including Thermal The GE load combination for RPV nozzles takes the maximum of eight different combinations which include thermal, obe, obe displacements, turbine stop valve closure, srv, and srv inertia.M pbe:=1806+34.5'Z M pbe=2.142'10 3 in-kips Mpbe c~abc'=l mom<pbe=2.76 ksi Faulted Loads: The GE faulted loads combination does not include thermal bending on the nozzle.Since the upset load combination includes thermal, it is conservatively added to the faulted loading without removal of the dynamic upset loads.M sse.=1067+25.5 Z+M pbe sse-3.458 10 in-kip 3 M sse'~sse'=l mom cz=4.455 ksi 968.18694 Al{6/93) @SUPPLY SYSIZM Prepared By/D a Y+8 MAMJAL CALCULATION Verified By/Date Page Or, Cont's On P9 S'-OOC REV.B/IR CelcUI ation No.--0)-tY-0 Revision No.Determine the discontinuity stresses due to the attachment of the stainless steel safe end to the carbon steel vessel nozzle.The vessel nozzle has a 3/8 in inconel butter on the surface and then is jointed to the safe end with an inconel weld.Thus there are three different materials to be evaluated for thermal growth.Nozzle Forging-SA-508 CL 2 (3/4NI-1/2Mo-CR-V) Coeffiecient of Thermal Expansion-Group A Materials at 550 F 7.34X1 0"-6in/in/F Modulus of Elasticity -27.0X10"6 psi Safe End-SA-336 F8-(18CR-8Ni)Group G Coefficient of Thermal Expansion-Group 9.45X1 0'-6 in/in/F Modulus of Elasticity -25.55X1 06 psi.Inconel Weld Metal: S8-167 N06690 (58 Ni-29Cr-9Fe)Coeffiecient of Thermal Expansion-8.13X1 0"-6in/in/F Modulus of Elasticity -28.2X1 0"6psi Check nozzle to inconel thermal discontinuity. Eab'=27.0 10+28.2.10 E ab=2.76.10 7 psl ua.=734 10-6 u b.=8.13 10 T a.=550-70~tdis'=Eab'a Ta ub Tb Tb ps 550-70 a tdis=1.047.10 4 psl Nozzle to safe end Check the inconel weld to safe end discontinuity. Eab ps 25.5 10+28.2.10 E ab=2.685 10 7 u a.=9.45.10 u b: 8 13.10 966.18694 R1{6/93) WA5rrlrlGTON tlraLIG toWSR 4 SUPPLY SYSI'EM Praparad By/ato MANUAL CALCULATION Varifiad By/Data Pago Cont'5 On Pago~Q)C ooc CaicUIatlon No.K-oa--0'/'aviaion No.Ta I=550-70 atdis Eab'xa Ta-abTb Tb Pa 550-70+tdis 1.701.10 Safe end to inconel weld.4 Thus the maximum discontinuity stress is between the stainless steel safe end and the inconel weld metal.The original vessel stress report provided calculation of the stress.concentration factors at the locations of tapered transitions in the nozzle.There was no stress concentration listed for the joint that we are evaluating. Since the weld joint between the safe end and the nozzle i's a flush weld between two equivalent diameter cylinders, we can use the stress indices from a flush weld in table NB-3683.2-1.The table lists C3 as 1.0 and K3 as 1.1.Thus for determining peak stress at the material discontinuity, the C3 and K3 indices are applied.1 a d Pa 1.0'1 1'o tdis'-1000+dis 18.713 ksi Summary of Safe end to nozzle stresses: Design Pressure Stress=7.790 ksi Deadweight Bending Stress o dwt=0.286 ksi Upset Primary plus Sec.Bending Stress o obe=2.76 ksi Faulted Bending Stress, includes thermal, deadweight, obe and sse.: 0 sse=4.455 ksi 966-16694 Ai (6/93) 4 sUPPLY SYSTtM Praparad B ata MAAUAL CALCULATION Vari/iad By/Data Pago.0 0 7 Cont's On Pago 5,~~g REV.Calculation No.--0-P&o~/Ravision No..Thermal Discontinuity Stress at the Carbon.To Stainless Steel Intersection: dis 18'713 ksi Stresses classified as bending stresses above are based on the outer fiber stress to maximize the magnitude. Bending stress on the inner wall is obtained by factoring the stress by 10.84/12.75. Stresses though the wall thickness are linear between the minimum on the inner wall to a maximum at the outer wall.966.t6694 Rt (6/93) 43 SUPPLY SYSIXM Prepared By/Date 7.M.ENvin MANUAL CALCULATIO Verified by/Date Page.VIZ Cont'd On Page G.oa Calculation No.ME-02-98-04 Revision No.0 FATIGUE CRACK GROWTH RATE BWR ENVIRONMENT da/dn~C a E a S e (hK)',n=Material constants, C=2.0 E-19,n=3.302 S=R-ratio correction factor=(1.0-0.5 Rs)" (3)E=Environmental factor (1.0, 2.0 and 10.0 for air,PWR, and BWR environments, respectively). hK=Kmax-Kmin, psi in Assume R-ratio=.7 , C a E*S=2,0 E-19 a 10.0 f 1.0-0.5 (.7)s]~=2.0 E-18 a[1.0-0.5(.49)] =2.0 E-18 a[.755]=2.0 E-18*3.07=6.155 E-18 THEREFORE da/dn=6.155 E-18 (dK)'or psi~in WA5HINGTON tlQLIC POWKR k9 SUPPLY SYSIXM Prepared By/Date T.M.Erwin MANUAL CALCULATIO VenTied by/Date Page Cont'd On Page X.oa 8 C~oe CetcUIetion No.ME-02-98-04 Revision No.0 Weld Residual Stress Calculation for through wall thickness based on NuReg 0313 Rev 2 methodology. (4)Definition of terms: S=polynomial coefficients c=percent of through wall thickness x/t R=ratio of residual stress to room temperature yield of 30 ksi for stainless steel.x=Point measured through wall from ID to OD.t=Thickness of 2.00 0,=The room temperature yield strength of stainless steel 30 ksi.cr=The calculated residual stress at location x through wall cr,+R=cr.S:=1.0-6.910 8.687-.480-2.027 i=0 4 i=0 10 G=0.0 O.l 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1.0 R,:=ps,c,.R=f at the%thickness, ref G above and err=30 ksi.y 0/1.0 0.395-0.042-0.321-0.457-0.47-0.385-0.232-0.044 0.138 027 RES:=R 30ksi RESistheweldresidualstress WA5BINGTON tUlLlc?OWSR I>sUPPLy svsrim Prepared By/Date'T.M.Eiwin MANUAL CALCULATIO Verified by/Date Page a4 Cont'd On Page 5,]o Calculation No.ME-02-98-04 Revision No.0 Using the information developed on the previous pages the following table identifies the stresses used in performing the evaluations. The last column in Table 1 identifies the stresses used in the IGSCC calculation. Table 1 x=in.30 R=ksi pres.=ksi DWT=ksi OBE=ksi SSE=ksi 30'R+pressure+DWT+OBE=ksi 0.2 0.395 0.4-0.042 0.6-0.321 0.8-0.457-0.47 1.2-0.385 1.4-0.232 1.6-0.044 1.8 0.138 2 0.27 30 11.85-1.26-9.63-13.71-14.1-11.55-6.96-1.32 4.14 8.1 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 7.79 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 2.76 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455 4.455'0.83 22.68 9.57 1.2-2.87-3.26-0.71 3.87 9.51 14.97 18.93*SSE was used as input to table 4 and is a one time event of safe shutdown earthquake. The computer Code rounds these numbers up to the nearest third decimal in scientific notation.Table 2 contains the stresses used in developing the fatigue cycle for the thermal discontinuity stress.This occurs one time as the RRC system heats up.The minimum stress values used are the same for the lGSCC crack growth calculation for normal operation. The maximum stress is developed by conservatively adding the thermal discontinuity stress equally through wall to the normal operational stresses.x=in.ID-OD Thermal Discontinuity Stress ksi Table 2 Stress Min)Thermal dis)ksi Stress(Max) Thermal dis)ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 18.73 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 59.566 41.416 28.306 19.936 15.856 15.466 18.016 22.606 28.246 33.706 37.666 The number 18.73 ksi was conservatively used instead of 18.713 ksi.

k3 sUpPLY sYSIXM MANUAL CALCULATIO Page c~0 Cont'd On Page Zo/Calculation No.ME-02-98-04 Prepared By/Date='.M.Etwin Verified by/Date ze Revision No.0 Table 3 contains the stresses used in the fatigue evaluation for the upset loading (OBE).The stresses for OBE were conservatively cycled on top of the normal operating stresses that also contained the OBE stresses.For full stress reversal the minimum stresses used were calculated using the normal stresses and subtracting the OBE stress (Table 1).The maximum stress was developed using the normal stresses and adding the OBE stress.The number of cycles used in the fatigue evaluation was 300/year.Table 3 x=in 30 R+ressure+DWT+OBE=ksi Stress Min Fatigue OBE=ksi Stress (Max)Fatigue OBE=ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 38.076 19.926 6.816-1.554-5.634-6.024-3.474 1.116 6.756 12.216 16.176 43.596 25.446 12.336 3.966-0.114-0.504 2.046 6.636 12.276 17.736 21.696 Table 4 contains the stresses used in the fatigue evaluation for the faulted loading (SSE).The stresses for SSE were conservatively cycled on top of the normal operating stresses that also contained the OBE stresses.For full stress reversal the minimum stresses used were calculated using the normal stresses and subtracting the SSE stress (Table 1).The maximum stress was developed using the normal stresses and adding the SSE stress.The number of cycles used in the fatigue evaluation was 10/lifetime. Table 4 x from I 30'R+pressure+DWT+OBE=ksi Stress (Min)Fatigue SSE=ksi Stress (Max)Fatigue SSE=ksi 0.2 0.4 0.6 0.8 1.2 1.4 1.6 1.8 40.836 22.686 9.576 1.206-2.874-3.264-0.714 3.876 9.516 14.976 18.936 36.381 18.231 5.121-3.249-7.329-7.719-5.169-0.579 5.061 10.521 14.481 45.291 27.141 14.031 5.661 1.581 1.191 3.741 8.331 13.971 19.431 23.391 I'~k L WASHINGTON at/aLlC PGWR1 49 SUPPLY SYSTEM Prepared By/Date T.M.Erwin MANUAL CALCULATIO Verified by/Dat Cont'd On Page 0/Calculation No.ME-02-98-04 Revision No.0 Table 5 contains the crack growth adjustments made to the computer calculated values as required by NUREG 0310 Rev.2.For IGSCC crack growth the NRC requires an aspect ratio (crack length to depth)to be a minimum of 20:1.To calculate this new length the initial value as found during R13 was first multiplied by 20 to obtain the new crack length.This was repeated for subsequent outages and by reviewing the output data for the IGSCC crack growth depth for estimated operational days between outages.R 16 was the last interval prior to R 17 when the flaw length to depth ratio would exceed 33%of the circumference. This length would require the assumption that the flaw was the entire circumference of the pipe in accordance with NUREG 0313 Rev.2.Therefore, the maximum length and depth used to complete the fatigue evaluation was the R 16 value of 0.89 deep and 17.8 in length.Outage 13 14 15 16 Days 290 580 870 Table 5 Depth=in 0.29 0.544 0.746 0.89 New Crack Length=in. 5.8 10.88 14.92 17.8 The Input file for N1FAT1.IN contains the flaw length of 17.8" and depth of 0.89".This flaw depth and length was then ran for one year of fatigue cycles due to discontinuity, OBE and SSE in accordance with ASME Code 1989 Section XI Rules.The final length was determined to be 17.81" and 0.983" deep.These values for Section XI Table IWB-3641-5 and IWB-3641-6 are: lf=17.81" af=0.983" To determine the Code acceptability of the flaws Tables IWB-3641-5 and-6 are used to determine aand a,.These are the maximum flaw depths for normal and faulted loading conditions. Acceptability is based on a<being less than these two values.The following calculations are used in conjunction with the referenced Section XI Tables to determined aand a<.The indication falls into what is classified as weld zone per Fig.IWB-3641-1. This requires the flaw to be evaluated using Tables IWB 3641-5 and-6.The use of these Tables requires the calculation of the defined stress ratio and the flaw length to circumference ratio to determine the allowable depth to thickness ratio.This value is used to determine the maximum flaw depth. s kJ SUPPLY SYSI'EM Prepared By/Date~T.M.Etwin MANUAL CALCVLATION Verified by/0 t Page S.'o Cont'd On Page Cetculetion No.ME-02-98-04 Revision No.0 Circumference of the nozzle is equal to 24+3.14=75.36" (based on a nominal diameter of 24)Depth/Thickness ratio=0.983"/2.0=.492 I</Circumference ratio=17.81/75.36"=.236 NORMAL OPERATING (INCLUDING UPSET AND TEST)CONDITIONS For Table IWB-3641-5 the stress ratio is determined by the following equation: Stress Ratio=M(P+P,+P)I 277 I S(From the referenced Table)Using the previous define stresses and an M value of 1.0 (for shielded metal arc welds when OD<24')the above equation for normal operating and upset conditions is equal to: DWT+OBE+Pressure +OBE+Thermal Discontinuity 0.286+2.76+7.79+2.76+18.73 =32.326 ksi NOTE: OBE is added twice conservatively to bound the normal operating and thermal stresses.Stress Ratio=32.326/2.77/16.65 =.701 Using the Stress Ratio and the Circumferential Ratio the allowable Depth to thickness ratio from Table IWB-3641-5 is 0.6.Therefore the maximum flaw=2.0.6=1.2" deep since 0.983"<1.2 The flaw is acceptable per Table IWB-3641-5 EMERGENCY AND FAULTED CONDITIONS For Table IWB-3641-6 the stress ratio is determined using a similar equation as above with the exception of the SSE stress being substituted for one of the OBE and 2.77 being replace with 1.39.P)Stress Ratio=M(P+Ps+P)I 139 I S(From the referenced Table)Therefore: 34.021/1.39/16.65 =1.47 Using the Stress Ratio and the Circumferential Ratio the allowable Depth to thickness ratio from Table IWB-3641-5 is 0.538 Therefore tha maximum flaw=2.0*0.538=1.076" since 0.983"<1.076'he flaw is acceptable per Table IWB-3641-6 Conclusion The flaw meets all the Code Section XI requirements and the N1 nozzle safe-end is acceptable for use without examination until R 16.}}