ML17292B665: Difference between revisions

From kanterella
Jump to navigation Jump to search
(Created page by program invented by StriderTol)
 
(Created page by program invented by StriderTol)
Line 16: Line 16:


=Text=
=Text=
{{#Wiki_filter:CATEGORYREGULATOYINFORMATION DISTRIBUTIO SYSTEM(RIDS)ACCESSION NBR:9905190200 DOC.ATE:~l~'31NOTARIZED:
{{#Wiki_filter:CATEGORY REGULATO Y INFORMATION DISTRIBUTIO SYSTEM (RIDS)ACCESSION NBR:9905190200 DOC.ATE:~l~'31 NOTARIZED:
NOFACIL:50-397 WPPSSNuclear.Project,Unit2,Washington PublicPoweAUTH.NAMEAUTHORAFFILIATION MCDONALD,J.E.
NO FACIL:50-397 WPPSS Nuclear.Project, Unit 2, Washington Public Powe AUTH.NAME AUTHOR AFFILIATION MCDONALD,J.E.
Washington PublicPowerSupplySystemSCHLEDER,L.S.,
Washington Public Power Supply System SCHLEDER,L.S., Washington Public Power Supply System MENDOLA.C.A.
Washington PublicPowerSupplySystemMENDOLA.C.A.
Teledyne Brown Engineering Co.RECIP.NAME RECIPIENT AFFILIATION DOCKET 05000397
TeledyneBrownEngineering Co.RECIP.NAME RECIPIENT AFFILIATION DOCKET05000397


==SUBJECT:==
==SUBJECT:==
"1998Radiological Envi=onMonitoring ProgramforWNP-2."With9051tr.DISTRIBUTION CODE:IE25DCOPIESRECEIVED:LTR IENCLISIZE:IR~TITLE:Environmental Monitoring Rept(perTechSpecs)NOTES:ERECIPXENT IDCODE/NAME LPD4-2LACUSHING,JINTERNAL:
"1998 Radiological Envi=on Monitoring Program for WNP-2." With 9051 tr.DISTRIBUTION CODE: IE25D COPIES RECEIVED:LTR I ENCL I SIZE: IR~TITLE: Environmental Monitoring Rept (per Tech Specs)NOTES: E RECIPXENT ID CODE/NAME LPD4-2 LA CUSHING, J INTERNAL: ACRS NRR/DIPM/IOLB EXTERNAL: NRC PDR 1 1 1 1 1 1 E CENTER 0 RGN4 FILE COPIES RECIPIENT LTTR ENCL ID CODE/NAME 1 1 LPD4-2 PD 1 1 COPIES LTTR ENCL 1 1 1 1 1,1 R'D 0 E NOTE TO ALL"RIDS" RECIPIENTS:
ACRSNRR/DIPM/IOLB EXTERNAL:
PLEASE HELP US TO REDUCE WASTE.'TO HAVE YOUR NAME OR ORGANIZATION REMOVED FROM DISTRIBUTION LISTS OR REDUCE THE NUMBER OF COPIES RECEIVED BY YOU OR YOUR ORGANIZATION, CONTACT THE DOCUMENT CONTROL DESK (DCD)ON EXTENSION 415-2083 TOTAL NUMBER OF COPIES REQUIRED: LTTR 8 ENCL 8 WASHINGTON PUBLIC POWER SUPPLY SYSTEM P.O.Box 968~Richland, Washiwgtou 99352-0968 May 12, 1999 G02-99-094 Docket No.50-397 U.S.Nuclear Regulatory Commission Document Control Desk Washington, D.C.20555 Energy Facility Site Evaluation Council Attn: EFSEC Manager P.O.Box 43172 Olympia, WA 98504-3172
NRCPDR111111ECENTER0RGN4FILECOPIESRECIPIENT LTTRENCLIDCODE/NAME 11LPD4-2PD11COPIESLTTRENCL11111,1R'D0ENOTETOALL"RIDS"RECIPIENTS:
PLEASEHELPUSTOREDUCEWASTE.'TO HAVEYOURNAMEORORGANIZATION REMOVEDFROMDISTRIBUTION LISTSORREDUCETHENUMBEROFCOPIESRECEIVEDBYYOUORYOURORGANIZATION, CONTACTTHEDOCUMENTCONTROLDESK(DCD)ONEXTENSION 415-2083TOTALNUMBEROFCOPIESREQUIRED:
LTTR8ENCL8 WASHINGTON PUBLICPOWERSUPPLYSYSTEMP.O.Box968~Richland, Washiwgtou 99352-0968 May12,1999G02-99-094 DocketNo.50-397U.S.NuclearRegulatory Commission DocumentControlDeskWashington, D.C.20555EnergyFacilitySiteEvaluation CouncilAttn:EFSECManagerP.O.Box43172Olympia,WA98504-3172


==Subject:==
==Subject:==
SUPPLYSYSTEMNUCLEARPLANTNO.2RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMANNUALREPORTFOR1998
SUPPLY SYSTEM NUCLEAR PLANT NO.2 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM ANNUAL REPORT FOR 1998


==References:==
==References:==


1.WNP-2(Operating LicenseNo.NPF-21),Technical Specification 5.6.22.EFSECResolution No.260,January13,1992Enclosedarethree(3)copiesofthesubjectreportandseparatedatavolumewhicharesubmitted perthereferenced requirements.
1.WNP-2 (Operating License No.NPF-21), Technical Specification 5.6.2 2.EFSEC Resolution No.260, January 13, 1992 Enclosed are three (3)copies of the subject report and separate data volume which are submitted per the referenced requirements.
Respectfully, 8uD.W.Coleman(MailDropPE20)Manager,Regulatory AffairsEnclosures cc(reportw/odatavolume,exceptasnoted):DMcBaugh(WDOH)EWMerschoff (NRCRIV)LAlbin(WDOH)(w/data vol)JSCushing(NRCNRR)RJJulian(WDOE-Kenn)
Respectfully, 8u D.W.Coleman (Mail Drop PE20)Manager, Regulatory Affairs Enclosures cc (report w/o data volume, except as noted): D McBaugh (WDOH)EW Merschoff (NRC RIV)LAlbin (WDOH)(w/data vol)JS Cushing (NRCNRR)RJ Julian (WDOE-Kenn)
NRCSrResidentInspector (927N)PDRobinson(WinstonkStrawn)RLDirkes(PNNL)DLWilliams(BPA/399)
NRC Sr Resident Inspector (927N)PD Robinson (Winston k Strawn)RL Dirkes (PNNL)DL Williams (BPA/399)V9OSi9OZOO esiiai PDR ADQCK OSOOO3'F7 R.PDR  
V9OSi9OZOO esiiaiPDRADQCKOSOOO3'F7 R.PDR  
~TO YAKNA BARRICADE ROUTE 11A r.wow<RD,J I col 51 z I 10 mi.Radius IO DI 5 al Q I 1I Ivy I3 A cE 0 O I I I I p 0 0@~12 hl Ol Wl I I J Rgf,++0~4'pp>+, VIE'i+0\I HOLUNGSWORTH RD.I I I I go a a a a a a a a a a I BASN HML RD.I I I lsaaaaaaaaa aa BELLFLOWER RD.'I HOLLtNGSWORTH I.Id I CIlHESTlay)I R 170~u.SHEFF1ELD RD.W.KLAMATH RD BASIN CITY BENTON CITY FAY 0 I COUn 224 82 12 RICHLAND LEGEND~PAVED ROAD IllPRVD RD 0 R G RVL ROAD 82>>>>~BOUNDRY UNES PASCO 880334.1 Map Nov 1997 FIGURE 4-1 REMP SAMPLING LOCATIONS WITHIN THE 10-MILE RADIUS.-~0~C Ao Ql Q)~~o"0 Am.33M Cf C: 27 fA WASHINGTON 38~Lyons~Ferry Lower Monumental am Little Goose Dam Snake River Lower Granite Dam~Pomeroy~Dayton AP'ERT'URp CALID IS0 AvaflabIe 0<~~,-r!IUre Card Clarkston~IDAHO~Walla Walla OREGON 1 inch=16 miles 16+Sample Locations\MONS OUTSIDE THE 10-MILE RADIUS 1998 REMP ANNUAL REPORT 4-19 Jan 1999 STATION 9B Q INDEPENDENCE RD SUNN YS/DE Q K 1-0 FACTORY RD STATION 9A+0 A MILK Q AIR+TLD SOIL VEGETABLE I-82 STATION 96~STATION 9C RAY RD Q O O FORSELL RD McCREADIE RD GRANDV I-82 I-82 MABIN SCALE IN MILES 0 1 2 3 4 5 6 22 PRQSSER 880138M FEB 1995 FIGURE 4-3 REMP SAMPLING LOCATIONS SUNNYSIDE/GRANDVIEW AREA THIS PAGE INTENTIONALLY BLANK ROAD FENCEIJNES SHE!NU5 RAILROAO TRACKS NOT TO SCALE FIGURE 4-4 REMP NEAR PLANT SAMPLING LOCATIONS 4-21 1998 REMP ANNUAL REPORT I I I I I I 5.0 ULT ANDDI C SI N During 1998, the analyses of REMP samples were performed by Teledyne Brown Engineering Environmental Services in Westwood, New Jersey.The thermoluminescent dosimeters were processed by Battelle Northwest in Richland, Washington.
~TOYAKNABARRICADE ROUTE11Ar.wow<RD,JIcol51zI10mi.RadiusIODI5alQI1IIvyI3AcE0OIIIIp00@~12hlOlWlIIJRgf,++0~4'pp>+,VIE'i+0\IHOLUNGSWORTH RD.IIIIgoaaaaaaaaaaIBASNHMLRD.IIIlsaaaaaaaaa aaBELLFLOWER RD.'IHOLLtNGSWORTH I.IdICIlHESTlay)IR170~u.SHEFF1ELD RD.W.KLAMATHRDBASINCITYBENTONCITYFAY0ICOUn2248212RICHLANDLEGEND~PAVEDROADIllPRVDRD0RGRVLROAD82>>>>~BOUNDRYUNESPASCO880334.1MapNov1997FIGURE4-1REMPSAMPLINGLOCATIONS WITHINTHE10-MILERADIUS.-~0~CAoQlQ)~~o"0Am.33MCfC:27fA WASHINGTON 38~Lyons~FerryLowerMonumental amLittleGooseDamSnakeRiverLowerGraniteDam~Pomeroy~DaytonAP'ERT'URp CALIDIS0AvaflabIe 0<~~,-r!IUreCardClarkston
Table 5-1 presents the means and ranges of selected 1998 results for each type of sample collected and Table 5-3 provides a summaiy of detectable results.The means and ranges of the preoperational and the previous operational data are also included in the table for comparison.
~IDAHO~WallaWallaOREGON1inch=16miles16+SampleLocations
The data tables of 1998 results comprise a separate volume that is available to interested parties.The data for the prcoperational period and the first six months of 1984 included"less than" (()designations for icsults below the actual LLD, the contractual LLD, or the two-sigma erior, depending upon the convention employed by the analytical contractor.
\MONSOUTSIDETHE10-MILERADIUS1998REMPANNUALREPORT4-19Jan1999 STATION9BQINDEPENDENCE RDSUNNYS/DEQK1-0FACTORYRDSTATION9A+0AMILKQAIR+TLDSOILVEGETABLE I-82STATION96~STATION9CRAYRDQOOFORSELLRDMcCREADIE RDGRANDVI-82I-82MABINSCALEINMILES012345622PRQSSER880138MFEB1995FIGURE4-3REMPSAMPLINGLOCATIONS SUNNYSIDE/GRANDVIEW AREA THISPAGEINTENTIONALLY BLANK ROADFENCEIJNES SHE!NU5RAILROAOTRACKSNOTTOSCALEFIGURE4-4REMPNEARPLANTSAMPLINGLOCATIONS 4-211998REMPANNUALREPORT IIIIII 5.0ULTANDDICSINDuring1998,theanalysesofREMPsampleswereperformed byTeledyneBrownEngineering Environmental ServicesinWestwood, NewJersey.Thethermoluminescent dosimeters wereprocessed byBattelleNorthwest inRichland, Washington.
Consequently, the data averages using"less than" values an: biased high.The use of the"less than" values was discontinued in mid-1984.Since then, REMP data have been reported as net (total results minus the detector counting background).
Table5-1presentsthemeansandrangesofselected1998resultsforeachtypeofsamplecollected andTable5-3providesasummaiyofdetectable results.Themeansandrangesofthepreoperational andthepreviousoperational dataarealsoincludedinthetableforcomparison.
Since the primary focus of the REMP is to deteimine whether Plant 2 operations had an impact on the environment, the 1998 results are compared in this rcport to the icsults during the prcoperational period and the results obtained during the previous years of Plant 2 operation.
Thedatatablesof1998resultscompriseaseparatevolumethatisavailable tointerested parties.Thedatafortheprcoperational periodandthefirstsixmonthsof1984included"lessthan"(()designations foricsultsbelowtheactualLLD,thecontractual LLD,orthetwo-sigma erior,depending upontheconvention employedbytheanalytical contractor.
They are also compared to state and federal regulatory limits.Because of the use of"less than" values, mther than net results, during the preoperational period and during the first year of operation, and because of the impact of the 1986 Chernobyl accident on environmental radiation levels, the interpretation of the 1998 measurements relative to previous measurements must bear this in mind.Some of the parameters considered in the evaluations discussed in this icport are the means, ranges and standard deviations or standard errors of the results.Comparative plots and ficquency distributions of the data are some of the tools that have been employed in the interpretation of the 1998 REMP data.The 1998 analytical icsults for the REMP sampling locations established since the picoperational period ate very similar to the results reported for previous years.The 1998 annual and quarterly TLD zcsults were also very much like those observed previously.
Consequently, thedataaveragesusing"lessthan"valuesan:biasedhigh.Theuseofthe"lessthan"valueswasdiscontinued inmid-1984.
No significant trends indicating an enviionmental impact or unexpected change in the environmental concentrations or exposure rates at REMP monitoring stations were observed.5-1 1998 REMP ANNUAL REPORT 5.1 Direct Radiation~Environmental radiation exposure rates at near plant and remote stations, as determined by thermoluminescent dosimeters (TLDs), remained consistent with data from previous years.032 O O.SO 5 O.20 e$0.26 Figure 5-1 presents a plot of the mean 1998 quarterly TLD results for each of the sixteen meteorological sectors at the property boundary of the plant ("S" stations).
Sincethen,REMPdatahavebeenreportedasnet(totalresultsminusthedetectorcountingbackground).
The chart also includes the high, low and mean result in each sector for 1984 through 1997.Figure 5-1 Site Boundary Quarterly TLDs 1984-97 Hi/Low/Mean vs.1998 Mean by Sector The relationship of the mean 1998 tcsults to the results for the previous operational periods is very similar for each sector This indicates that there were no significant directional effects observed in the N NNE he ENE E ESE SE SSE S SSW SW WSW W'%NW NW NNW SECTOR o P~PERATIoNAL hlEAN 4 Isso 07 III/LowlhfEAN loss hlEAN 03$1998 TLD results.r ohio 5 0.2$020 N Nhe he ENE E ESE SE SSE S SSW SW WSW W WNW NW NNW The higher exposures in the N, NNE, and NNW sectors for the"S" stations is a result of those TLDs being physically closer to the plant than those of the other"S" station TLDs.Compatc the data presented in Figure 5-1 with that of Figure 5-2, where the near-plant TLDs an: more of an evenly placed distance from the plant.SECTOR 0 PRE.OPERATIONAL hlEAN+IOS4 0211!/LOWA!EAN I SOS hlEAN Figure 5-2 Near-Plant Quarterly TLDs-1984-97 Hi/Low/Mean vs.1998 Mean by Sector Summaries of the environmental radiation exposure rates, determined by thermoluminescent dosimeters (TLDs)are presented in Tables 5-4 and 5-5.1998 REMP ANNUAL REPORT'5-2 0.40 0.38 0.36 0.34 0.32 0.30 g 0.28 K 0.26~0.24 0.22 0.20 0.18 0.16 0.14 N NNE NE ENE E ESE SE SSE S SSW SW WSW W WlAV lAV NNW SECf OR o PRF OPERATIONAL MEAN+1984-97 HVLOW/MEAN
SincetheprimaryfocusoftheREMPistodeteimine whetherPlant2operations hadanimpactontheenvironment, the1998resultsarecomparedinthisrcporttotheicsultsduringtheprcoperational periodandtheresultsobtainedduringthepreviousyearsofPlant2operation.
-1998 MEAN Figure 5-3 Remote Quarterly TLDs 1984-97 Hi/Low/Mean vs.1998 Mean by Sector For the Iemote TLDs, Station 46 in the Wahluke Reserve (NE sector)Iemained the location with the highest mean exposure rate, as shown in Figure 5-3.Since the p1eoperational measurement phase, the Iesults for this location have exceeded the Iesults for all other locations.
Theyarealsocomparedtostateandfederalregulatory limits.Becauseoftheuseof"lessthan"values,mtherthannetresults,duringthepreoperational periodandduringthefirstyearofoperation, andbecauseoftheimpactofthe1986Chernobyl accidentonenvironmental radiation levels,theinterpretation ofthe1998measurements relativetopreviousmeasurements mustbearthisinmind.Someoftheparameters considered intheevaluations discussed inthisicportarethemeans,rangesandstandarddeviations orstandarderrorsoftheresults.Comparative plotsandficquency distributions ofthedataaresomeofthetoolsthathavebeenemployedintheinterpretation ofthe1998REMPdata.The1998analytical icsultsfortheREMPsamplinglocations established sincethepicoperational periodateverysimilartotheresultsreportedforpreviousyears.The1998annualandquarterly TLDzcsultswerealsoverymuchlikethoseobservedpreviously.
Variations in the soil and underlying rock composition most likely account for localized differences such as shown in the TLD results for Station 46.The quarterly mean of the four quarterly results for Station 46 was 0.30 mR/day, with a range of 0.27 mR/day to 0.31 mR/day.Frequency distribution plots of the 1998 quarterly TLD Iesults are pIesented in Figure 5-4.The plots were varied slightly from quarter to quarter, with 0.24 mR/day being the most frequent result, followed by 0.25 mR/day, 0.23 mR/day and 0.26 mR/day.The most frequent result for the period 1984 to 1997 was 0.26 mR/day, followed by 0.25 mR/day, 0.27 mR/day and 0.24 mR/day.The frequency distributions for the previous operational TLD results an: shown in Figure 5-5.A comparison of the 1998 annual and mean quarterly TLD result is pIesented in Table 5-6.The 1998 annual TLD Iesults ate generally 5-10%lower than the mean quarterly Iesults because of signal fade.This defference is not significant, in light of the variability commonly observed in TLD results.In most cases, the annual result is within the uncertainty associated with the quarterly TLD IeSultS.5-3 1998 REMP ANNUAL REPORT 70 65 1998 MEAN 0242 mR/DAY TOTAL OCCURRENCES
Nosignificant trendsindicating anenviionmental impactorunexpected changeintheenvironmental concentrations orexposureratesatREMPmonitoring stationswereobserved.
~227 60 55 50 45 m 40$35 Pg 30 2S 20 IS 10 a}'6}}l}0.14 0.15 0.16 0.17 0.18 0.19 0.20 0,21 0,22 0.23 0.24 0.25 0.26 0.27 0.28 0.29 0.30 0.31 0.32 0.33 094 035 MEAN mR/DAY~1998 FREQUENCY 1998 CURVE Figure SA Frequency Distribution for 1998 Quarterly TLDs 700 650 600 1984 97 hI EAN~0.251 mR/DAY TOTAI OCCURRENCES~SI40 550 500" 450~}}}}3SO 300 2SO 200 150 100 50."ih 0 4I}m 0.14 0.15 0.16 0.17 0.18 0 19 0,20 0.21 0 22 0.23 0,24 0 25 0.26 0.27 0,28 0,29 0.30 0.31 0.32 0.33 034 0.35 hI RAN mR/DAY~1984.96 FREQUENCY~1984-1997 CURVE Figure 5-5 Frequency Distribution for 1984-97 Quarterly TLDs 1998 REMP ANNUAL REPORT 5-4 5.2 Airborne Particulate/Iodine
5-11998REMPANNUALREPORT 5.1DirectRadiation
'Ihe 1998 mean weekly gross beta on particulate filter icsults for indicator stations near (within 3 miles)Plant 2 are plotted in Figure 5-6.'Ihe yoss beta in air xcsults for 1998 were within the ranges observed during the picoperational period and during previous operational periods, as shown in Table 5-1.In Figure 5-7, the similarity between melts from near-plant locations and those from remote locations can be seen.The control location (Station 9A)insults follow a very similar pattern to the remote and near-plant indicator locations.
~Environmental radiation exposureratesatnearplantandremotestations, asdetermined bythermoluminescent dosimeters (TLDs),remainedconsistent withdatafrompreviousyears.032OO.SO5O.20e$0.26Figure5-1presentsaplotofthemean1998quarterly TLDresultsforeachofthesixteenmeteorological sectorsatthepropertyboundaryoftheplant("S"stations).
As observed previously, gross beta levels increased during periods of inversion occurring in the fall and winter months.Gross beta results plotted over a period of several years show a cyclic pattern of fall and winter increases.
Thechartalsoincludesthehigh,lowandmeanresultineachsectorfor1984through1997.Figure5-1SiteBoundaryQuarterly TLDs1984-97Hi/Low/Mean vs.1998MeanbySectorTherelationship ofthemean1998tcsultstotheresultsforthepreviousoperational periodsisverysimilarforeachsectorThisindicates thattherewerenosignificant directional effectsobservedintheNNNEheENEEESESESSESSSWSWWSWW'%NWNWNNWSECTORoP~PERATIoNAL hlEAN4Isso07III/LowlhfEAN losshlEAN03$1998TLDresults.rohio50.2$020NNheheENEEESESESSESSSWSWWSWWWNWNWNNWThehigherexposures intheN,NNE,andNNWsectorsforthe"S"stationsisaresultofthoseTLDsbeingphysically closertotheplantthanthoseoftheother"S"stationTLDs.Compatcthedatapresented inFigure5-1withthatofFigure5-2,wherethenear-plantTLDsan:moreofanevenlyplaceddistancefromtheplant.SECTOR0PRE.OPERATIONAL hlEAN+IOS40211!/LOWA!EAN ISOShlEANFigure5-2Near-Plant Quarterly TLDs-1984-97Hi/Low/Mean vs.1998MeanbySectorSummaries oftheenvironmental radiation exposurerates,determined bythermoluminescent dosimeters (TLDs)arepresented inTables5-4and5-5.1998REMPANNUALREPORT'5-2 0.400.380.360.340.320.30g0.28K0.26~0.240.220.200.180.160.14NNNENEENEEESESESSESSSWSWWSWWWlAVlAVNNWSECfORoPRFOPERATIONAL MEAN+1984-97HVLOW/MEAN
The increase, which was evident in the results of all the air sampling locations, is due to an increase in radon and radon daughter concentrations during the inversions.
-1998MEANFigure5-3RemoteQuarterly TLDs1984-97Hi/Low/Mean vs.1998MeanbySectorFortheIemoteTLDs,Station46intheWahlukeReserve(NEsector)Iemainedthelocationwiththehighestmeanexposurerate,asshowninFigure5-3.Sincethep1eoperational measurement phase,theIesultsforthislocationhaveexceededtheIesultsforallotherlocations.
The quarterly gamma analyses of the particulate filter composites indicated only the presence of two naturally-occurring radionuclides, beiyHium-7 and potassium-40, at levels above detection limits at indicator locations and the control location.All iodine-131 in air results for 1998 were less than the 0.02 picocuries/cubic meter (pCi/m')LLD.SEEKS l9 75 R)R 1985 ARE NOr INCu)DED IN MEAN DUE TQ IEGII BIAS CAUSED BY CNERNCBYL Io all La aIO~0.09 g aco$ao7 IS aOO 8~ao)aol I 5 5 7 9 II 1515)7)9)I 2)2527%515))557)9 4I 4)454749 5l IRUVAVC I)8597 4$AVERAGE199$
Variations inthesoilandunderlying rockcomposition mostlikelyaccountforlocalized differences suchasshownintheTLDresultsforStation46.Thequarterly meanofthefourquarterly resultsforStation46was0.30mR/day,witharangeof0.27mR/dayto0.31mR/day.Frequency distribution plotsofthe1998quarterly TLDIesultsarepIesented inFigure5-4.Theplotswerevariedslightlyfromquartertoquarter,with0.24mR/daybeingthemostfrequentresult,followedby0.25mR/day,0.23mR/dayand0.26mR/day.Themostfrequentresultfortheperiod1984to1997was0.26mR/day,followedby0.25mR/day,0.27mR/dayand0.24mR/day.Thefrequency distributions forthepreviousoperational TLDresultsan:showninFigure5-5.Acomparison ofthe1998annualandmeanquarterly TLDresultispIesented inTable5-6.The1998annualTLDIesultsategenerally 5-10%lowerthanthemeanquarterly Iesultsbecauseofsignalfade.Thisdefference isnotsignificant, inlightofthevariability commonlyobservedinTLDresults.Inmostcases,theannualresultiswithintheuncertainty associated withthequarterly TLDIeSultS.5-31998REMPANNUALREPORT 70651998MEAN0242mR/DAYTOTALOCCURRENCES
Figure 5-6 1985-97 Weekly Hi/Low/Mean vs.1998 Weekly Mean Gross Beta in Air-Near Plant Stations NOIR'O'EEKS l)-2)fOR I 924 ARE NO7 INCEUDED IN MEAN DUE TO BIO)I BIAS CAUSED BY aKRNOBYL 4.22 w~a)I o a'o$aot 2$ao)o aot OOI I l S I 7 II D 1$27 It II 2l)$27 lt ll)))S)7)t~I 4l 4$47 4t SI WEEK NlfLO/AVCI)9597
~22760555045m40$35Pg302S20IS10a}'6}}l}0.140.150.160.170.180.190.200,210,220.230.240.250.260.270.280.290.300.310.320.33094035MEANmR/DAY~1998FREQUENCY 1998CURVEFigureSAFrequency Distribution for1998Quarterly TLDs700650600198497hIEAN~0.251mR/DAYTOTAIOCCURRENCES~SI40 550500"450~}}}}3SO3002SO20015010050."ih04I}m0.140.150.160.170.180190,200.210220.230,240250.260.270,280,290.300.310.320.330340.35hIRANmR/DAY~1984.96FREQUENCY
~AVERAGE)992 Figure 5-7 1985-97 Weekly Hi/Low/Mean vs.1998 Weekly Mean Gross Beta in Air-Remote Stations No evidence of any impact of plant operations on the environment was apparent in the particulate filter and charcoal cartridge results for 1998.5-5 1998 REMP ANNUAL REPORT 5.3 Water IO All river/drinking water tcsults for gross beta were within the ranges normally observed and less than 8 picocuries/liter (pCi/1), the level at which a strontium analysis is performed to verify compliance with the Washington State drinking water standard for strontium-90'.
~1984-1997 CURVEFigure5-5Frequency Distribution for1984-97Quarterly TLDs1998REMPANNUALREPORT5-4 5.2AirborneParticulate/Iodine
The 1998 STATE ANNUAL AVERAGE CONCENTRATION LIMIT I 5:C.)~EJ INTAKE S JOO AREA r3RICIILAND Figure 5-8 Gross Beta in River/Drinking Water-1998 0 gross beta concentrations in FEB MAR APR MAY lUN lUL AUO SEP OCT NOV DEC JAN MONTH river/drinking water, relative to the state annual average concentration limit"", are presented in Figure 5-8.The mean gmss beta results in discharge water for 1998 are presented in Figure 5-9.The 1998 average results compan: well to the averages from previous periods.The gross beta levels in the discharge sample 3cflect the concentrations of naturally-occurring radionuclides, principally potassium-40, and any radionuclides from upstream sources of past Hanford activities present in the makeup water, in addition to radionuclides Aom Plant 2 discharges.
'Ihe1998meanweeklygrossbetaonparticulate filtericsultsforindicator stationsnear(within3miles)Plant2areplottedinFigure5-6.'Iheyossbetainairxcsultsfor1998werewithintherangesobservedduringthepicoperational periodandduringpreviousoperational periods,asshowninTable5-1.InFigure5-7,thesimilarity betweenmeltsfromnear-plant locations andthosefromremotelocations canbeseen.Thecontrollocation(Station9A)insultsfollowaverysimilarpatterntotheremoteandnear-plant indicator locations.
The discharge sample results are representative of the radioactivity present in plant discharges before any mixing with river water occurs.All results were below the Washington Department of Health's (WDOH)80 75 70 65 60~55 I 50~is~~i0 g 30 25 20 IO wh, DrriI 833 9XL9F tlXh433UttvrPZtcAIIM38!pe.P JMf IIR CIA>AI~Mat JI;5 JUL AUG sap ocr Nov Dsc hl ONTII Figurc'5.IJ Gross Beta in Discharge Water-1998 investigation level, which is the point the Supply System would notify WDOH of the result.'Strontium-90 is assumed to account for the gross beta result.1998 REMP ANNUAL REPORT'5-'6 The 1998 tritium levels in the river/dm1king water and groundwater were comparable with results obtained for prior years.Tritium levels in the discharge water were higher than the levels observed for the river/drinking water samples because of plant releases and because discharge water samples were taken prior to the water reaching the river and becoming 3 0$406 I.ostol 2.5Bt06 S.os%05 r r ml6.0Er03 6AIEt03''ROE@03 1909 I 990 I 99 I I 993)993 I 99I l 995 I 996 I 999 I 990 YEAR diluted.As shown in Figure 5-TRITIIM III/LOW/MEAN
Asobservedpreviously, grossbetalevelsincreased duringperiodsofinversion occurring inthefallandwintermonths.Grossbetaresultsplottedoveraperiodofseveralyearsshowacyclicpatternoffallandwinterincreases.
~!FSLIJENT DISCIIARCED 10 the annual mean tritium 9 Figure 5-10 Tritium in Discharge Water and Effluent Discharged 1989-98 continued to be lower than the levels observed in the 1989-96 period.This reduction is due to an overall reduction in the volume of radwaste discharges from a high of over three million gallons in 1993 to a low of 132,000 gallons in 1997.The volume of liquid radwaste discharged in 1998 was 717,000 gaHons.5.0EtM 63Et0l 6.0ER3 33Et03 3.0Em tt SSE403 8 XOE<3 IDEk8 I.OBK8 5.0Et02 0.0Et00 WASIBNGTON DEPARTSIE&#xc3;P OF HEALTII INVESISCA'll ON LEVFL tI 000~SECOND Tll&#xc3;D QUARTER SI COOLINC TOWER DISCIIARCE Figure 5-11 Tritium in Discharge Water-1998 Tritium concentrations in the discharge water for 1998 ranged&om 100 to 4200 pCi/1, which is low when compared to the NRC reporting level of 20,000 pCi/1 for a quarterly average concentration in drinking water.Other than tritium, there were no detectable nuclides in the river/drinking or ground water samples during 1998.The discharge water had detectable tritium and one occurrence of detectable cobalt-60.
Theincrease, whichwasevidentintheresultsofalltheairsamplinglocations, isduetoanincreaseinradonandradondaughterconcentrations duringtheinversions.
The cobalt-60 was measured at 6.2 pCi/I, well below the NRC reporting level of 300 pCi/l.5.4 Soil Gamma spectrometry performed on soil samples in 1998 indicated a range of cesium-137 Aom 23 picocuries/kilogram (pCi/kg)to 166 pCi/kg at the indicator stations and a result of 79 pCi/kg at the consol station.As shown in Table 5-1, the cesium-137 levels in the soil samples were well within 5-7 199$REMP ANNUAL REPORT the range observed during preoperational and previous operational sampling.The gamma spectrometry results for the soil samples did not indicate any impact from Plant 2 operations on the environment.
Thequarterly gammaanalysesoftheparticulate filtercomposites indicated onlythepresenceoftwonaturally-occurring radionuclides, beiyHium-7 andpotassium-40, atlevelsabovedetection limitsatindicator locations andthecontrollocation.
No stxontium analysis was xequixcd in 1998.Aside from cesium-137, the only radionuclides detected in the samples were potassium-40, radium-226 and thorium-228.
Alliodine-131 inairresultsfor1998werelessthanthe0.02picocuries/cubic meter(pCi/m')LLD.SEEKSl975R)R1985ARENOrINCu)DEDINMEANDUETQIEGIIBIASCAUSEDBYCNERNCBYL IoallLaaIO~0.09gaco$ao7ISaOO8~ao)aolI5579II1515)7)9)I2)2527%515)
These axe part of the natural radioactivity typically found in soils.5.5 River Sediment The results of gamma spectxometxy of river sediment indicated that aside fxom the naturally occurring radionuclides (potassium-40, radium-226 and thorium-228), cobalt-60 and cesium-137 were detected downstxcam of the plant (Station 34).Cesium-137 was also detected in the upstream control sample (Station 33).The cesium-137 concentrations in the upstream samples were 42'pCi/kg and 60 pCi/kg dxy weight.The concentrations of cesium-137 in the downstxeam samples were 194 pCi/kg and 337 pCi/kg dry weight.Cobalt-60 levels in the two downstream samples were 20 pCi/kg and 22 pCi/kg dry weight, Both cobalt-60 and cesium-137 have been detected in similar quantities in pamperational samples and operational samples.They have also been previously identified as components of the Columbia River sediment originating from the operation of the old Hanfoxd Reservation reactors."" 5.6 Hsh The gamma spectrometry xcsults of fish samples collected in the vicinity of the Plant 2 discharge and at the contxol location on the Snake River were below detection limits, except for potassium-40, a naturally-occurring radionuclide.
)557)94I4)4547495lIRUVAVCI)85974$AVERAGE199$
5.7 Milk There was one detectable iodine-131 result in 1998.The result of 0.64 pCi/1 was found in the November sample taken at Station 64 and is just above the detection level for this nuclide.The iodine-131 result from the other downwind dairy was below the detection limit.An investigation of plant effluents determined it was not an effect from the plant.All gamma spectxometxy milk sample results for the indicator and control locations were less than the detection limits, except for potassium-40, which is naturally occurring.
Figure5-61985-97WeeklyHi/Low/Mean vs.1998WeeklyMeanGrossBetainAir-NearPlantStationsNOIR'O'EEKSl)-2)fORI924ARENO7INCEUDEDINMEANDUETOBIO)IBIASCAUSEDBYaKRNOBYL4.22w~a)Ioa'o$aot2$ao)oaotOOIIlSI7IID1$27ItII2l)$27ltll)))S)7)t~I4l4$474tSIWEEKNlfLO/AVCI)9597
Because of the loss of the control dairy, it was decided to use the garden produce as a substitute while another suitable dairy was located.No dairy in the area of the control was located that didn'at least use feed grown downwind of the plant as supplemental feed.In August, the REMP began collecting samples of feed grown by the owners of the dairy at Station 9.No radionuclides were detected other than the naturally occurring beryllium-7 and potassium-40.
~AVERAGE)992 Figure5-71985-97WeeklyHi/Low/Mean vs.1998WeeklyMeanGrossBetainAir-RemoteStationsNoevidenceofanyimpactofplantoperations ontheenvironment wasapparentintheparticulate filterandcharcoalcartridge resultsfor1998.5-51998REMPANNUALREPORT 5.3WaterIOAllriver/drinking watertcsultsforgrossbetawerewithintherangesnormallyobservedandlessthan8picocuries/liter (pCi/1),thelevelatwhichastrontium analysisisperformed toverifycompliance withtheWashington Statedrinkingwaterstandardforstrontium-90'.
1998 REMP ANNUAL REPORT 5-8 5.8 Garden Produce The gamma isotopic analysis icsults for all root, fruit and leafy vegetables collected in 1998 were below detection limits other than potassium-40, which occurs naturally.
The1998STATEANNUALAVERAGECONCENTRATION LIMITI5:C.)~EJINTAKESJOOAREAr3RICIILAND Figure5-8GrossBetainRiver/Drinking Water-1998 0grossbetaconcentrations inFEBMARAPRMAYlUNlULAUOSEPOCTNOVDECJANMONTHriver/drinking water,relativetothestateannualaverageconcentration limit"",arepresented inFigure5-8.Themeangmssbetaresultsindischarge waterfor1998arepresented inFigure5-9.The1998averageresultscompan:welltotheaveragesfrompreviousperiods.Thegrossbetalevelsinthedischarge sample3cflecttheconcentrations ofnaturally-occurring radionuclides, principally potassium-40, andanyradionuclides fromupstreamsourcesofpastHanfordactivities presentinthemakeupwater,inadditiontoradionuclides AomPlant2discharges.
5.9 Special Interest Stations The storm drain pond, Sanitaiy Waste Treatment Facility (SWTF)and the containerized storage area were incorporated into the routine sampling schedule in 1992.The cooling tower sediment disposal area was added in 1995.Thermoluminescent dosimeters were placed around the spray pond drainfield (Station 120)in June 1995.Discussions of the icsults from each of the locations aic given in the following sections.Until incorporated into the REMP, the sediment samples collected during previous years at the storm drain and SWTF were analyzed by the Supply System.The storm drain and SWTF sediment samples were analyzed wet, so the icsults were in terms of wet weight instead of the dry weight concentrations determined by Teledyne.Consequently, direct comparison of the wet sample icsults with the dried sample icsults is difficult since the peicent solids can vary from sample to sample.5.9.1 Storm Drain Pond (Station 101)The storm drain pond is located approximately 1500 feet northeast of Plant 2.Water is conveyed to the pond via a 18-inch diameter pipe which discharges into a 300-foot long earthen channel that leads to a 100-foot diameter pond.The pond is a shallow, unlined percolation/evaporation basin.REMP personnel collected water, sediment, soil and vegetation samples at the outfall during 1998.Monthly water grab samples and sediment samples were taken&om the pond area beginning in July of 1994 and were discontinued in July 1996.At the outfall, an automatic sampler collected flow proportional composite water samples.Sediment sampling at the outfall was changed from monthly to biannually in July of 1996.Vegetation was sampled annually near the outfall.Tritium was the only isotope detected during 1998.Figure 5-12 shows the monthly averages for 1992 thmugh 1998.The range for positive tritium results at the outfall was from 160 pCi/1 to 3700 pCi/1 and averaged 738 pCi/I.Detectable gross beta activity at the outfall averaged 4.4 pCi/1 with a range of 2.6 to 9.3 pCi/l.In June, an accidental actuation of the fire protection system caused the rupture of a cast iron valve, icsulting in flooding of a stairwell in the Reactor Building.Approximately 160,000 gallons of water was discharged into the stairwell.
Thedischarge sampleresultsarerepresentative oftheradioactivity presentinplantdischarges beforeanymixingwithriverwateroccurs.AllresultswerebelowtheWashington Department ofHealth's(WDOH)8075706560~55I50~is~~i0g302520IOwh,DrriI8339XL9FtlXh433UttvrPZtcAIIM38!pe
A sample of the water in the stairwell was taken and counted, per procedure, to free release LLDs by the Plant Chemistry laboratory.
.PJMfIIRCIA>AI~MatJI;5JULAUGsapocrNovDschlONTIIFigurc'5.IJ GrossBetainDischarge Water-1998 investigation level,whichisthepointtheSupplySystemwouldnotifyWDOHoftheresult.'Strontium-90 isassumedtoaccountforthegrossbetaresult.1998REMPANNUALREPORT'5-'6 The1998tritiumlevelsintheriver/dm1king waterandgroundwater werecomparable withresultsobtainedforprioryears.Tritiumlevelsinthedischarge waterwerehigherthanthelevelsobservedfortheriver/drinking watersamplesbecauseofplantreleasesandbecausedischarge watersamplesweretakenpriortothewaterreachingtheriverandbecoming30$406I.ostol2.5Bt06S.os%05rrml6.0Er036AIEt03''ROE@031909I990I99II993)993I99Il995I996I999I990YEARdiluted.AsshowninFigure5-TRITIIMIII/LOW/MEAN
There was no detectable activity in this sample.Approximately 17,000 gallons of water was pumped from the stairwell to the storm drain pond when a second sample indicated a possibility of cobalt-60 being present.Pumping activities were suspended.
~!FSLIJENT DISCIIARCED 10theannualmeantritium9Figure5-10TritiuminDischarge WaterandEffluentDischarged 1989-98continued tobelowerthanthelevelsobservedinthe1989-96period.Thisreduction isduetoanoverallreduction inthevolumeofradwastedischarges fromahighofoverthreemilliongallonsin1993toalowof132,000gallonsin1997.Thevolumeofliquidradwastedischarged in1998was717,000gaHons.5.0EtM63Et0l6.0ER333Et033.0EmttSSE4038XOE<3IDEk8I.OBK85.0Et020.0Et00WASIBNGTON DEPARTSIE&#xc3;P OFHEALTIIINVESISCA'll ONLEVFLtI000~SECONDTll&#xc3;DQUARTERSICOOLINCTOWERDISCIIARCE Figure5-11TritiuminDischarge Water-1998Tritiumconcentrations inthedischarge waterfor1998ranged&om100to4200pCi/1,whichislowwhencomparedtotheNRCreporting levelof20,000pCi/1foraquarterly averageconcentration indrinkingwater.Otherthantritium,therewerenodetectable nuclidesintheriver/drinking orgroundwatersamplesduring1998.Thedischarge waterhaddetectable tritiumandoneoccurrence ofdetectable cobalt-60.
The flow-proportional composite sampler at the outfall collected 171 ml of sample, which upon analysis at Teledyne, confirmed that there was no detectable cobalt-60 present.5-9 1998 REMP ANNUAL REPORT 00 I 1.04+0)5 P I.04+01 JAN FSB O1 991~1991 O1996 JUN JUI MONTH O199S O1 996 81999 1994 Figure 5-12 Average Monthly Tritium at Storm Drain Outfall-1992-98 Sediment at ST101 was sampled biannually at the outfall.In the sediment samples, cobalt-60 and cesium-137 were detected, along with the natural-occurring nuclides potassium-40, radium-226 and thorium-228.
Thecobalt-60 wasmeasuredat6.2pCi/I,wellbelowtheNRCreporting levelof300pCi/l.5.4SoilGammaspectrometry performed onsoilsamplesin1998indicated arangeofcesium-137 Aom23picocuries/kilogram (pCi/kg)to166pCi/kgattheindicator stationsandaresultof79pCi/kgattheconsolstation.AsshowninTable5-1,thecesium-137 levelsinthesoilsampleswerewellwithin5-7199$REMPANNUALREPORT therangeobservedduringpreoperational andpreviousoperational sampling.
Detectable cobalt-60 averaged 174 pCi/kg dry and ranged from 140 pCi/kg dry to 207 pCi/kg dry.The detectable cesium-137 ranged from 38 pCi/kg dry to 44 pCi/kg dry and averaged 41 pCi/kg dry All six soil samples, taken on the east and west banks, had detectable amounts of cesium-137 in them.The natural radionuclides of beryllium-7 potassium-40, radium-226 and thorium-228 were also detected.Cesium-137 averaged 33 pCi/kg and ranged from 30 pCi/kg to 37 pCi/kg.These results an: within the ranges observed in previous years.In the annual vegetation sample taken in the stieam, no detectable radionuclides were found other than potassium-40, which occurs naturally.
Thegammaspectrometry resultsforthesoilsamplesdidnotindicateanyimpactfromPlant2operations ontheenvironment.
5.9.2 Sanitary Waste Treatment Facility (Station 102)The Sanitary Waste Treatment Facility (SWTF), located approximately 0,4 mile south-southeast of Plant 2, processes the sanitary waste from Plant 2, the WNP-1 and WNP-4 sites, the Plant Support Facility (PSF)and the Department of Energy's 400 Area (beginning April, 1997).Discharge standmds and monitoring requirements for the SWTF are established in EFSEC Resolution No.259"".Until April 1992, the SWTF sediment was sampled semiannually and analyzed in the Support Services radiation laboratory and the radionuclide concentrations were given in terms of wet weight.Gross beta icsults for wastewater sampled prior to discharge to the percolation beds averaged 37 pCi/l and ranged Rom 32 pCi/l to 41 pCi/1.An investigation in 1994 into the source of the gross beta indicated potassium', a natural isotope, was the major contributor.
Nostxontium analysiswasxequixcdin1998.Asidefromcesium-137, theonlyradionuclides detectedinthesampleswerepotassium-40, radium-226 andthorium-228.
Other contributors to the beta appear to be natural isotopes and no fission or activation products were detected that would 1998 REMP ANNUAL REPORT 5-10 indicate Plant 2 as a source.Monthly composite water samples of the 400 Abaca effluent had gross beta results ranging fiom 17 pCi/1 to 41 pCi/1 and averaging 29 pCi/l.Prior to discharge samples and 400 Area effluent samples were also analyzed for gmss alpha.There were no detectable gross alpha results for 1998.Tritium results at the headworks (ST.102B)continued to increase due to the influx of FFTF effluent.The mean at the headworks increased from 466 pCi/1 to 1342 pCi/1.From May until August, tritium levels at the FFTF sewer line (ST.102A)averaged 15000 pCi/1.This was due to FFTF drawing water from another aquifer, known to have tritium levels of approximately 20000 pCi/I, while maintenance was performed on the main pump.The annual average for tritium at ST.102A was 8008 pCi/1 and ranged from 3800 pCi/1 to 20000 pCi/1.Tritium in the prior to discharge samples (ST.102C)averaged 803 pCi/1 and ranged fiom 480 pCi/1 to 1100 pCi/1.Water samples taken fiom the north stabilization pond (ST.102D)ranged fiom 670 pCi/1 to 1200 pCi/1 and average 935 pCi/1 while the south stabilization pond (ST.102E)had a mean of 925 pCi/1 and a range of 550 pCi/1 to 1300 pCi/l.Gamma analysis of sediment samples collected from the north stabilization pond revealed detectable quantities of cobalt-60 and cesium-137 in addition to naturally occurring nuclides.Detectable cobalt-60 ranged fmm 164 pCi/kg dry weight to 2110 pCi/kg diy weight.Cesium-137 results ranged from 72 pCi/kg dry weight to 132 pCi/kg diy weight.After the higher cobalt-60 result was received, a second sample&om the sample area was taken.The cobalt-60 and cesium 137 results for this sample were below the detection limits.5.9.3 Containerized Storage Area (Station 118)Station 118, consists of twenty-nine large metal storage containers holding the low-pressure turbine rotor parts removed from the plant during the 1992 maintenance outage, Soil samples and ionization chamber readings were taken at Station 118.Beginning in September 1994, samples from different areas were composited and sent to Teledyne Brown for analysis Soil samples taken at Station 118 before the storage'of the low-picssure turbine rotor parts contained no detectable radioactivity except that from naturally occurring radionuclides, such as potassium-40 and radium-226.
Theseaxepartofthenaturalradioactivity typically foundinsoils.5.5RiverSedimentTheresultsofgammaspectxometxy ofriversedimentindicated thatasidefxomthenaturally occurring radionuclides (potassium-40, radium-226 andthorium-228),
No detectable nuclides, other than those that are naturally occurring, were found in 1998.5.9.4 Cooling Tower Sediment Disposal Area (Station 119)'On May 8, 1995, EFSEC approved Resolution No.278"@that authorized the onsite disposal of cooling tower sediments containing low levels of radionuclides.
cobalt-60 andcesium-137 weredetecteddownstxcam oftheplant(Station34).Cesium-137 wasalsodetectedintheupstreamcontrolsample(Station33).Thecesium-137 concentrations intheupstreamsampleswere42'pCi/kgand60pCi/kgdxyweight.Theconcentrations ofcesium-137 inthedownstxeam sampleswere194pCi/kgand337pCi/kgdryweight.Cobalt-60 levelsinthetwodownstream sampleswere20pCi/kgand22pCi/kgdryweight,Bothcobalt-60 andcesium-137 havebeendetectedinsimilarquantities inpamperational samplesandoperational samples.Theyhavealsobeenpreviously identified ascomponents oftheColumbiaRiversedimentoriginating fromtheoperation oftheoldHanfoxdReservation reactors.
This area is located just south of the cooling towers.According to Resolution No.278, the REIMP is to monitor the aica's direct radiation exposure rate with annual pressurized ion chamber measurements.
""5.6HshThegammaspectrometry xcsultsoffishsamplescollected inthevicinityofthePlant2discharge andatthecontxollocationontheSnakeRiverwerebelowdetection limits,exceptforpotassium-40, anaturally-occurring radionuclide.
Direct radiation dose is measum1 by quarterly and annual TLDs and a dry composite sediment sample is taken from the disposal cell within thirty days following each cleaning to confirm that the disposal criteria outlined in the resolution have not been exceeded.5-11 1998 REMP ANNUAL REPORT An estimated total of 41 cubic yards of material was disposed of during the 1998 cleaning.Using the volume and an average measured dry density of 1.4 g/cm', along with the activity, it is calculated that the following quantities of nuclides were placed in the disposal area: Cobalt-60 Manganese-54 Zinc-65 Cesium-134 1.85E-06 curies 4.56E-07 curies 9.13E-08 curies'1.90E-06 curies Cesium-137 1.00E-05 curies Qf the above nuclides, only cobalt-60 and cesium-137 were above detection levels.The cobalt-60 cult was 42 pCi/kg dry.The cesium-137 result was 228 pCi/kg dry.Since the results for manganese-54, zinc-65 and cesium-134 were lower than the detection limit, the calculated quantities disposed of those nuclides are estimates of maximum possible concentration.
5.7MilkTherewasonedetectable iodine-131 resultin1998.Theresultof0.64pCi/1wasfoundintheNovembersampletakenatStation64andisjustabovethedetection levelforthisnuclide.Theiodine-131 resultfromtheotherdownwinddairywasbelowthedetection limit.Aninvestigation ofplanteffluents determined itwasnotaneffectfromtheplant.Allgammaspectxometxy milksampleresultsfortheindicator andcontrollocations werelessthanthedetection limits,exceptforpotassium-40, whichisnaturally occurring.
Measurements of direct radiation were taken using TLDs and a Reuter Stokes pressurized ion chamber.The TLDs were collected quarterly and annually.Two locations were used, one next to the collection area (ST.119B)and the other approximately 100 yards to the east as the control (ST.119-Control).
Becauseofthelossofthecontroldairy,itwasdecidedtousethegardenproduceasasubstitute whileanothersuitabledairywaslocated.Nodairyintheareaofthecontrolwaslocatedthatdidn'atleastusefeedgrowndownwindoftheplantassupplemental feed.InAugust,theREMPbegancollecting samplesoffeedgrownbytheownersofthedairyatStation9.Noradionuclides weredetectedotherthanthenaturally occurring beryllium-7 andpotassium-40.
The mean quarterly TLD result for ST.119B was 0.25 mR/day and ST.119-Control had a mean quarterly result of 0.24 mR/day.The annual TLD results were 0.22 mR/day for ST.119B and 0.23 for ST.119-Control.
1998REMPANNUALREPORT5-8 5.8GardenProduceThegammaisotopicanalysisicsultsforallroot,fruitandleafyvegetables collected in1998werebelowdetection limitsotherthanpotassium-40, whichoccursnaturally.
The pressurized ion chamber readings were taken monthly during 1998.The readings remained consistent throughout the year, with a high mean of 0.0102 mR/hr in March with the plant at 100%power to a low mean of 0.0091 mR/hr in April, with the plant shutdown.The average for the year was 0.0097 mR/hr.5.10 Spray Pond Drain Field (Station 120)Sediment&om spray pond cleanings had been discharge) to a trench located approximately 500 feet south of the spray ponds.In 1995, soil samples taken in, the trcnch indicated detectable amounts of cesium-137 and cobalt-60.
5.9SpecialInterestStationsThestormdrainpond,SanitaiyWasteTreatment Facility(SWTF)andthecontainerized storageareawereincorporated intotheroutinesamplingschedulein1992.Thecoolingtowersedimentdisposalareawasaddedin1995.Thermoluminescent dosimeters wereplacedaroundthesprayponddrainfield (Station120)inJune1995.Discussions oftheicsultsfromeachofthelocations aicgiveninthefollowing sections.
In 1996.the deposited sediment was removed to a disposal cell south of the cooling towers.The trencli has continual to be used as the discharge location for spray pond filter backwash water.In 1997, the decision was made to remove the west TLD station inside the trench, and the control TLD station on the south bank.The Station I l9 Control TLD would also act as the control location for Station 120.In 1998, the niean for the quarterly TLD inside the trench was 0.25 mR/day.The quarterly mean for the contrvl location was 0.24 mR/day.The annual results were 0.23 mR/day for both locations.
Untilincorporated intotheREMP,thesedimentsamplescollected duringpreviousyearsatthestormdrainandSWTFwereanalyzedbytheSupplySystem.ThestormdrainandSWTFsedimentsampleswereanalyzedwet,sotheicsultswereintermsofwetweightinsteadofthedryweightconcentrations determined byTeledyne.
Soil samples were taken in March and October of 1998.The samples are composites, taken from several areas inside the trench.These continued to show that no new radionuclides had been deposited in the trench since the previously deposited sediment was relocated in 1996.Along with the naturally occurring nuclides of beryllium-7, potassium-40, radium-226 and thorium-228, the 1998 REMP ANNVAL REPORT 5-12 only other detectable nuclide was cobalt-60 and cesium-137.
Consequently, directcomparison ofthewetsampleicsultswiththedriedsampleicsultsisdifficult sincethepeicentsolidscanvaryfromsampletosample.5.9.1StormDrainPond(Station101)Thestormdrainpondislocatedapproximately 1500feetnortheast ofPlant2.Waterisconveyedtothepondviaa18-inchdiameterpipewhichdischarges intoa300-footlongearthenchannelthatleadstoa100-footdiameterpond.Thepondisashallow,unlinedpercolation/evaporation basin.REMPpersonnel collected water,sediment, soilandvegetation samplesattheoutfallduring1998.Monthlywatergrabsamplesandsedimentsamplesweretaken&omthepondareabeginning inJulyof1994andwerediscontinued inJuly1996.Attheoutfall,anautomatic samplercollected flowproportional composite watersamples.Sedimentsamplingattheoutfallwaschangedfrommonthlytobiannually inJulyof1996.Vegetation wassampledannuallyneartheoutfall.Tritiumwastheonlyisotopedetectedduring1998.Figure5-12showsthemonthlyaveragesfor1992thmugh1998.Therangeforpositivetritiumresultsattheoutfallwasfrom160pCi/1to3700pCi/1andaveraged738pCi/I.Detectable grossbetaactivityattheoutfallaveraged4.4pCi/1witharangeof2.6to9.3pCi/l.InJune,anaccidental actuation ofthefireprotection systemcausedtheruptureofacastironvalve,icsulting infloodingofastairwell intheReactorBuilding.
The cobalt-60 results were 16 pCi/kg and 61 pCi/kg and the one detectable cesium-137 result was 21 pCi/kg.The cobalt-60 results were far below the pre-cleaning result of 6880 pCi/kg and comparable to results of samples taken immediately after the sediment had been removed in August of 1996.5.11 1998 Sample Deviations Air sampler outages made up the majority of sample deviations for 1998.Problems ranged from pump failure to power outages.Qf the three water sample deviations, one was due to the plant refueling outage and another to an outage of the water source.Deviations are listed in Table 5-2.5-13 1998 REMP ANNUAL REPORT TABLE 5-1 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE
Approximately 160,000gallonsofwaterwasdischarged intothestairwell.
 
Asampleofthewaterinthestairwell wastakenandcounted,perprocedure, tofreereleaseLLDsbythePlantChemistry laboratory.
==SUMMARY==
Therewasnodetectable activityinthissample.Approximately 17,000gallonsofwaterwaspumpedfromthestairwell tothestormdrainpondwhenasecondsampleindicated apossibility ofcobalt-60 beingpresent.Pumpingactivities weresuspended.
MEDIA/ANALYSIS PREOPERATIONALto MEAN RANGE PREVIOVS OPERATIONAL&xe MEAN RANGE 1998'" MEAN NGE Air: pCI/m'ross Beta 1-131" Gamma Cs-134 Cs-137 River/Drinking Water: pCi/I Gross Beta Gamma Cs-134 Cs-137 Co-58 Fe-59 Zn-65 H-3 Groundwatert pCi/1 Gamma Cs-134 Cs-137 Co-58 Co-60 Fe-59 Zn-65 H-3<0.02 (<0.003-0.130)<0.05 (<0.01-0.11)<0.01 (<0.001-0.040)<0.01 (<0.001-0.040)<3 (<I-<6)<3.8 (<I-<12)<4.1 (<I-<13)<5.1 (<I-<25)<4.7 (<I-<13)<13.3 (<2-<93)<8.3 (<2-<27)<481.7 (220-<820)<4 (<I-<12)<3.8 (0.8-<8)<4.'7 (<I-<12)<4.1 (0.1-<9)<11.6 (<2-<33)<8.6 (<2-17)<467.8 (<10-2600)0.020 (0.001-0.741)0.00 (%.07-0.82)0.0003 (%.0021-0.0149)0.0006 (%.0011-0.0356)1.9 (W.2-9.1)0.1 (-8.2-5.2)I (-5.7-6.2)4.1 (-3.3-2.9)0.7 (-4.9-7.1)0.7 (-8.9-6.9)4.9 (-16.2-10.5)108.4 (-500-596)0.4 (-4.1-5.4)0.9 (-6-4.9)-0.4 (-3.3-1.9)0.9 (-2.4-8.4)0.8 (-4.5-5.7)-0.6 (-46.8-15)16.7 (-516-324)0.012 (0.002-0.043)0.00 (-0.01-0.01)0.0000 (%.0003-0.0002)0.0000 (%.0003-0.0002)1.6 (0.4-2.4)0.1 (-2.3-2.6)0.7 (-3.2-3.3)%.1 (-2.3-1.1)0.1 (-3.1-1.4)1.6 (-2-6)0.9 (-2.7-5)120.3 (7.1-250)0.2 (-1.5-2.2)0.5 (-2.7-4.2)-0.4 (-2-0.7)0.2 (-2.1-1.7)0.2 (-2.2-3.3)I (-4.3-9.5)47.5 (-47-190)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of thc data means and ranges are biased high due to Chernobyl in 1986.(c)The data used for these avcragcs does not include the less than'alues reported in 1984.(d)Indicator stations only.(e)Charcoal cartridge results.1998 REMP ANNUAL REPORT-5-14 TABLE 5-1 (cont,)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE SUhQ~Y PREOPERATIONALto MEDIA/ANALYSIS MEAN GE MEAN GE PREVIOUS OPERATIONAL' 1998'o GE Discharge Water: pCI/I Gross Beta<2.8 (<1.9-4)16.9 (0.6-56)9.4 (1.1-22)Cs-134 Cs-137 Co-58 Fe 59 Zn-65 H-3 Sr-90<3.7 (<I-<8)<4.7 (<I-16)<1.4 (I-13)<5.0 (<1.9-<13)<11.9 (<3-<38)<8.6 (<2-27)<420 (<80-700)<3 0.5 2 0.0 5.6 0.9 3.8 1907 0.8 (-3.9-10.1)(-5.3-23.1)(-2.6-4.6)(-8.7-57.6)(-5.9-13)(-8.2-86.7)(55-12000)(0.5-1.1)0.5 1.5 W.3 0.6 1.5 0.4 803 (-1.1-1.9)(W.I-3.2)(-1.4-2.7)(-6.5-6.2)(-1.3-4.7)(-2.6-3.9)(62-1600)Analysis Not Performed Storm Drain Water: pCi/I Gross Beta Analysis Not Performed Analysis Not Performed 9.6 (0.2-1100)3.3 (0.3-9.3)Cs-134 Cs-137 Co-58 Co-60 Fe-59 Zn-65 Mn-54 1-131 Ce-141 1-131" H-3 Analysis Not Performed 0.0 1.3-0.4 0.9 0.8 0.8 0.6 W.I-I 0.4 5703.5 (-9.6-8.1)(-11-252)(-7.6-3.4)(A.2-125)(-14-12)(-13-53)(-6.2-6.7)(-17-21.1)(-441-707)(-0.2-8.3)(-330-270000)0.1 0.8 W.3 0.4 0.8 I 0.2 0.5-1.7 (-7.6-2.7)(A.4-7.5)(-3-2.5)(-11-2.9)(-3.5-4.7)(-6.7-1.8)(-2.9-3.5)(-4.2-7.7)(-13.2-3.3)Analysis Not Performed 324.6 (-52-3700)Sanitary Waste Water: pCi/I Gross Alpha Gross Beta Cs-134 Cs-137 Co-58 H-3 Analysis Not Performed Analysis Not Performed Analyses Not Performed 0.5 35.6 0.1 1 A.3 0.4 496.9 (48-2.3)(5.9-61)(-2.6-4.9)(-5.1-4.2)(-2.9-1.8)(-12.9-4)(-170-6700)0.5 31.3 0.2 0.9 W.3 0.1 3723.1 (-I-2.4)(17-41)(-2.3-2.6)(-4.2-3.6)(-1.4-1.6)(-3.2-1.7)(-170-20000)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges are biased high due to Chernobyl in 1986 (c)The data used for these averages does not include the'less than values reported in 1984.(d)Indicator stations only." (e)Resin method 5-15 1998 REMP ANNUAL REPORT TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE
Theflow-proportional composite samplerattheoutfallcollected 171mlofsample,whichuponanalysisatTeledyne, confirmed thattherewasnodetectable cobalt-60 present.5-91998REMPANNUALREPORT 00I1.04+0)5PI.04+01JANFSBO1991~1991O1996JUNJUIMONTHO199SO1996819991994Figure5-12AverageMonthlyTritiumatStormDrainOutfall-1992-98SedimentatST101wassampledbiannually attheoutfall.Inthesedimentsamples,cobalt-60 andcesium-137 weredetected, alongwiththenatural-occurring nuclidespotassium-40, radium-226 andthorium-228.
 
Detectable cobalt-60 averaged174pCi/kgdryandrangedfrom140pCi/kgdryto207pCi/kgdry.Thedetectable cesium-137 rangedfrom38pCi/kgdryto44pCi/kgdryandaveraged41pCi/kgdryAllsixsoilsamples,takenontheeastandwestbanks,haddetectable amountsofcesium-137 inthem.Thenaturalradionuclides ofberyllium-7 potassium-40, radium-226 andthorium-228 werealsodetected.
==SUMMARY==
Cesium-137 averaged33pCi/kgandrangedfrom30pCi/kgto37pCi/kg.Theseresultsan:withintherangesobservedinpreviousyears.Intheannualvegetation sampletakeninthestieam,nodetectable radionuclides werefoundotherthanpotassium-40, whichoccursnaturally.
MEDIA/ANALYSIS PREOPERATIONALro MEAN RANGE PREVIOUS OPERATIONAL"xo NGE 1998'+GE Analysis Not Performed" Cs-134 Cs-137 Co-58 Zn-65 Mn-54 Ce-141 Sanitary Waste Sediment: pCi/kg (dry)Gamma: Analysis Not Performed" Cs-134 Cs-137 Zn-65 Mn-54 Annual Soil: pCi/kg (dry)Gamma River Sediment: pCI/kg (dry)Gamma Cs-134.<112.5 (<50-<150)Cs-137<287 (<50-<560)Co-60<254.6 (130-610)Storm Drain Sediment: pCi/kg (dry)Gamma: 52.1 (7-172)316.1 (136.5-1890)37.4 (9-129)61.6 (4.1-1140)160.6 (-3.6-2900)-1.9 (-27-58)750.7 (-6.4-25400)116.2 (-34.5-4650)22.8 (-9.6-670)35.2 (-28.8-3740)27.7 (-15.6-55.2)148.8 (0-255.1)227.7 (-3.4-728.2)12.1 (-106-125)6.2 (-26-95)32.5 (26.1-38.9)265.5 (193.9-337.1)20.9 (20.3-21.6)12.2 (5.2-19.2)41.2 (38.1-44.4)-7.9 (-8.7--7.1)173.1 (139.6-206.6)4.8 (-34.5-1.2)1.6 (0.1-3.1)4.1 (1.5-6.7)34.6 (25.7-45.8)73.3 (15.7-132.1)760 (4.9-2110)1.6 (-38-37)9.1 (2.6-12.4)Cs-134 Cs-137 Sr-90<65.3 (<20-<150)364.3 (<20-<1880)Analysis Not Performed 24.9 (I-53.2)224.1 (-7.3-735)178.8 (0.2-455)32.7 (29.3-37.1)80.6 (23-165.9)Analysis Not Performed (a)All stations all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges aro biased high due to Chernobyl in 1986 (c)Tho data used for theso averages does not include the less the'alues reported in 1984.(d)Indicator stations only.(o)Prior to February 1992, theso samples werc analyzed as wet weight.These numbers aro for tho samples analyzed as dry weight.1998 REMP ANNUAL REPORT 5-16 TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENrAL MONITORING PROGRAM COMPARITIVE
5.9.2SanitaryWasteTreatment Facility(Station102)TheSanitaryWasteTreatment Facility(SWTF),locatedapproximately 0,4milesouth-southeast ofPlant2,processes thesanitarywastefromPlant2,theWNP-1andWNP-4sites,thePlantSupportFacility(PSF)andtheDepartment ofEnergy's400Area(beginning April,1997).Discharge standmdsandmonitoring requirements fortheSWTFareestablished inEFSECResolution No.259"".UntilApril1992,theSWTFsedimentwassampledsemiannually andanalyzedintheSupportServicesradiation laboratory andtheradionuclide concentrations weregivenintermsofwetweight.Grossbetaicsultsforwastewater sampledpriortodischarge tothepercolation bedsaveraged37pCi/landrangedRom32pCi/lto41pCi/1.Aninvestigation in1994intothesourceofthegrossbetaindicated potassium',
 
anaturalisotope,wasthemajorcontributor.
==SUMMARY==
Othercontributors tothebetaappeartobenaturalisotopesandnofissionoractivation productsweredetectedthatwould1998REMPANNUALREPORT5-10 indicatePlant2asasource.Monthlycomposite watersamplesofthe400Abacaeffluenthadgrossbetaresultsrangingfiom17pCi/1to41pCi/1andaveraging 29pCi/l.Priortodischarge samplesand400Areaeffluentsampleswerealsoanalyzedforgmssalpha.Therewerenodetectable grossalpharesultsfor1998.Tritiumresultsattheheadworks (ST.102B) continued toincreaseduetotheinfluxofFFTFeffluent.
MEDIA/ANALYSIS ST 118 Soil: pG/kg (dry)Gamma Cs-134 Cs-137 Storm Drain Soil: pCi/kg (dry)Gamma Cs-134 Cs-137 Milk: pG/I Gamma PREOPERATIONAU'EAN RANGE Analysis Not Performed Analysis Not Performed MEAN NGE 22.4 (-3.5-46)14.9 (0.5-48)22.3 (-1.4-38)41.7 (12.5-77.3)PREVIOUS OPERATIONAL' MEAN 21.8 13.7 24.7 (16.5-29.2)32.9 (30-36.7)Cs-134 Cs-137 Ba-140 La-140 1-131'" Sr-90 Fish: pG/kg (wet)Gamma<3.7 (<0.9-<14)<3.8 (<I-<12)<72.1 (<6-<2000)<33.3 (<5-1000)<0.5 (<0.1-<I)Analysis Not Performed 0.7 2.2 0.2-0.4 0.7 1.9 (-8.7-22.6)(-6.6-47.3)(A4.3-55)(-24.2-9.7)(A.8-143.6)(1.3-3.9)0.1 (-6.5-3.4)1.1 (-4.5-5.1)0.1 (-8.7-8.2)44 (-6.1-2.5)0.0 (A.4-0.6)Analysis Not Performed Cs-134 Cs-137 Co-58 Co-60 Fe-59 Mn-54 Produce: pG/kg (wet)Gamma<61.2 (<6-<130)<88.8 (<10-<130)87.7 (<9-<130)<80.6 (<9-<130)<130 (<30-<260)<88.3 (<8-<130)1.8 (-20.4-24)14.2 (-35.1-57)0.5 (-16.8-25.8)1.6 (-18.4-21)0.2 (-34.2-30)1.5 (-20-30.9)-1.4 8.7 2.5 0.1 1.6 1.6 (-6.7-6.4)(4.4-13.2)(0.4-4.3)(-6.3-4.6)(-1.6-7.2)(N.7-2.9)Cs-134 Cs-137 1-131<49.1 (<10-<140)<69.8 (<10-<140)<105.6 (<10-<1000)0.6 (-24.8-19.8)3 (-9.8-20.9)-0.3 (-26-59)0.4 (-3.4-3.6)1.2 (-1.7-2.4)4.1 (-5.3-3)(a)All stations, all years.(b)Indicator stations only for tho years 1984 to 1997.Some of the data means and ranges aro biased high duo to Chernobyl in 1986.(c)Tho data used for theso averages does not includo the less than values reported in 1984.(d)Indicator stations only.(o)Resin method.5-17 1998 REMP ANNUAL REPORT TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE SUMIrIARY MEDIA/ANALYSIS Storm Drain Vegetation":
Themeanattheheadworks increased from466pCi/1to1342pCi/1.FromMayuntilAugust,tritiumlevelsattheFFTFsewerline(ST.102A) averaged15000pCi/1.ThiswasduetoFFTFdrawingwaterfromanotheraquifer,knowntohavetritiumlevelsofapproximately 20000pCi/I,whilemaintenance wasperformed onthemainpump.TheannualaveragefortritiumatST.102Awas8008pCi/1andrangedfrom3800pCi/1to20000pCi/1.Tritiuminthepriortodischarge samples(ST.102C) averaged803pCi/1andrangedfiom480pCi/1to1100pCi/1.Watersamplestakenfiomthenorthstabilization pond(ST.102D) rangedfiom670pCi/1to1200pCi/1andaverage935pCi/1whilethesouthstabilization pond(ST.102E) hadameanof925pCi/1andarangeof550pCi/1to1300pCi/l.Gammaanalysisofsedimentsamplescollected fromthenorthstabilization pondrevealeddetectable quantities ofcobalt-60 andcesium-137 inadditiontonaturally occurring nuclides.
pCi/kg (wet)Gamma Mn-54 Co-60 Zn-65 Cs-134 Cs-137 PREOPERATIONALto MEAN RANGE Analysis Not Performed MEAN NGE 11.9 (-2-32.2)18.1 (-3.7-48.2)25 (-4.3-57.4)6.6 (-6.5-45.8)24.7 (-1.6-93.5)PREVIOUS OPERATIONAL' MEAN RANGE 2.2-3.8 26.8-14.8-1.2 Cooling Tower Sediment: pCi/kg (dry)Analysis Not Performed Analysis Not Performed Mn-54 Co-60 Zn-65 Cs-134 Cs-137 8.8 (2.8-14.9)69.7 (69.7-92.3)17 (4.5-27.8)32.1 (28-34.6)228.3 (211-236.9)10.4 32.2 2.1 43.2 228.1 TLD: mR/day Quarterly Annual 0.24 (0.17-0.31)0.24 (0.20-0.29)0.25 (0.16-0.35)0.24 (0.18-0.34)0.24 (0.20-0.31)0.22 (0.19-0.28)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges are biased high due to Chernobyl in 1986.(c)Tho data used for thesoaverages does not include the less than values reported in 1984.(d)Indicator Stations only.(o)Routino samples from tho outfall only.1998 REMP ANNUAL REPORT 5-18 TABLE 5-2 1998 SAMPLE DEVIATIONS SAMPLE MEDIA DATE Air Particulate/Iodine 02/0242/09 02/0942/17 04/2745/04 05/1145/18 05/1845/26 05/1845/26 05/2646/01 05/2646/01 07/2047-27 11/02-11/09 LOCATION Station 5 Station 5 Station 7 Station 57 Station 1 Station 48 Station 1 Station 48 Station 4 Station 48 PROBLEM Power off for substation repair.Sample volume acceptable Power off for substation repair.Sample volume acceptable Unit failure.Sample volume acceptable.
Detectable cobalt-60 rangedfmm164pCi/kgdryweightto2110pCi/kgdiyweight.Cesium-137 resultsrangedfrom72pCi/kgdryweightto132pCi/kgdiyweight.Afterthehighercobalt-60 resultwasreceived, asecondsample&omthesampleareawastaken.Thecobalt-60 andcesium137resultsforthissamplewerebelowthedetection limits.5.9.3Containerized StorageArea(Station118)Station118,consistsoftwenty-nine largemetalstoragecontainers holdingthelow-pressure turbinerotorpartsremovedfromtheplantduringthe1992maintenance outage,Soilsamplesandionization chamberreadingsweretakenatStation118.Beginning inSeptember 1994,samplesfromdifferent areaswerecomposited andsenttoTeledyneBrownforanalysisSoilsamplestakenatStation118beforethestorage'ofthelow-picssure turbinerotorpartscontained nodetectable radioactivity exceptthatfromnaturally occurring radionuclides, suchaspotassium-40 andradium-226.
Unit failure.Sample volume acceptable.
Nodetectable
Power off due to Outage.Sample volume unacceptable.
: nuclides, otherthanthosethatarenaturally occurring, werefoundin1998.5.9.4CoolingTowerSedimentDisposalArea(Station119)'OnMay8,1995,EFSECapprovedResolution No.278"@thatauthorized theonsitedisposalofcoolingtowersediments containing lowlevelsofradionuclides.
Unit failure.Sample volume unacceptable.
Thisareaislocatedjustsouthofthecoolingtowers.According toResolution No.278,theREIMPistomonitortheaica'sdirectradiation exposureratewithannualpressurized ionchambermeasurements.
Power restored this week.Volume acceptable.
Directradiation doseismeasum1byquarterly andannualTLDsandadrycomposite sedimentsampleistakenfromthedisposalcellwithinthirtydaysfollowing eachcleaningtoconfirmthatthedisposalcriteriaoutlinedintheresolution havenotbeenexceeded.
Late placement in field.Sample volume acceptable.
5-111998REMPANNUALREPORT Anestimated totalof41cubicyardsofmaterialwasdisposedofduringthe1998cleaning.
Unit failure.Sample volume unacceptable.
Usingthevolumeandanaveragemeasureddrydensityof1.4g/cm',alongwiththeactivity, itiscalculated thatthefollowing quantities ofnuclideswereplacedinthedisposalarea:Cobalt-60 Manganese-54 Zinc-65Cesium-134 1.85E-06curies4.56E-07curies9.13E-08curies'1.90E-06 curiesCesium-137 1.00E-05curiesQftheabovenuclides, onlycobalt-60 andcesium-137 wereabovedetection levels.Thecobalt-60 cultwas42pCi/kgdry.Thecesium-137 resultwas228pCi/kgdry.Sincetheresultsformanganese-54, zinc-65andcesium-134 werelowerthanthedetection limit,thecalculated quantities disposedofthosenuclidesareestimates ofmaximumpossibleconcentration.
Unit failure.Sample volume unacceptable.
Measurements ofdirectradiation weretakenusingTLDsandaReuterStokespressurized ionchamber.TheTLDswerecollected quarterly andannually.
Water Soil, Milk R-13 Outage 08/1048/18 12/01-12/10 12/31 2 Quarter Station 27 Station 28 Station 28 Station 101 Station 96 Sampler in Timed mode for plant outage.Sampler out of service for repair.Sample shipped on schedule.300 Area water off.No sam le due to wet weather.Ramerman Dairy quits operation.
Twolocations wereused,onenexttothecollection area(ST.119B) andtheotherapproximately 100yardstotheeastasthecontrol(ST.119-Control).
No suitable replacement found.Substitution of broadleaf vegetables and feed from Station 9 used l 5-19 1998 REMP ANNUAL REPORT TABLE 5-3 RADIOLO ICAL ENVIRONMENTAL MONITORING PROGRAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection~'ean (Ratio)"'D an e Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Control Location Mean (Ratio)"t an e Number of Nonroutine Reported Measurements Air Particulates (pCi/ms)Gross Beta 624 Gamma 48 (Quarterly) 0.003 0.012(572/572)
Themeanquarterly TLDresultforST.119Bwas0.25mR/dayandST.119-Control hadameanquarterly resultof0.24mR/day.TheannualTLDresultswere0.22mR/dayforST.119Band0.23forST.119-Control.
(0.002%.043) 4 6.4 191 SSE 0.013(52/52) 0.012(52/52) 0 (0.004%.043)
Thepressurized ionchamberreadingsweretakenmonthlyduring1998.Thereadingsremainedconsistent throughout theyear,withahighmeanof0.0102mR/hrinMarchwiththeplantat100%powertoalowmeanof0.0091mR/hrinApril,withtheplantshutdown.
Theaveragefortheyearwas0.0097mR/hr.5.10SprayPondDrainField(Station120)Sediment&omspraypondcleanings hadbeendischarge) toatrenchlocatedapproximately 500feetsouthofthesprayponds.In1995,soilsamplestakenin,thetrcnchindicated detectable amountsofcesium-137 andcobalt-60.
In1996.thedeposited sedimentwasremovedtoadisposalcellsouthofthecoolingtowers.Thetrenclihascontinual tobeusedasthedischarge locationforspraypondfilterbackwashwater.In1997,thedecisionwasmadetoremovethewestTLDstationinsidethetrench,andthecontrolTLDstationonthesouthbank.TheStationIl9ControlTLDwouldalsoactasthecontrollocationforStation120.In1998,thenieanforthequarterly TLDinsidethetrenchwas0.25mR/day.Thequarterly meanforthecontrvllocationwas0.24mR/day.Theannualresultswere0.23mR/dayforbothlocations.
SoilsamplesweretakeninMarchandOctoberof1998.Thesamplesarecomposites, takenfromseveralareasinsidethetrench.Thesecontinued toshowthatnonewradionuclides hadbeendeposited inthetrenchsincethepreviously deposited sedimentwasrelocated in1996.Alongwiththenaturally occurring nuclidesofberyllium-7, potassium-40, radium-226 andthorium-228, the1998REMPANNVALREPORT5-12 onlyotherdetectable nuclidewascobalt-60 andcesium-137.
Thecobalt-60 resultswere16pCi/kgand61pCi/kgandtheonedetectable cesium-137 resultwas21pCi/kg.Thecobalt-60 resultswerefarbelowthepre-cleaning resultof6880pCi/kgandcomparable toresultsofsamplestakenimmediately afterthesedimenthadbeenremovedinAugustof1996.5.111998SampleDeviations Airsampleroutagesmadeupthemajorityofsampledeviations for1998.Problemsrangedfrompumpfailuretopoweroutages.Qfthethreewatersampledeviations, onewasduetotheplantrefueling outageandanothertoanoutageofthewatersource.Deviations arelistedinTable5-2.5-131998REMPANNUALREPORT TABLE5-1RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMCOMPARITIVE SUMMARYMEDIA/ANALYSISPREOPERATIONALto MEANRANGEPREVIOVSOPERATIONAL&xe MEANRANGE1998'"MEANNGEAir:pCI/m'ross Beta1-131"GammaCs-134Cs-137River/Drinking Water:pCi/IGrossBetaGammaCs-134Cs-137Co-58Fe-59Zn-65H-3Groundwatert pCi/1GammaCs-134Cs-137Co-58Co-60Fe-59Zn-65H-3<0.02(<0.003-0.130)<0.05(<0.01-0.11)<0.01(<0.001-0.040)<0.01(<0.001-0.040)<3(<I-<6)<3.8(<I-<12)<4.1(<I-<13)<5.1(<I-<25)<4.7(<I-<13)<13.3(<2-<93)<8.3(<2-<27)<481.7(220-<820)<4(<I-<12)<3.8(0.8-<8)<4.'7(<I-<12)<4.1(0.1-<9)<11.6(<2-<33)<8.6(<2-17)<467.8(<10-2600)0.020(0.001-0.741)0.00(%.07-0.82)0.0003(%.0021-0.0149)0.0006(%.0011-0.0356)1.9(W.2-9.1)0.1(-8.2-5.2)I(-5.7-6.2)4.1(-3.3-2.9)0.7(-4.9-7.1)0.7(-8.9-6.9)4.9(-16.2-10.5)108.4(-500-596)0.4(-4.1-5.4)0.9(-6-4.9)-0.4(-3.3-1.9)0.9(-2.4-8.4)0.8(-4.5-5.7)-0.6(-46.8-15)16.7(-516-324)0.012(0.002-0.043)0.00(-0.01-0.01)0.0000(%.0003-0.0002)0.0000(%.0003-0.0002)1.6(0.4-2.4)0.1(-2.3-2.6)0.7(-3.2-3.3)%.1(-2.3-1.1)0.1(-3.1-1.4)1.6(-2-6)0.9(-2.7-5)120.3(7.1-250)0.2(-1.5-2.2)0.5(-2.7-4.2)-0.4(-2-0.7)0.2(-2.1-1.7)0.2(-2.2-3.3)I(-4.3-9.5)47.5(-47-190)(a)Allstations, allyears.(b)Indicator stationsonlyfortheyears1984to1997.SomeofthcdatameansandrangesarebiasedhighduetoChernobyl in1986.(c)Thedatausedfortheseavcragcsdoesnotincludethelessthan'alues reportedin1984.(d)Indicator stationsonly.(e)Charcoalcartridge results.1998REMPANNUALREPORT-5-14 TABLE5-1(cont,)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMCOMPARITIVE SUhQ~YPREOPERATIONALto MEDIA/ANALYSISMEANGEMEANGEPREVIOUSOPERATIONAL' 1998'oGEDischarge Water:pCI/IGrossBeta<2.8(<1.9-4)16.9(0.6-56)9.4(1.1-22)Cs-134Cs-137Co-58Fe59Zn-65H-3Sr-90<3.7(<I-<8)<4.7(<I-16)<1.4(I-13)<5.0(<1.9-<13)<11.9(<3-<38)<8.6(<2-27)<420(<80-700)<30.520.05.60.93.819070.8(-3.9-10.1)(-5.3-23.1)(-2.6-4.6)(-8.7-57.6)(-5.9-13)(-8.2-86.7)(55-12000)(0.5-1.1)0.51.5W.30.61.50.4803(-1.1-1.9)(W.I-3.2)(-1.4-2.7)(-6.5-6.2)(-1.3-4.7)(-2.6-3.9)(62-1600)AnalysisNotPerformed StormDrainWater:pCi/IGrossBetaAnalysisNotPerformed AnalysisNotPerformed 9.6(0.2-1100)3.3(0.3-9.3)Cs-134Cs-137Co-58Co-60Fe-59Zn-65Mn-541-131Ce-1411-131"H-3AnalysisNotPerformed 0.01.3-0.40.90.80.80.6W.I-I0.45703.5(-9.6-8.1)(-11-252)(-7.6-3.4)(A.2-125)(-14-12)(-13-53)(-6.2-6.7)(-17-21.1)(-441-707)(-0.2-8.3)(-330-270000)0.10.8W.30.40.8I0.20.5-1.7(-7.6-2.7)(A.4-7.5)(-3-2.5)(-11-2.9)(-3.5-4.7)(-6.7-1.8)(-2.9-3.5)(-4.2-7.7)(-13.2-3.3)AnalysisNotPerformed 324.6(-52-3700)SanitaryWasteWater:pCi/IGrossAlphaGrossBetaCs-134Cs-137Co-58H-3AnalysisNotPerformed AnalysisNotPerformed AnalysesNotPerformed 0.535.60.11A.30.4496.9(48-2.3)(5.9-61)(-2.6-4.9)(-5.1-4.2)(-2.9-1.8)(-12.9-4)(-170-6700)0.531.30.20.9W.30.13723.1(-I-2.4)(17-41)(-2.3-2.6)(-4.2-3.6)(-1.4-1.6)(-3.2-1.7)(-170-20000)(a)Allstations, allyears.(b)Indicator stationsonlyfortheyears1984to1997.SomeofthedatameansandrangesarebiasedhighduetoChernobyl in1986(c)Thedatausedfortheseaveragesdoesnotincludethe'lessthanvaluesreportedin1984.(d)Indicator stationsonly."(e)Resinmethod5-151998REMPANNUALREPORT TABLE5-1(cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMCOMPARITIVE SUMMARYMEDIA/ANALYSISPREOPERATIONALro MEANRANGEPREVIOUSOPERATIONAL"xo NGE1998'+GEAnalysisNotPerformed" Cs-134Cs-137Co-58Zn-65Mn-54Ce-141SanitaryWasteSediment:
pCi/kg(dry)Gamma:AnalysisNotPerformed" Cs-134Cs-137Zn-65Mn-54AnnualSoil:pCi/kg(dry)GammaRiverSediment:
pCI/kg(dry)GammaCs-134.<112.5(<50-<150)Cs-137<287(<50-<560)Co-60<254.6(130-610)StormDrainSediment:
pCi/kg(dry)Gamma:52.1(7-172)316.1(136.5-1890)37.4(9-129)61.6(4.1-1140)160.6(-3.6-2900)-1.9(-27-58)750.7(-6.4-25400)116.2(-34.5-4650)22.8(-9.6-670)35.2(-28.8-3740)27.7(-15.6-55.2)148.8(0-255.1)227.7(-3.4-728.2)12.1(-106-125)6.2(-26-95)32.5(26.1-38.9)265.5(193.9-337.1)20.9(20.3-21.6)12.2(5.2-19.2)41.2(38.1-44.4)-7.9(-8.7--7.1)173.1(139.6-206.6)4.8(-34.5-1.2)1.6(0.1-3.1)4.1(1.5-6.7)34.6(25.7-45.8)73.3(15.7-132.1)760(4.9-2110)1.6(-38-37)9.1(2.6-12.4)Cs-134Cs-137Sr-90<65.3(<20-<150)364.3(<20-<1880)AnalysisNotPerformed 24.9(I-53.2)224.1(-7.3-735)178.8(0.2-455)32.7(29.3-37.1)80.6(23-165.9)AnalysisNotPerformed (a)Allstationsallyears.(b)Indicator stationsonlyfortheyears1984to1997.SomeofthedatameansandrangesarobiasedhighduetoChernobyl in1986(c)Thodatausedforthesoaveragesdoesnotincludethelessthe'alues reportedin1984.(d)Indicator stationsonly.(o)PriortoFebruary1992,thesosampleswercanalyzedaswetweight.Thesenumbersaroforthosamplesanalyzedasdryweight.1998REMPANNUALREPORT5-16 TABLE5-1(cont.)RADIOLOGICAL ENVIRONMENrAL MONITORING PROGRAMCOMPARITIVE SUMMARYMEDIA/ANALYSISST118Soil:pG/kg(dry)GammaCs-134Cs-137StormDrainSoil:pCi/kg(dry)GammaCs-134Cs-137Milk:pG/IGammaPREOPERATIONAU'EAN RANGEAnalysisNotPerformed AnalysisNotPerformed MEANNGE22.4(-3.5-46)14.9(0.5-48)22.3(-1.4-38)41.7(12.5-77.3)PREVIOUSOPERATIONAL' MEAN21.813.724.7(16.5-29.2)32.9(30-36.7)Cs-134Cs-137Ba-140La-1401-131'"Sr-90Fish:pG/kg(wet)Gamma<3.7(<0.9-<14)<3.8(<I-<12)<72.1(<6-<2000)<33.3(<5-1000)<0.5(<0.1-<I)AnalysisNotPerformed 0.72.20.2-0.40.71.9(-8.7-22.6)(-6.6-47.3)(A4.3-55)(-24.2-9.7)(A.8-143.6)(1.3-3.9)0.1(-6.5-3.4)1.1(-4.5-5.1)0.1(-8.7-8.2)44(-6.1-2.5)0.0(A.4-0.6)AnalysisNotPerformed Cs-134Cs-137Co-58Co-60Fe-59Mn-54Produce:pG/kg(wet)Gamma<61.2(<6-<130)<88.8(<10-<130)87.7(<9-<130)<80.6(<9-<130)<130(<30-<260)<88.3(<8-<130)1.8(-20.4-24)14.2(-35.1-57)0.5(-16.8-25.8)1.6(-18.4-21)0.2(-34.2-30)1.5(-20-30.9)-1.48.72.50.11.61.6(-6.7-6.4)(4.4-13.2)(0.4-4.3)(-6.3-4.6)(-1.6-7.2)(N.7-2.9)Cs-134Cs-1371-131<49.1(<10-<140)<69.8(<10-<140)<105.6(<10-<1000)0.6(-24.8-19.8)3(-9.8-20.9)-0.3(-26-59)0.4(-3.4-3.6)1.2(-1.7-2.4)4.1(-5.3-3)(a)Allstations, allyears.(b)Indicator stationsonlyforthoyears1984to1997.SomeofthedatameansandrangesarobiasedhighduotoChernobyl in1986.(c)Thodatausedforthesoaveragesdoesnotincludothelessthanvaluesreportedin1984.(d)Indicator stationsonly.(o)Resinmethod.5-171998REMPANNUALREPORT TABLE5-1(cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMCOMPARITIVE SUMIrIARY MEDIA/ANALYSISStormDrainVegetation":
pCi/kg(wet)GammaMn-54Co-60Zn-65Cs-134Cs-137PREOPERATIONALto MEANRANGEAnalysisNotPerformed MEANNGE11.9(-2-32.2)18.1(-3.7-48.2)25(-4.3-57.4)6.6(-6.5-45.8)24.7(-1.6-93.5)PREVIOUSOPERATIONAL' MEANRANGE2.2-3.826.8-14.8-1.2CoolingTowerSediment:
pCi/kg(dry)AnalysisNotPerformed AnalysisNotPerformed Mn-54Co-60Zn-65Cs-134Cs-1378.8(2.8-14.9)69.7(69.7-92.3)17(4.5-27.8)32.1(28-34.6)228.3(211-236.9)10.432.22.143.2228.1TLD:mR/dayQuarterly Annual0.24(0.17-0.31)0.24(0.20-0.29)0.25(0.16-0.35)0.24(0.18-0.34)0.24(0.20-0.31)0.22(0.19-0.28)(a)Allstations, allyears.(b)Indicator stationsonlyfortheyears1984to1997.SomeofthedatameansandrangesarebiasedhighduetoChernobyl in1986.(c)Thodatausedforthesoaverages doesnotincludethelessthanvaluesreportedin1984.(d)Indicator Stationsonly.(o)Routinosamplesfromthooutfallonly.1998REMPANNUALREPORT5-18 TABLE5-21998SAMPLEDEVIATIONS SAMPLEMEDIADATEAirParticulate/Iodine 02/0242/09 02/0942/17 04/2745/04 05/1145/18 05/1845/26 05/1845/26 05/2646/01 05/2646/01 07/2047-27 11/02-11/09 LOCATIONStation5Station5Station7Station57Station1Station48Station1Station48Station4Station48PROBLEMPoweroffforsubstation repair.Samplevolumeacceptable Poweroffforsubstation repair.Samplevolumeacceptable Unitfailure.Samplevolumeacceptable.
Unitfailure.Samplevolumeacceptable.
PoweroffduetoOutage.Samplevolumeunacceptable.
Unitfailure.Samplevolumeunacceptable.
Powerrestoredthisweek.Volumeacceptable.
Lateplacement infield.Samplevolumeacceptable.
Unitfailure.Samplevolumeunacceptable.
Unitfailure.Samplevolumeunacceptable.
WaterSoil,MilkR-13Outage08/1048/18 12/01-12/10 12/312QuarterStation27Station28Station28Station101Station96SamplerinTimedmodeforplantoutage.Sampleroutofserviceforrepair.Sampleshippedonschedule.
300Areawateroff.Nosamleduetowetweather.RamermanDairyquitsoperation.
Nosuitablereplacement found.Substitution ofbroadleaf vegetables andfeedfromStation9usedl5-191998REMPANNUALREPORT TABLE5-3RADIOLOICALENVIRONMENTAL MONITORING PROGRAMUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARYItoDECEMBER31,1998MediumorPathwaySamplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimitofAllIndicator Locations Detection~'ean (Ratio)"'D aneLocationWithHiestMeanNameMean(Ratio)+DistanceandDirection aneControlLocationMean(Ratio)"t aneNumberofNonroutine ReportedMeasurements AirParticulates (pCi/ms)GrossBeta624Gamma48(Quarterly) 0.0030.012(572/572)
(0.002%.043) 46.4191SSE0.013(52/52) 0.012(52/52) 0(0.004%.043)
(0.0034.029)
(0.0034.029)
AirIodine(pCi/m')Soil(pCi/kgdry)Be-7I-131624Gamma5Cs-137Ra-226Th-2280.010.098(44/44)
Air Iodine (pCi/m')Soil (pCi/kg dry)Be-7 I-131 624 Gamma 5 Cs-137 Ra-226 Th-228 0.01 0.098(44/44)
(0.061%.173)0.010.006(5/44)
(0.061%.173)0.01 0.006(5/44)
(0.001%.006) 0.01-(0/572)70014300(4/4)
(0.001%.006) 0.01-(0/572)700 14300(4/4)
(13400-16700)4080.6(4/4)
(13400-16700)40 80.6(4/4)(23.0-166) 400 862(4/4)(637-988)50 637(4/4)(457-867)40 6.4mi SE 0.111(4/4)
(23.0-166) 400862(4/4)(637-988) 50637(4/4)(457-867) 406.4miSE0.111(4/4)
(0.0764.173)4 6.4 mi SSE 0.006(1/4) 7 2.7 mi WNW 166(1/I)23 3.0 mi ESE 988(l/I)23 3.0 mi ESE 867(1/I)23 3.0 mi ESE 16700(1/1) 0.095(4/4)
(0.0764.173)46.4miSSE0.006(1/4) 72.7miWNW166(1/I)233.0miESE988(l/I)233.0miESE867(1/I)233.0miESE16700(1/1) 0.095(4/4)
(0.0684.148)
(0.0684.148)
-(0/4)-(0/52)12500(l/I) 78.8(1/I) 951(l/1)618(1/I)0meanofpositiveresultsabovetheLLDatNtratioofthoseresultstothenumberofsamplLLDs~tLUgggbeloggspeei fjg~tes.~fortheparameter ofinterest.
-(0/4)-(0/52)12500(l/I) 78.8(1/I)951(l/1)618(1/I)0 mean of positive results above theLLD atNt ratio of those results to the number of sampl LLDs~t LUgggbe loggspeei fjg~tes.~for the parameter of interest.
TABLE5-3(cont.)RADILOGICALENVIRONMENTAL MORINPRRAMUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARY1toDECEMBER31,1998MediumorPathway'amplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimitofAllIndicator Locations Detection+)
TABLE 5-3 (cont.)RADI LOGICAL ENVIRONMENTAL M ORIN PR RAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'ampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+)
Mean(Ratio)@aneLocationWithHiestMeanNameMean(Ratio)"'istance andDirection aneNumberofControlLocationNonroutineMean(Ratio)"'eported aneMeasurements.
Mean (Ratio)@an e Location With Hi est Mean Name Mean (Ratio)"'istance and Direction an e Number of Control Location Nonrou tine Mean (Ratio)"'eported an e Measurements.
Water(River/Drinking)
Water (River/Drinking)(pCi/liter)
(pCi/liter)
Gross Beta 36 4 1.66(21/24)
GrossBeta3641.66(21/24)
(0.40-2.4) 28 7.4 mi SSE 1.88(12/12)
(0.40-2.4) 287.4miSSE1.88(12/12)
(1.1-2.4)1.56(10/12)
(1.1-2.4) 1.56(10/12)
Tritium 12 Gamma 36 200 197(3/8)(140-250)28 7.4 mi SSE 197(3/4)(140-250)-(0/4)Water (Discharge)(pCi/liter)
Tritium12Gamma36200197(3/8)(140-250) 287.4miSSE197(3/4)(140-250)
Gross Beta 12 Tritium 4 Gamma 12 20-(0/24)12 9.44(12/12)
-(0/4)Water(Discharge)
(1.1-22)1050(3/4)(62-1600)27 3.2mi E 27 3.2mi E 9.44(12/12)
(pCi/liter)
(1.1-22)1050(3/4)(62-1600)-(0/12)-(0/0)-(0/0)Co%0 Cs-137 10-(0/12)10-(0/12)-(0/0)-(0/0)(a)'Ihe mean of positive results above theLLD and ratio of those results to the number of samples analyzed for the parameter of interest.(b)Contract LLDs.hctual LLDs may be lower for specific samples.
GrossBeta12Tritium4Gamma1220-(0/24)129.44(12/12)
TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORIN PROGRAM
(1.1-22)1050(3/4)
 
(62-1600) 273.2miE273.2miE9.44(12/12)
==SUMMARY==
(1.1-22)1050(3/4)
WASHINGTON PUBLIC POWER SUPPLY SYSTEM WN P-2 DOCKEI'O.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Water (Ground)(pCi/liter)
(62-1600)
Sediment (pCi/kg dry)Analysis and Total Number of Analyses Performed Tritium 12 Gamma 12 Gamma 4 Lower Limit of All Indicator Locati Detection~'ean (Ratio)"'LD an e 200-(0/12)-(0/12)ons Location With Hi hest Mean Name Mean (Ratio)t" Distance and Direction an e Control Location Mean (Ratio)t" an e-(0/0)-(0/0)Number of Nonroutine Reported Measurements Co%0 700 15800(2/2)
-(0/12)-(0/0)-(0/0)Co%0Cs-13710-(0/12)10-(0/12)-(0/0)-(0/0)(a)'IhemeanofpositiveresultsabovetheLLDandratioofthoseresultstothenumberofsamplesanalyzedfortheparameter ofinterest.
(14400-17200) 30 20.9(2/2)(20.3-21.6) 34 3.5 mi ESE 34 3.5 mi ESE 15800(2/2)
(b)ContractLLDs.hctualLLDsmaybelowerforspecificsamples.
(14400-17200) 20.9(2/2)(20.3-21.6) 14450(2/2)
TABLE5-3(cont.)RADIOLOGICAL ENVIRONMENTAL MONITORIN PROGRAMSUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKEI'O.
50-397HANFORDWASHINGTON JANUARYItoDECEMBER31,1998MediumorPathwaySamplednitofMeasurement Water(Ground)(pCi/liter)
Sediment(pCi/kgdry)AnalysisandTotalNumberofAnalysesPerformed Tritium12Gamma12Gamma4LowerLimitofAllIndicator LocatiDetection~'ean (Ratio)"'LD ane200-(0/12)-(0/12)onsLocationWithHihestMeanNameMean(Ratio)t" DistanceandDirection aneControlLocationMean(Ratio)t" ane-(0/0)-(0/0)NumberofNonroutine ReportedMeasurements Co%070015800(2/2)
(14400-17200) 3020.9(2/2)
(20.3-21.6) 343.5miESE343.5miESE15800(2/2)
(14400-17200) 20.9(2/2)
(20.3-21.6) 14450(2/2)
(14300-14600)
(14300-14600)
-(0/2)Cs-13740266(2/2)(194-337) 343.5miESE266(2/2)(194-337) 50.3(2/2)
-(0/2)Cs-137 40 266(2/2)(194-337)34 3.5 mi ESE 266(2/2)(194-337)50.3(2/2)(41.0-59.6)
(41.0-59.6)
Ra-226 Th-228 50 1058(2/2)(986-1130) 738(2/2)(722-754)33 3.6 mi ENE 33 3.6 mi ENE 1280(2/2)(660-1900) 1037(2/2)(523-1550) 1280(2/2)(660-1900) 1037(2/2)(523-1550) mean of positive results above theLLD and ratio of those results to the timber of sampl for the parameter of interea.LLD~I LL~be to~spec~tea.~
Ra-226Th-228501058(2/2)
TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PR GRAM MARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Fish (pCi/kg wet)hlilk (pCi/liter)
(986-1130) 738(2/2)(722-754) 333.6miENE333.6miENE1280(2/2)
Broadleaf In Lieu of hIilk (pCi/kg wet)Roots (pCi/kg wet)Fruits (pCi/kg wet)Vegetables (pCi/kg wet)Analysis and Total Number of Analyses Performed 1-131 57 Gamma 57 Gamma 5 Gamma 8 Gamma 9 Gamma 10 Lower Limit of All Indicator Locations Detection+'ean (Ratio)+LD an e 1000 3363(3/3)(2910-3620) 0.5 0.6(1/54)200 1341(54/54)
(660-1900) 1037(2/2)
(1120-2000) 200-(0/0)-(0/4)-(0/5)-(0/5)Location With Hi est ean Name Mean (Ratio)+Distance and Direction e 38 26.5 mi ESE 3747(3/3)(32204460) 64 9.7 mi ESE 0.6(1/54)96 36.0 IIB SW 1383(3/3)(1180-1490) 9G 30.0 mi WSW 5820(5/5)(3720-7760)
(523-1550) 1280(2/2)
Control Location Mean (Ratio)@att e 3747(3/3)(3220M60)-(0/3)1383(3/3)(1180-1490) 5820(5/5)(3720-7760)
(660-1900) 1037(2/2)
-(0/4)-(0/4)-(0/5)Number of Nonroutine Reported Measurements.
(523-1550) meanofpositiveresultsabovetheLLDandratioofthoseresultstothetimberofsamplfortheparameter ofinterea.LLD~ILL~beto~spec~tea.
'0 (a)'the mean of positive results above theLLD and ratio of those results to the number of samples analyzed for the parameter of interest.(b)Contract LLDs.Actual LLDs msy be lower for specific samples.
~
TABLE 5-3 (cont.)RADIOLOGICAL ENVIROIOIENTAL MONITORING PROGRAM
TABLE5-3(cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PRGRAMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARY1toDECEMBER31,1998MediumorPathwaySamplednitofMeasurement Fish(pCi/kgwet)hlilk(pCi/liter)
 
Broadleaf InLieuofhIilk(pCi/kgwet)Roots(pCi/kgwet)Fruits(pCi/kgwet)Vegetables (pCi/kgwet)AnalysisandTotalNumberofAnalysesPerformed 1-13157Gamma57Gamma5Gamma8Gamma9Gamma10LowerLimitofAllIndicator Locations Detection+'ean (Ratio)+LDane10003363(3/3)
==SUMMARY==
(2910-3620) 0.50.6(1/54) 2001341(54/54)
WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+'ean (Ratio)o'ane Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Number of Control Location Nonroutine Mean (Ratio)t" Reported an e Measurements
(1120-2000) 200-(0/0)-(0/4)-(0/5)-(0/5)LocationWithHiesteanNameMean(Ratio)+DistanceandDirection e3826.5miESE3747(3/3)
.Direct Radiation TLD Quarterly TLDs (mR/day)227 0.25(223/223)
(32204460) 649.7miESE0.6(1/54) 9636.0IIBSW1383(3/3)
(0.204.31) 46 5 88 NE 0.30(4/4)0.22(4/4)0 (0.27%.31)
(1180-1490) 9G30.0miWSW5820(5/5)
(3720-7760)
ControlLocationMean(Ratio)@atte3747(3/3)
(3220M60)
-(0/3)1383(3/3)
(1180-1490) 5820(5/5)
(3720-7760)
-(0/4)-(0/4)-(0/5)NumberofNonroutine ReportedMeasurements.
'0(a)'themeanofpositiveresultsabovetheLLDandratioofthoseresultstothenumberofsamplesanalyzedfortheparameter ofinterest.
(b)ContractLLDs.ActualLLDsmsybelowerforspecificsamples.
TABLE5-3(cont.)RADIOLOGICAL ENVIROIOIENTAL MONITORING PROGRAMSUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARY1toDECEMBER31,1998MediumorPathway'SamplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimitofAllIndicator Locations Detection+'ean (Ratio)o' aneLocationWithHiestMeanNameMean(Ratio)+DistanceandDirection aneNumberofControlLocationNonroutine Mean(Ratio)t" ReportedaneMeasurements
.DirectRadiation TLDQuarterly TLDs(mR/day)2270.25(223/223)
(0.204.31) 46588NE0.30(4/4) 0.22(4/4) 0(0.27%.31)
(0.214.23)
(0.214.23)
DirectRadiation AnnualTLDs(mR/day)ST119DirectRadiation TI.DQuarterly TLDs(mR/day)570.22(56/56)
Direct Radiation Annual TLDs (mR/day)ST119 Direct Radiation TI.D Quarterly TLDs (mR/day)57 0.22(56/56)
(0.194.28)0.25(4/4)
(0.194.28)0.25(4/4)(0.244.27) 46 Smi NE 119B 0.2mi S 0.28(1/I)0.25(4/4)(0.244.27) 0.20(1/I)0.24(4/4)(0.234.25)
(0.244.27) 46SmiNE119B0.2miS0.28(1/I) 0.25(4/4)
STI19 Direct Radiation TLD Annual TLDs (mR/day)ST120 Direct Radiation TLD Quarterly TLDs (mR/day)ST120 Direct Radiation TLD Annual TLDs (mR/day)0.23(l/I)0.25(4/4)0.23(l/1)119Cntrl 0.2 mi SSE 120 0.3 nu SSE 120 0.3 mi SSE 0.23(1/I)0.25(4/4)0.23(1/I)0.23(1/I)mean of positive results above theLLD and ratio of those results to the number of sarnpl for the parameter of interest.LDs~l LUQgbe lo~specifjggles.
(0.244.27) 0.20(1/I) 0.24(4/4)
(0.234.25)
STI19DirectRadiation TLDAnnualTLDs(mR/day)ST120DirectRadiation TLDQuarterly TLDs(mR/day)ST120DirectRadiation TLDAnnualTLDs(mR/day)0.23(l/I) 0.25(4/4) 0.23(l/1) 119Cntrl0.2miSSE1200.3nuSSE1200.3miSSE0.23(1/I) 0.25(4/4) 0.23(1/I) 0.23(1/I) meanofpositiveresultsabovetheLLDandratioofthoseresultstothenumberofsarnplfortheparameter ofinterest.
LDs~lLUQgbelo~specifjggles.
~
~
WMW-WWTABLE5-3(cont.)RDIGICALEONMEALMRWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2HANFORDWASHINGTON PROGRAMMARYDOCKETNO.50-397JANUARY1toDECEMBER31,1998MediumorPathwaySamplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimit&'I-"'Detection+
W M W-W W TABLE 5-3 (cont.)R DI GICAL E ONME AL M R WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 HANFORD WASHINGTON PROGRAM MARY DOCKET NO.50-397 JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit&'I-"'Detection+
Mean(Ratio)+etionWithHiestNameMean(Ratio)@DistanceandDirection eControlLocationMean(Ratio)@eNumberofNonroutine ReportedMeasurements
Mean (Ratio)+e tion With Hi est Name Mean (Ratio)@Distance and Direction e Control Location Mean (Ratio)@e Number of Nonroutine Reported Measurements
~StormDrainSedimentGamma2Station101-Outfall (pCi/kg)Mn-547004855(2/2)
~Storm Drain Sediment Gamma 2 Station 101-Outfall (pCi/kg)Mn-54 700 4855(2/2)(4490-5220) 40$0/2)101 0.3 mi ENE 4855(2/2)(4490-5220)
(4490-5220) 40$0/2)1010.3miENE4855(2/2)
-(0/0)$0/0)0 Co%0 30 205(2/2)(140-270)100 56.3(1/2)101 0.3 mi ENE 101 0.3 nn ENE 205(2/2)(140-270)56.3(1/2)-(0/0)-(0/0)Cs-137 Ra-226 Th-228 40 41.2(2/2)(38%4.4)400 826(2/2)(810-841)50 399(2/2)(363434)101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 41.2(2/2)(38.M.4)826(2/2)(810-841)399(2/2)(363-434)$0/0)-(0/0)-(0/0)(a)tbe mean of positive results above tbeLLD stat ratio of tbose results to tbe number of sampies analysett for tbe parameter of interest.(b)Contract ILDs.hctual I1Ds may be lower for specific samples.
(4490-5220)
TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL hiONITORING PROGRAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+
-(0/0)$0/0)0Co%030205(2/2)(140-270) 10056.3(1/2) 1010.3miENE1010.3nnENE205(2/2)(140-270) 56.3(1/2)
Mean (Ratio)t" LD an e Location With Hi hest Mean Name Mean (Ratio)" Distance and Direction an e Control Location Mean (Ratio)to an e Number of Nonroutine Reported Measurements.
-(0/0)-(0/0)Cs-137Ra-226Th-2284041.2(2/2)
Storm Drain Soil (pCi/kg)Be-7 136(6/6)(101-185)101 0.3 mi ENE 136(6/6)(101-185)-(0/0)700 15217(6/6)
(38%4.4)400826(2/2)(810-841) 50399(2/2)(363434)1010.3miENE1010.3miENE1010.3miENE41.2(2/2)
(14600-16200) 101 0.3 mi ENE 15217(6/6)
(38.M.4)826(2/2)(810-841) 399(2/2)(363-434)
-(0/0)(14600-16200) 0.Station 118 Soil (pCi/kg dty)Mn-54 Cs-137 Ra-226 Th-228 Gamma 1 Be-7 Ra-226 Th-228-(0/6)40 32.8(6/6)(29.9-36.7) 400 777(6/6)(677-885)50 467(6/6)(168-561)171(1/I)700 13100(1/1) 40 640(1/1)50 521(1/1)101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 118 0.3 mi SE 118 0.3 mi SE 118 0.3 mi SE 118 0.3 mi SE 32.8(6/6)(29.9-36.7) 777(6/6)(677-885)467(6/6)(168-561)171(1/I)13100(1/I) 640(1/1)521(1/1)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)0~mean of positive results above theLLD and ratio of those results to the number of sampl for the parameter of interest.LLD~at LL~be l~spec~ptas.
$0/0)-(0/0)-(0/0)(a)tbemeanofpositiveresultsabovetbeLLDstatratiooftboseresultstotbenumberofsampiesanalysett fortbeparameter ofinterest.
(b)ContractILDs.hctualI1Dsmaybelowerforspecificsamples.
TABLE5-3(cont.)RADIOLOGICAL ENVIRONMENTAL hiONITORING PROGRAMUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARYItoDECEMBER31,1998MediumorPathwaySamplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimitofAllIndicator Locations Detection+
Mean(Ratio)t" LDaneLocationWithHihestMeanNameMean(Ratio)"DistanceandDirection aneControlLocationMean(Ratio)to aneNumberofNonroutine ReportedMeasurements.
StormDrainSoil(pCi/kg)Be-7136(6/6)(101-185) 1010.3miENE136(6/6)(101-185)
-(0/0)70015217(6/6)
(14600-16200) 1010.3miENE15217(6/6)
-(0/0)(14600-16200) 0.Station118Soil(pCi/kgdty)Mn-54Cs-137Ra-226Th-228Gamma1Be-7Ra-226Th-228-(0/6)4032.8(6/6)
(29.9-36.7) 400777(6/6)(677-885) 50467(6/6)(168-561) 171(1/I)70013100(1/1) 40640(1/1)50521(1/1)1010.3miENE1010.3miENE1010.3miENE1180.3miSE1180.3miSE1180.3miSE1180.3miSE32.8(6/6)
(29.9-36.7) 777(6/6)(677-885) 467(6/6)(168-561) 171(1/I)13100(1/I) 640(1/1)521(1/1)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)0~meanofpositiveresultsabovetheLLDandratioofthoseresultstothenumberofsamplfortheparameter ofinterest.
LLD~atLL~bel~spec~ptas.
~
~
TABLE5-3(cont.)RADILILEAL0RGWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2HANFORDWASHINGTON PRORAMARYDOCKETNO.50-397JANUARY1toDECEMBER31,1998MediumorPathway'amplednitofMeasurement StormDrainVegetation (pCi/kgwet)AnalysisandTotalNumberofAnalysesPerformed Gamma1Be-7LowerLimitDetection+
TABLE 5-3 (cont.)RADI L I LE AL 0 R G WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 HANFORD WASHINGTON PRO RA MARY DOCKET NO.50-397 JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'ampled nit of Measurement Storm Drain Vegetation (pCi/kg wet)Analysis and Total Number of Analyses Performed Gamma 1 Be-7 Lower Limit Detection+
Mean(Ratio)@ane-(0/1)LocationW'thHiestNameMean(Ratio)@DistanceandDirection eControlLocationMean(Ratio)@e-(0/0)NumberofNonroutine ReportedMeasurements StormDrainWaterStation101(pCi/liter)
Mean (Ratio)@an e-(0/1)Location W'th Hi est Name Mean (Ratio)@Distance and Direction e Control Location Mean (Ratio)@e-(0/0)Number of Nonroutine Reported Measurements Storm Drain Water Station 101 (pCi/liter)
GrossBeta47Tritium46Gamma483020(1/1) 440(22/47)
Gross Beta 47 Tritium 46 Gamma 48 3020(1/1)4 40(22/47)(2.6-9.3)300 738(19/46)
(2.6-9.3) 300738(19/46)
(160-3700) 101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 3020(1/1)4.40(22/47)
(160-3700) 1010.3miENE1010.3miENE1010.3miENE3020(1/1) 4.40(22/47)
(2.6-9.3)738(19/46)
(2.6-9.3) 738(19/46)
(160-3700)
(160-3700)
-(0/0)-(0/0)-(0/0)0SanitaryWasteTreatment FacilityWater(pCi/1)Cs-137'Ih-228GrossAlpha16GrossBeta16Tritium32200-(0/48)10-(0/48)10-(0/48)-(0/16)131.2(16/16)
-(0/0)-(0/0)-(0/0)0 Sanitary Waste Treatment Facility Water (pCi/1)Cs-137'Ih-228 Gross Alpha 16 Gross Beta 16 Tritium 32 200-(0/48)10-(0/48)10-(0/48)-(0/16)1 31.2(16/16)
(1741)3003978(30/32)
(1741)300 3978(30/32)
(470-20000) 102C0.4miSSE102A0.4miSSE31.2(16/16)
(470-20000) 102C 0.4 mi SSE 102A 0.4 mi SSE 31.2(16/16)
(1741)8042(12/12)
(1741)8042(12/12)
(3800-20000)
(3800-20000)
$0/0)$0/0)$0/0)$0/0)-(0/0)$0/0)0(a)ihomeanofpositiveresultsabovethcILDandratioofthoseresultstothcnumberofsamplesanalyzedforthoparamctcr ofinterest.
$0/0)$0/0)$0/0)$0/0)-(0/0)$0/0)0 (a)iho mean of positive results above thcILD and ratio of those results to thc number of samples analyzed for tho paramctcr of interest.(b)Contract ILDs.hctual ILDs may bo lower for specific samples.
(b)ContractILDs.hctualILDsmaybolowerforspecificsamples.
TABLE 5-3 (cont.)RADIOLOGICAL ENVIROIAKNTAL MONITORIN PRO RAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of ll Indicator Locatio Detection"'ean (Ratio)'" LD all e ns Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Control Location Mean (Ratio)+an e Number of Nonroutine Reported Measurements
TABLE5-3(cont.)RADIOLOGICAL ENVIROIAKNTAL MONITORIN PRORAMUMMARYWASHINGTON PUBLICPOWERSUPPLYSYSTEMWNP-2DOCKETNO.50-397HANFORDWASHINGTON JANUARY1toDECEMBER31,1998MediumorPathwaySamplednitofMeasurement AnalysisandTotalNumberofAnalysesPerformed LowerLimitofllIndicator LocatioDetection"'ean (Ratio)'"
.Sanitary Waste Treatment Facility Water (pCi/1)(cont.)Gamma 32 300 56.8(l/22) 102A 0.4 mi SSE 56.8(1/22)
LDallensLocationWithHiestMeanNameMean(Ratio)+DistanceandDirection aneControlLocationMean(Ratio)+aneNumberofNonroutine ReportedMeasurements
-(0/0)Sanitary Waste Treatment Facility Sediment (pCi/kg)Gamma 3 Cs-137 700 10860(3/3)
.SanitaryWasteTreatment FacilityWater(pCi/1)(cont.)Gamma3230056.8(l/22) 102A0.4miSSE56.8(1/22)
(8980-13200) 30 1137(2/3)(164-2110) 40 74(3/3)(15.9-132) 102 0.4 mi SSE 1020.4 mi SSE 1020.4 mi SSE 10860(3/3)
-(0/0)SanitaryWasteTreatment FacilitySediment(pCi/kg)Gamma3Cs-13770010860(3/3)
(8980-13200) 1137(2/3)(164-2110) 74(3/3)(15.9-132)
(8980-13200) 301137(2/3)
-(0/0)-(0/0)-(0/0)Ra-226'Ih-228 400 1413(3/3)(1190-1540) 50 654(3/3)(448-967)1020.4 mi SSE 102 0.4 mi SSE 1413(3/3)(1190-1540) 654(3/3).(448-967)-(0/0)-(0/0)0 mean of positive results above theLLD and ratio of those results to the number of ssrnpl for the parameter of interest.LDsl L~be to~speci~tea.
(164-2110) 4074(3/3)(15.9-132) 1020.4miSSE1020.4miSSE1020.4miSSE10860(3/3)
(8980-13200) 1137(2/3)
(164-2110) 74(3/3)(15.9-132)
-(0/0)-(0/0)-(0/0)Ra-226'Ih-2284001413(3/3)
(1190-1540) 50654(3/3)(448-967) 1020.4miSSE1020.4miSSE1413(3/3)
(1190-1540) 654(3/3).
(448-967)
-(0/0)-(0/0)0meanofpositiveresultsabovetheLLDandratioofthoseresultstothenumberofssrnplfortheparameter ofinterest.
LDslL~beto~speci~tea.
~
~
TABLE5-4MEANQUARTERLY TLDDATASUhGVfARY FORTHEPREOPERATIONAL ANDOPERATIONAL PERIODSResultsinmR/dayPREOPERATIONAL 19&4-1997OPERATIONAL 1998OPERATIONAL STATIONMEAN"'TANDARD ERRORMEANSTANDARDERRORMEANSTANDARDERRORI234567891011121314151617181920212223242540414243444546474950510.240.230.220.220.230.220.230.260.220.230.240.250.240.240.250.240.250.240.240.240.230.240.240.240.250.220.260.250.250.230.230.290.220.240.220.230.020.020.010.020.010.010.010.010.020.010.010.010.010.020.010.010.010.010.010.010.010.010.010.010.010.010.020.010.010.010.010.020.020.000.000.010.250.250.240.220.230.230.240.270.230.240.240.260.250.250.260.250.250.250.250.250.230.250.240.250.260.230.260.260.260.240.240.300.230.250.250.240.010.000.000.010.000.000.000.010.000.000.000.010.000.000.010.000.010.010.000.000.000.000.000.000.010.000.010.010.010.000.000.010.010.000.010.000.250.240.230.210.220.220.240.250.220.230.230.250.240.230.250.240.250.240.25'.250.230.240.230.240.250.220.250.240.240.230.230.300.220.240.240.230.010.000.000.010.010.010.010.020.010.010.000.010.010.000.010.000.010.010.010.010.000.010.000.010.000.010.010.000.000.010.010.020.010.010.020.01(a)Thispreoperational meanisforthe1982-1983 dataonly.5-291998REMPANNUALREPORT TABLE5-4(cont.)MEANQUARTERLY TLDDATASUMMITRYFORTHEPREOPERATIONAL ANDOPERATIONAL PERIODSResultsinmR/dayPREOPERATIONAL 1984-1997OPERATIONAL 1998OPERATIONAL STATIONMEAN"STANDARDERRORMEAN'TANDARDERRORMEANSTANDARDERROR53545556616571(1S)72(2S)73(3S)74(4S)75(5S)76(6S)77(7S)78(8S)79(9S)80(10S)81(11S)82(12S)83(13S)84(14S)85(15S)86(16S)119B119Ctrl120East120West120CtrlAll0.270.260.230.24(h)(c)0.240.250.230.260.220.240.250.250.250.240.240.260.250.240.260.25(d)(d)(d)(d)(d)0.250.000.000.000.000.020.010.010.010.02,0.010.010.010.010.010.020.020.010.010.020.010.000.270.260.240.250.270.240.280.270.240.270.250.250.250.250.250.240.250.250.260.250.260.280.260.260.270.280.25O.~d0.010.000.000.010.010.010.010.010.000.010.010.010.000.000.000.000.000.000.010.010.010.010.010.010.020.040.010.010.250.240.240.24(h)0.230.280.270.230.250.240.240.240.230.240.230.230.250.240.250.250.270.250.240.25(d)(d)0.250.010.010.000.010.010.020.010.010.010.010.010.010.010.010.010.010.010.000.010.010.020.010.010.010.01(a)Thispreoperational meanisfor1982-1983 dataonly(b)Station61wasaddedin1989anddiscontinued m199'c)Station65addedin1997.(d)Stations119B,119Ctrl,120East,120Westandl20Ctrladded>nl995.Stations120Wcstand120Ctrldiscontinued in1997.1998REMPANNUALREPORT5-30 TABLE5-5ANNUALTLDDATASUhQVIARY FORTHEPREOPERATIONAL ANDOPERATIONAL PERIODSResultsinmR/daySTATIONPREOPERATIONAL 1984-1997OPERATIONAL MEAN"STANDARDERRORMEANSTANDARDERROR1998OPERATIONAL RESULT12345678910111213141516171819202124254041424344454647490.250.230.230.240.240.220.230.260.220.230.240.260.240.230.250.250.240.250.24>>0.240.220.240.230.240.250.21>>0.260.24>>0.24>>0.240.230.29022>>(c)0.040.000.010.070.030.010.010.010.010.010.010.000.010.000.030.010.020.030.010.010.010.010.010.010.010.020.010.010.240.230.220.210.220.220.230.260.210.220.230.250.230.230.250.240.240.240.240.240.220.230.230.240.250.220.250.240.250.230.230.290.220.230.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.220.220.210.190.190.200.210.240.200.220.220.240.220.220.230.230.230.240.240.230.200.230.210.220.220.200.220.220.200.200.220.280.210.22(a)Thisprcopcrational meanisfor1982-1983dataonly.(b)Thcrowasonlyonoannualexchangeduringthopreoperational period.(c)Stations49-56werefirstmonitored duringFourthQuarter1983.(d)TLDmissing.5-311998REMPANNUALREPORT TABLE5-5(cont.)ANNUALTLDDATASUhQVlARY FORTHEPREOPERATIONAL ANDOPERATIONAL PERIODSResultsinmR/dayPREOPERATIONAL 1984-1997OPERATIONAL STATIONMEAN"STANDARDERRORMEANSTANDARDERROR1998OPERATIONAL RESULT5051535455566171(1$)72(2S)73(3S)74(4S)75(SS)76(6S)77(7S)78(8S)79(9S)80(IOS)81(IIS)82(12S)83(13S)84(14S)85(ISS)86(16S)119B119Ctrl120East120West120CtrlAll(c)(c)(c)(c)(c)(c)(c)O.24>>P25>>0.23>>O.24>>0.24>>O.24>>O.25>>0.25>>P25>>0.23>>P23>>P25>>0.25>P23>>0.25">0.24>>0.240.000.230.230.260.250.230.24O.26>>0.270.260.230.250.240.240.240.230.240.230.230.240.250.240.250.270.280.280.300.330.290.240.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.010.030.010.020.000.230.220.240.230.210.22(d)0.250.250.220.240.220.220.220.220.220.230.220.220.230.230.240.260.220.230.23(e)(e)0.22(a)Thispreoperational meanisfor1982-1983dataonly.(b)Therewasonlyoneannualexchangeduringthepreoperational period.(c)Stations49-56werefirstmonitored duringFourthQuarter1983.Station61wasaddedin1989.(d)Station61discontinued onJune29,1992(e)Stations120Westand120Ctrlwerediscontinued in19971998REMPANNUALREPORT,5-32 TABLE5-61998MEANQUARTERLY VERSUSANNUALTLDDATAResultsinmR/day1984-97TLDsQUARTERLY ANNUALSTATIONMEAN"'EAN QUARTERLY MEAN'"1998TLDsANNUALRESULTSI2345678910111213141516171&19202122232425404142434445464749500.250.250.240.220.230.230.240.270.230.240.240.260.250.250.260.250.250.250.250.250.230.250.240.250.260.230.260.260.260.240.250.300.230.250.250.240.230.220.210.220.220.230.260.210.220.230.250.230.230.250.240.240.240.230.240.220.230.230.240.250.220.250.240.250.230.230.290.220.230.231.051.051.071.061.071.061.051.031.061.071.061.061.061.071.051.061.041.051.061.051.061.061.061.061.051.071.061.071.061.061.071.041.051.061.070.250.240.230.210.220.220.240.250.220.230.230.250.240.230.250.240.250.240.250.250.230.240.230.240.250.220.250.240.240.230.230.300.220.240.240.220.220.210.190.190.200.210.240.200.220.220.240.220.220.230.230.230.240.240.230.200.230.210.220.220.200.220.220.200.200.220.280.210.220.231.121.101.091.091.111.121.151.031.081.081.061.051.071.091.091.071.121.031.041.061.131.041.121.121.121.101.101.101.221.161.081.051.051.071.05(a)Meanofthequarterly results.(b)Quarterly result/Annual result(c)TLDmissing5-33"1998REMPANNUALREPORT TABLE5-6(cont.)1998MEANQUARTERLY VERSUSANNUALTLDDATAResultsinmR/day1984-97TLDsQUARTERLY ANNUALSTATIONMEAN"MEANRATIO"'998 TLDsQUARTERLY ANNUALMEAN"RESULTSRATIO~'15354555661<<65<<71(IS)72(2S)73(3S)74(4S)75(SS)76(6S)77(7S)78(8S)79(9S)80(IOS)81(IIS)82(12S)83(13S)84(14S)85(15S)86(16S)I19B119Ctrl120East120West120CtrlALL0.240.270.260.240.250.270.250.280.270.240.270.250.250.250.250.250.240.250.250.26"0.250.270.280.260.260.280.280.250.250.230.260.250.230.240.260.240.270.260.230.250.240.240.240.230.230.230.230.240.250.240.250.270.280.280.300.330.290.241.061.051.051.061.051.061.041.051.041.071.061.061.051.061.051.071.061.061.041.05.1.061.051.040.930.950.930.860.861.040.230.280.270.230.250.240.240.240.230.240.230.230.250.240.250.250.270.250.240.25(e)(c)0.240.220.250.250.220.240.220.220.220.220.220.230.220.220.230.230.240.260.220.230.23(e)(e)0.221.041.111.101.051.051.081.111.091.071.091.001.091.151.081.131.051.04'.141.071.081.090.230.221.070.250.241.070.240.231.080.240.211.150.240.221.08(a)Meanofthequarterly results.(b)Quarterly result/Annual result.(c)Station61wasaddedin1989anddiscontinued in1992.(d)Station65addedin1997.(e)Stationsdiscontinued in1997.1998REMPANNUALREPORT5-34  
TABLE 5-4 MEAN QUARTERLY TLD DATA SUhGVfARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 19&4-1997 OPERATIONAL 1998 OPERATIONAL STATION MEAN"'TANDARD ERROR MEAN STANDARD ERROR MEAN STANDARD ERROR I 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 40 41 42 43 44 45 46 47 49 50 51 0.24 0.23 0.22 0.22 0.23 0.22 0.23 0.26 0.22 0.23 0.24 0.25 0.24 0.24 0.25 0.24 0.25 0.24 0.24 0.24 0.23 0.24 0.24 0.24 0.25 0.22 0.26 0.25 0.25 0.23 0.23 0.29 0.22 0.24 0.22 0.23 0.02 0.02 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.02 0.00 0.00 0.01 0.25 0.25 0.24 0.22 0.23 0.23 0.24 0.27 0.23 0.24 0.24 0.26 0.25 0.25 0.26 0.25 0.25 0.25 0.25 0.25 0.23 0.25 0.24 0.25 0.26 0.23 0.26 0.26 0.26 0.24 0.24 0.30 0.23 0.25 0.25 0.24 0.01 0.00 0.00 0.01 0.00 0.00 0.00 0.01 0.00 0.00 0.00 0.01 0.00 0.00 0.01 0.00 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.00 0.01 0.01 0.01 0.00 0.00 0.01 0.01 0.00 0.01 0.00 0.25 0.24 0.23 0.21 0.22 0.22 0.24 0.25 0.22 0.23 0.23 0.25 0.24 0.23 0.25 0.24 0.25 0.24 0.25'.25 0.23 0.24 0.23 0.24 0.25 0.22 0.25 0.24 0.24 0.23 0.23 0.30 0.22 0.24 0.24 0.23 0.01 0.00 0.00 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.00 0.01 0.01 0.00 0.01 0.00 0.01 0.01 0.01 0.01 0.00 0.01 0.00 0.01 0.00 0.01 0.01 0.00 0.00 0.01 0.01 0.02 0.01 0.01 0.02 0.01 (a)This preoperational mean is for the 1982-1983 data only.5-29 1998 REMP ANNUAL REPORT TABLE 5-4 (cont.)MEAN QUARTERLY TLD DATA SUMMITRY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 1984-1997 OPERATIONAL 1998 OPERATIONAL STATION MEAN" STANDARD ERROR MEAN'TANDARD ERROR MEAN STANDARD ERROR 53 54 55 56 61 65 71(1S)72(2S)73(3S)74(4S)75(5S)76(6S)77(7S)78(8S)79(9S)80(10S)81(11S)82(12S)83(13S)84(14S)85(15S)86(16S)119B 119Ctrl 120 East 120West 120 Ctrl All 0.27 0.26 0.23 0.24 (h)(c)0.24 0.25 0.23 0.26 0.22 0.24 0.25 0.25 0.25 0.24 0.24 0.26 0.25 0.24 0.26 0.25 (d)(d)(d)(d)(d)0.25 0.00 0.00 0.00 0.00 0.02 0.01 0.01 0.01 0.02, 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.01 0.01 0.02 0.01 0.00 0.27 0.26 0.24 0.25 0.27 0.24 0.28 0.27 0.24 0.27 0.25 0.25 0.25 0.25 0.25 0.24 0.25 0.25 0.26 0.25 0.26 0.28 0.26 0.26 0.27 0.28 0.25 O.~d 0.01 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.04 0.01 0.01 0.25 0.24 0.24 0.24 (h)0.23 0.28 0.27 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.25 0.24 0.25 0.25 0.27 0.25 0.24 0.25 (d)(d)0.25 0.01 0.01 0.00 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.01 0.02 0.01 0.01 0.01 0.01 (a)This preoperational mean is for 1982-1983 data only (b)Station 61 was added in 1989 and discontinued m 199'c)Station 65 added in 1997.(d)Stations 119B, 119Ctrl, 120East, 120West and l20Ctrl added>n l995.Stations 120Wcst and 120Ctrl discontinued in 1997.1998 REMP ANNUAL REPORT 5-30 TABLE 5-5 ANNUAL TLD DATA SUhQVIARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day STATION PREOPERATIONAL 1984-1997 OPERATIONAL MEAN" STANDARD ERROR MEAN STANDARD ERROR 1998 OPERATIONAL RESULT 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 24 25 40 41 42 43 44 45 46 47 49 0.25 0.23 0.23 0.24 0.24 0.22 0.23 0.26 0.22 0.23 0.24 0.26 0.24 0.23 0.25 0.25 0.24 0.25 0.24>>0.24 0.22 0.24 0.23 0.24 0.25 0.21>>0.26 0.24>>0.24>>0.24 0.23 0.29 0 22>>(c)0.04 0.00 0.01 0.07 0.03 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.00 0.03 0.01 0.02 0.03 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.24 0.23 0.22 0.21 0.22 0.22 0.23 0.26 0.21 0.22 0.23 0.25 0.23 0.23 0.25 0.24 0.24 0.24 0.24 0.24 0.22 0.23 0.23 0.24 0.25 0.22 0.25 0.24 0.25 0.23 0.23 0.29 0.22 0.23 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.22 0.22 0.21 0.19 0.19 0.20 0.21 0.24 0.20 0.22 0.22 0.24 0.22 0.22 0.23 0.23 0.23 0.24 0.24 0.23 0.20 0.23 0.21 0.22 0.22 0.20 0.22 0.22 0.20 0.20 0.22 0.28 0.21 0.22 (a)This prcopcrational mean is for 1982-1983 data only.(b)Thcro was only ono annual exchange during tho preoperational period.(c)Stations 49-56 were first monitored during Fourth Quarter 1983.(d)TLD missing.5-31 1998 REMP ANNUAL REPORT TABLE 5-5 (cont.)ANNUAL TLD DATA SUhQVlARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 1984-1997 OPERATIONAL STATION MEAN" STANDARD ERROR MEAN STANDARD ERROR 1998 OPERATIONAL RESULT 50 51 53 54 55 56 61 71 (1$)72 (2S)73 (3S)74 (4S)75(SS)76(6S)77 (7S)78 (8S)79 (9S)80 (IOS)81 (I IS)82 (12S)83 (13S)84 (14S)85 (ISS)86 (16S)119B 119Ctrl 120East 120 West 120 Ctrl All (c)(c)(c)(c)(c)(c)(c)O.24>>P 25>>0.23>>O.24>>0.24>>O.24>>O.25>>0.25>>P 25>>0.23>>P 23>>P 25>>0.25>P 23>>0.25">0.24>>0.24 0.00 0.23 0.23 0.26 0.25 0.23 0.24 O.26>>0.27 0.26 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.24 0.25 0.24 0.25 0.27 0.28 0.28 0.30 0.33 0.29 0.24 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.03 0.01 0.02 0.00 0.23 0.22 0.24 0.23 0.21 0.22 (d)0.25 0.25 0.22 0.24 0.22 0.22 0.22 0.22 0.22 0.23 0.22 0.22 0.23 0.23 0.24 0.26 0.22 0.23 0.23 (e)(e)0.22 (a)This preoperational mean is for 1982-1983 data only.(b)There was only one annual exchange during the preoperational period.(c)Stations 49-56 were first monitored during Fourth Quarter 1983.Station 61 was added in 1989.(d)Station 61 discontinued on June 29, 1992 (e)Stations 120West and 120Ctrl were discontinued in 1997 1998 REMP ANNUAL REPORT ,5-32 TABLE 5-6 1998 MEAN QUARTERLY VERSUS ANNUAL TLD DATA Results in mR/day 1984-97 TLDs QUARTERLY ANNUAL STATION MEAN"'EAN QUARTERLY MEAN'" 1998 TLDs ANNUAL RESULTS I 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1&19 20 21 22 23 24 25 40 41 42 43 44 45 46 47 49 50 0.25 0.25 0.24 0.22 0.23 0.23 0.24 0.27 0.23 0.24 0.24 0.26 0.25 0.25 0.26 0.25 0.25 0.25 0.25 0.25 0.23 0.25 0.24 0.25 0.26 0.23 0.26 0.26 0.26 0.24 0.25 0.30 0.23 0.25 0.25 0.24 0.23 0.22 0.21 0.22 0.22 0.23 0.26 0.21 0.22 0.23 0.25 0.23 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.22 0.23 0.23 0.24 0.25 0.22 0.25 0.24 0.25 0.23 0.23 0.29 0.22 0.23 0.23 1.05 1.05 1.07 1.06 1.07 1.06 1.05 1.03 1.06 1.07 1.06 1.06 1.06 1.07 1.05 1.06 1.04 1.05 1.06 1.05 1.06 1.06 1.06 1.06 1.05 1.07 1.06 1.07 1.06 1.06 1.07 1.04 1.05 1.06 1.07 0.25 0.24 0.23 0.21 0.22 0.22 0.24 0.25 0.22 0.23 0.23 0.25 0.24 0.23 0.25 0.24 0.25 0.24 0.25 0.25 0.23 0.24 0.23 0.24 0.25 0.22 0.25 0.24 0.24 0.23 0.23 0.30 0.22 0.24 0.24 0.22 0.22 0.21 0.19 0.19 0.20 0.21 0.24 0.20 0.22 0.22 0.24 0.22 0.22 0.23 0.23 0.23 0.24 0.24 0.23 0.20 0.23 0.21 0.22 0.22 0.20 0.22 0.22 0.20 0.20 0.22 0.28 0.21 0.22 0.23 1.12 1.10 1.09 1.09 1.11 1.12 1.15 1.03 1.08 1.08 1.06 1.05 1.07 1.09 1.09 1.07 1.12 1.03 1.04 1.06 1.13 1.04 1.12 1.12 1.12 1.10 1.10 1.10 1.22 1.16 1.08 1.05 1.05 1.07 1.05 (a)Mean of the quarterly results.(b)Quarterly result/Annual result (c)TLD missing 5-33" 1998 REMP ANNUAL REPORT TABLE 5-6 (cont.)1998 MEAN QUARTERLY VERSUS ANNUAL TLD DATA Results in mR/day 1984-97 TLDs QUARTERLY ANNUAL STATION MEAN" MEAN RATIO"'998 TLDs QUARTERLY ANNUAL MEAN" RESULTS RATIO~'1 53 54 55 56 61<<65<<71 (IS)72 (2S)73 (3S)74 (4S)75 (SS)76 (6S)77 (7S)78 (8S)79 (9S)80 (IOS)81 (I IS)82 (12S)83 (13S)84 (14S)85 (15S)86 (16S)I 19B 119 Ctrl 120East 120 West 120Ctrl ALL 0.24 0.27 0.26 0.24 0.25 0.27 0.25 0.28 0.27 0.24 0.27 0.25 0.25 0.25 0.25 0.25 0.24 0.25 0.25 0.26" 0.25 0.27 0.28 0.26 0.26 0.28 0.28 0.25 0.25 0.23 0.26 0.25 0.23 0.24 0.26 0.24 0.27 0.26 0.23 0.25 0.24 0.24 0.24 0.23 0.23 0.23 0.23 0.24 0.25 0.24 0.25 0.27 0.28 0.28 0.30 0.33 0.29 0.24 1.06 1.05 1.05 1.06 1.05 1.06 1.04 1.05 1.04 1.07 1.06 1.06 1.05 1.06 1.05 1.07 1.06 1.06 1.04 1.05.1.06 1.05 1.04 0.93 0.95 0.93 0.86 0.86 1.04 0.23 0.28 0.27 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.25 0.24 0.25 0.25 0.27 0.25 0.24 0.25 (e)(c)0.24 0.22 0.25 0.25 0.22 0.24 0.22 0.22 0.22 0.22 0.22 0.23 0.22 0.22 0.23 0.23 0.24 0.26 0.22 0.23 0.23 (e)(e)0.22 1.04 1.11 1.10 1.05 1.05 1.08 1.11 1.09 1.07 1.09 1.00 1.09 1.15 1.08 1.13 1.05 1.04'.14 1.07 1.08 1.09 0.23 0.22 1.07 0.25 0.24 1.07 0.24 0.23 1.08 0.24 0.21 1.15 0.24 0.22 1.08 (a)Mean of the quarterly results.(b)Quarterly result/Annual result.(c)Station 61 was added in 1989 and discontinued in 1992.(d)Station 65 added in 1997.(e)Stations discontinued in 1997.1998 REMP ANNUAL REPORT 5-34 6.0 UALITY ASSURANCE AND UALITY CONTROL The REMP is designed to meet the quality assurance and quality control criteria of Regulatory Guide 4.15"'.To accomplish this, the REMP requires that its analytical contractors meet these criteria also.In<epth audits are performed of the REMP records and activities and the records and activities of its support organizations at least annually by the Supply System Quality Assurance group.Quality assurance and technical audits of the analytical contractor (Teledyne Brown Engineering) are also conducted periodically to verify their compliance to regulatory and contractual requirements.
The adequacy of their quality assurance program is also assessed during the audits.Intercomparison programs, which involve the comparison of Supply System analytical melts of samples containing known concentrations of various radionuclides, to the known values and also with the icsults reported by other monitoring programs, are a major component of the quality assurance activities of the REMP.The program participates in the Environmental Protection Agency (EPA)and Environmental Measurements Laboratoiy (EML)inteicomparison programs.It also participates in local and regional intercomparison studies.The following sections summarize the quality assurance and quality control aspects of the TLD and analytical components of the REIMP.6.1 Quality Control For the Supply System Environmental TLD Program The Quality Control Program includes the pieparation, processing and evaluation of environmental TLDs.To begin with, all environmental TLDs, including controls, which are to be used in the same quarter (or year for annuals), are annealed at the same time.This allows for uniform accumulation of and cornxtion for background radiation.
From the time the TLDs an: annealed to the time they are placed in the field, they are stool and transported together.Once the field TLDs are collected, they are again stored together with the controls until processed.
Reader QC dosimeters aa: prepared by the TLD processor and serve as indicators that the invader calibration is satisfactory and that the TLDs were pmcessed correctly.
These TLDs are annealed just prior to being given a known exposure (typically 100 mR)to'"Cs and processed among the field dosimeters.
The number of QA dosimeters used during each pmcessing is generally 10%of the number of field dosimeters.
If the mean icader QC dosimeter results vary by more than+5%from the given exposure, the processor is contacted and an investigation into the source of the disciepancy is initiated.
Evaluation of the 1998 reader QC dosimeter results indicated satisfactory agnmment for all four quarters and the annual processing results.Control dosimeters (trip controls)are used for each set of field dosimeters to monitor the contribution of the exposure received by the field TLDs while in transit.The radiation background in the storage area is also monitor by a separate set of control dosimeters (building controls).
If the trip control results are greater tlian the building control results, the difference between the two is subtracted fiom the field dosimeters.
6-1 1998 REMP ANNUAL REPORT Spiked dosimeters, which are exposed by the Supply System, are irradiated 25 mR cesium-137 for quarterly dosimeters or 85 mR for annual dosimeters.
These spiked dosimeters aa: also processed with the field dosimeters during each run to verify the accuracy and consistency of the environmental TLD evaluations.
All results were within,J5%
of the known exposure and aie piovided in Table 6-1.Extra sets of control dosimeters, known as zero dose dosimeters, are also included with the field dosimeters for processing.
These zero dose TLDs are stored in a shielded container throughout the quarter (or year for annuals)and are used as an additional indication of reader performance.
These TLDs may also be used as substitutes if a field TLD is lost.6.2 Quality Control For the Analytical Program Quality control for the analytical program involves two components:
the quality contml activities performed by the Supply System and the quality control program of the analytical contractor, Teledyne Brown Engineering.
Both of these components are described in the following sections.6.2.1 Supply System Quality Control Activities The Supply System has participated in the U.S.Department of Energy's Environmental Measurements Laboratory (EML)Quality Assessment Program since 1987.In general, the Teledyne Brown icsults ayeed with the EML values as seen in Table 6-2.All results were either acceptable or acceptable with warning.Duplicate samples were submitted to Teledyne Brown for analysis during 1998.These duplicates consisted of two sets of milk samples and one set of air filters from EML.The milk duplicates were marked Station 37 and were submitted for analysis at the same time as the milk samples fiom Station 36.6.2.2 Teledyne Brown Engineering Quality Control Program The goal of the quality control program at Teledyne Brown Engineering
-Envimnmental Services is to pioduce analytical icsults which are accurate, precise and supported by adequate documentation.
The program is based on the requirements of 10CFR50, Appendix B, Nuclear Regulatory Guide 4.15 and the program, as described in Teledyne's Quality Assurance Manual (IWI 0032-395)and Quality Control Manual (IWL-0032-365).
All measuring equipment is calibrated for efficiency at least annually using standi reference material traceable to the National Institute of Standards and Technology (NIST).For alpha and beta counting, check sources are prepared and counted each weekday the counter is in use.Control charts aic maintained with thine-sigma limits specified.
Backgiounds are usually measured at least once per week."'998 REMP ANNUAL REPORT 6-2 The gamma spectrometers are calibrated annually with a NIST-traceable standard reference material selected to cover the energy range of the nuclides to be monitor for all of the geometries measured.Backgrounds are determined every other week and check sources are counted weekly.The energy resolution and efficiency an: plotted at two energy levels (59.5 and 1332 KeV)and held within three-sigma control limits."'he efficiency of the liquid scintillation counters is determined at least annuaHy by counting NIST traceable standards which have been diluted in a known amount of distilled water and various amounts of quenching agent."'he background of each counter is measured with each batch of samples.A control chart is maintained for the background and check source measurements as a stability check.Results are reviewed before being entered into the data system by the Quality Assurance and/or the Department Manager for reasonableness of the parameters (background, efficiency, decay, etc.).Any results that are suspect, being higher or lower than results in the past, are returned to the laboratory for recount.If a longer count, decay check, recount on another system or recalculation does not give acceptable icsults based on experience, a new aliquot is analyzed.The complete information about the sample is contained on the worksheets accompanying the sample results.Teledyne Brown also participates in the US EPA Interlaboratory Comparison Pa)gram to the fullest extent possible.That is, they participate in the program for all radioactive isotopes prepared and at the maximum&cquency of availability.
Beginning with 1996, the US EPA discontinued providing milk and air particulate filter samples.Teledyne purchased comparable spiked samples from Analytics, Inc.Tables 6-3 and 6-4 present the Teledyne Brown quality control data icsults for blanks and spikes, respectively.
Table 6-5 pments the results of the 1998 EPA Intercomparison as icported to the Supply System.Footnotes in the table refer to investigations of problems encountered in a few cases and the steps taken by Teledyne Brown to prevent esurience.
Table 6-6 presents the Analytics Cross Check Comparison results for 1998.No deviations from written procedures occurred during 1998.A summary of the quality control blank and spiked sample results follow.Iodine-131 Cartridges A blank charcoal filter was analyzed with each group of samples assayed.Fifty-two blanks were analyzed in 1998.The average activity was-1.8 J 10.0 E-01 total pCi.Activities were calculated without considering detection limits.Gross-Beta
-Filters One blank filter was measured with each set of filters assayed.Fifty-two blanks were counted for 1998.The average activity 1.0 J 0.2 E+00 total pCi, which indicated a relatively stable background for the filter and the gross beta proportional counters.6-3 1998 REMP ANNUAL REPORT I-131-Milk A blank milk was analyzed with each youp of samples assayed.The msults showed that there was no contamination in the laboratory or counting area.The measurements of the blank samples indicated that there was no bias on the low background counters.The average activity for eighteen samples in 1998 was-1.3 J 9.8 E-02 pCi/liter without considering detection limits.In addition ten blanks were analyzed as part of the Teledyne Brown Engineering
-Environmental Services'uality control program.The average result for 1998 was 5.3+15 E-01 pCi/liter.
Sr-90-Milk and Water Eleven blank water samples were analyzed during 1998.The average result, without considering the detection limits, was 1.2+1.9 E-01 pCi/liter.
Eleven spiked water samples were analyzed during 1998, The average value of the samples was 3.4 J 0.4 E+01 pCi/1 compared with a spike level of 3.5 J 0.6 E+01 pCi/1.During 1998, a total of ten spiked milk samples were analyzed.The average value of the samples was 3.2+0.9 E+01 pCi/1 compared with a spike value of 3.5 J 0.6 E+01 pCi/l.These results were within the limits as specified by the EPA Intercomparison Studies Program.Ten blank milk samples were analyzed with an average activity of 6.6 J 2.9 E-01 pCi/1 of Sr-90, which is the natural content of milk.Gross Beta-Water Eleven blanks were prepared from distilled water.The average result without considering detection limits for 1998 was 1.3 J 3.7 E-01 pCi/1.Eleven gross beta samples with a spike level of 2.2+0.7 E+01 pCi/1 were analyzed during 1998.The average zesult was 2.1+0.3 E+01 pCi/1.The msults were well within the guidelines outlined in Table 2,of the document,"Environmental Radioactivity Laboratory Intercomparison Studies Program," EPA-600/4-81-004.
Tritium in Water Thirteen blank samples were analyzed during 1998.The average result, without considering detection levels, was 1.0 J 6.9 E+01 pCi/I.Thirty:n tritium samples with a spike level of 1.7 J 0.5 E+03 pCi/1 were analyzed by liquid scintillation counting during 1998.The average result was 1.5+0.2 E+03 pCi/I.Gamma Spectroscopy A blank water sample was analyzed weekly in the garrrma spectroscopy laboratory.
All nuclides were less than the normal level of detection indicating no contamination.
Spike samples were measured weekly using the Cs-137 peak at 662 KcV.The average activity of eleven measurements during 1998 was 2.2+0.05 E+04 pCi/1 as comparLd with a spike level of 2.0+0.3 E+04 pCi/l.1998 REMP ANNUAL REPORT 6-4 TABLE 6-1 1998 ENVIRONMENTAL SPIKED DOSIMETER RESULTS DISTRIBUTION PERIOD GIVEN EXPOSURE mR REPORTED EXPOSURE mR BIAS First Quarter Second Quarter Third Quarter Fourth Quarter 24.0 25.0 25.0 25.0 85.0 23.1 23.2 23.4 24.3 25.1 24.5 23.8 24.5 24.4 25.1 24,2 24.0 80.6 80.4 80.1-3.8 303-2.5-2.8+4.0-2.0-4.8-2.0-2.4+0.2 303-4.1-5.2-5.4-5.8 6-5 1998 REMP ANNUAL REPORT TABLE 6-2 1998 ENVIRONMENTAL MEASUREMENTS LABORATORY (EML)QUALITY ASSESSMENT PROGRAM RESULTS SAMPLE REPORTED EML EML RATIO DATE TYPE" NUCLIDE RESULT ERROR VALUE ERROR REPORTED/EML 06/98 Air Mn-54 (Bq/filter)
Co%0 Sb-125 Cs-137 Gr-p Ce-144 06/98 Soil K-40 (Bq/kg)Sr-90 Cs-137 5.81E+00 8.71E+00 1.28E+01 1.22E+01 2.11E+00 7.36E+00 3.89E+02 1.30E+01 3.92E+02 2.5E-01 3.3E%1 6.3E+1 3.3EAI 7.4E%2 5.7E<1 1.4E+01 2.2E+00 3.4E+00 SA4E+00 9.09E+00 1.22E+01 1.19E+01 1.96E+00 8.21E+00 3.14E+02 1.31E+01 3.30E+02 4.9E%1 7.3EZl 1.2E%1 9.6E%1 3.0E41 8.0EAl 1.0E+01 2.8EAl 9.3E+00 1.07 0.96 1.05 1.03 1.08 0.90 1.24 0.99 1.19 06/98 Vegetation K-40 8.38E+02 2.2E+01 7.07E+02 2.5E+01 1.18 (Bq/kg)Co-60 1.33E+01 1.2E+00 1.06E+01 2.1E%1 1.26 Cs-137 2.23E+02 3.0E+00 1.82E+02 7.1E+00 1.23 06/98 Water H-3 (Bq/l)Mn-54 Co-60 Cs-137 Gr-tx Gr-3.40E+02 5.61E+01 1.36E+01 4.72E+01 L40E+03 5.3E+01+i 4.8E+01 1.3E+00 8.0E%1 1.2E+00 1.1E+02 2.0E+00 2.18E+02 5.70E+01 1.36E+01 4.60E+01 1.42E+03 2.20E+03 6.5E+00 1.9E+00 1.2E+00 1.7E+00 1.0E+02 1.0E+02 1.56 0.98 1.00 1.03 0.99 0.02 Bq=becquerel; the EML results are reported in becquerel instead of picocuries.
One picocurie equals 0.037 becquerel Supply System result was entered wrong on EML database.Result should have been 1.96E+03 Bq/l.1998 REMP ANNUAL REPORT 6-6 TABLE 6-3 1998 TELEDYNE BROWN QUALIIY CONTROL DATA-BLANKS NUCLIDE MEDIUM NUMBER AVERAGE RESULT UNITS I-131 Sr-90 H-3 Gross Beta Gamma Gross Beta I-131 Water Water Water Water AP Filter Charcoal 18()10(b)13(c)52 52(c)(4)52(a)(c)-1.3+9.8E-02 5.3 J 15E-01 1.2+1.9E-01 1.0+6.9E+01 1.3 J 3.7E-01 1.0 J 0.2E+00-1.8+10E-01 pCi/I pCi/1 pCi/1 pCi/1 pCi/1 pCi/I Total pCi Total pCi Footnotes:
All nuclides less than minimum detection level a)This average is calculated from the Supply System quality control samples without considering detection limits.b)This is the natural content in milk.c)The in-house weekly quality control blanks for AP filters and charcoals are calculated in total pCi.d)This average includes only the blank AP filters analyzed for the Supply System.A blank planchette (counter background) and a blank filter are counted with each set of filters analyzed (approximately 10 sets per week).6-7 1998 REMP ANNUAL REPORT TABLE 6-4 1998 TELEDYNE BROWN QUAIZIY CONTROL DATA-SPIKES NUCLIDE MEDIUM NUMBER.AVERAGE RESULT SPIKE LEVEL Gross Beta H-3 Sr-90 Sr-90 Gamma'*~Water Water Water Milk Water 13 10 2.1 g 0.3E+01 1.5 g 0.2E+03 3.4 g 0.4E+01 3.2+0.9E+01 2.2+0.7E+01 1.7 g 0.5E+03 3.5+0.6E+01 3.5+0.6E+01 2.2+0.05E+04 2.0+0.3E+04 Footnotes:
a)Measured Cs-137 peak at 662 KeV.1998 REMP ANNUAL REPORT 6-8 TABLE 6-5 1998 EPA INTERCOMPARISON PROGRAM RESULTS COLLECTION ISOTOPE DATE MEDIUM-WATER Ci/liter TI RESULTS<i EPA RESULTS+~OTHER LABS"~Sr-89 Sr-90 Sr-89 Sr-90 Sr-89 Sr-90 Sr-89 Sr-90 Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta I-131 I-131 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 01/16/98 01/16/98 04/21/98 04/21/98 07/17/98 07/17/98 10/20/98 10/20/98 01/30/98 01/30/98 04/21/98 04/21/98 07/24/98 07/24/98 10/20/98 10/20/98 02/06/98 09/11/98 02/13/98 02/13/98 04/21/98 04/21/98 06/12/98 06/12/98 09/18/98 09/18/98 10/20/98 10/20/98 5.00 g 1.73 31.67+0.58 4.67 2 1.15 21.67+1.15 21.00+1.00 6.33 2 0.58 18.33+1.53 8.33+1.15 33.00 J 2.65 5.60 g 0.90 50.00+1.73 102.00+6.56 5.43 2 0.64 14.67+2.08 21.67+2.31 74.67 g 7.64 110.00+0.00 5.93+0.55 14.67 g 0.58 32.00+2.00 15.00+0.00 8.50 g 0.20 4.47 2 0.85 1.93 g 0.21 1.53 2 0.46 6.70 2 0.35 4.67 2 0.25 1.90 g 0.20 8.0 2 5.0 32.0+5.0 6.0 g 5.0 18.0 2 5.0 21.0+5.0 7.0 g 5.0 19.0 J 5.0 8.0 g 5.0 30.5 2 7.6 3.9 J 5.0 54.4 2 13.6 94.7 g 10.0 7.2+5.0 12.8 g 5.0 30.1+7.5 94.0 g 10.0 104.9+10.5 6.1+2.0 16.0+2.4 33.3 2 8.3 15.0 2 2.3 9.3+2.3 4.9 g 0.7 2.1+0.5 1.7 g 0.3 5.7 J 1.4 4.5 g 0.7 1.5+0.4 9.33 g 4.70 29.51 2 3.39 6.15 2 2.53 17.06+2.75 20.53 2 3.50 6.82 g 1.80 18.25+3.33 7.24 g 1.61 21.36 2 5.99 7 44+2.59 53.26+9.73 97.73 J 9.53 7.27 2 1.98 13.23 g 2.84 30.01+5.15 94.20+10.64t~105.74+5.43 6.70+1.17 16.05 g 1.67 31.89+5.93 14.57 2 1.70 9.50 2 1.61 4.70 g 0.70 2.62 g 0.64 1.82+0.29 5.76+0.82 4.53 2 0.98 1.92+0.51 H-3 03/13/98 1833.33 g 57.74 2155.0+348.0 2159.47 2 234.20 Co%0 Cs-134 Cs-137 Co-60 Zn-65 Cs-134 Cs-137 Ba-133 Co-60 Cs-134 Cs-137 Co-60 04/21/98 04/21/98 04/21/98 06/05/98 06/05/98 06/05/98 06/05/98 06/05/98 10/20/98 10/20/98 10/20/98 11/11/98 52.33 R 1.53 21.00 g 1.00 11.67 g 0.58 13.00 g 1.00 111.67 f 2.52 32.33 g 0.58 37.67 g 2.08 35.00 g 2.65 22.33 g 1.15 6.67 g 0.58 56.33 2 3.79 38.67+2.52 50.0 g 5.0 22.0 g 5.0 10.0 R 5.0 12.0+5.0 104.0 g 10.0 31.0+5.0 35.0+5.0 40.0 g 5.0 21.0+5.0 6.0 2 5.0 50.0 g 5.0 38.0 2 5.0 49.65 g 2.25 20.74+2.29 10.82 g 1.72 12.74+1.81 108.45 2 7.54 28.42+2.16 36.13+2.06 38.11+2.84 21.77 2 2.03 6 40+1.57 50.88 g 2.72t'~38.17+2.38 6-9 1998 REMP ANNUAL REPORT TABLE 6-5 (cont.)1998 EPA INIERCOMPARISON PROGRAM RESULTS ISOTOPE COLLECTION DATE Tr RESULTS<i EPA RESULTS+'THER LABS'n45 Cs-134 Cs-137 Ba-133 11/11/98 11/11/98 11/11/98 11/11/98 140.67 g 10.97 103.00+2.00 115.33+1.53 46.33 2 2.52 131.0 J 13.0 105.0+5.0 111.0+6.0 56.0 R 6.0 137.21 1 7.65 97.11 g 6.14 113.38+5.42 53.11 g 3.64 Footnotes:
a)Teledyne Results-Average P one sigma.Units are pCi/incr for<<~icr aod inilk except K is in mg/liter.Units are total pCi for air particulate filters.b)EPA Results-Expected laboratory precision (I sigma i Unns are pCi'leer for<<ster and milk except K is in mg/liter.Units are total pCi for air particulate filters.C)Average concentration g one sigma, based on range of values coc>>uotcccd ln>m other labs.d)The special EPA instmctions concerning multiple csap>ration<<ith c>>o.cntratcd nitric acid (to purge)chlorides derived from HCl preservative were omitted by oversight.
The chlondca cau>c greater>ct(aha>rption and lead to lower results.Two additional aliquots using tow evaporations with concentrated nitric acid<<crc analyzed The results, when corrected for decay of Sr-89, were 87 and 83 pCi/liter, which compare favorably with the EPA result e)An investigation is being conducted; result will hc~callable shortly, 1998 REMP ANNUAL REPORT 6-10 TABLE 6-6 1998 ANALYTICS, INC.CROSS CHECK COMPARISON PROGRAM SAMPLE ID MEDIA NUCLIDE TI RESULT o ANALYTICS RESULT RATIO"I E1346-396 TI&#xb9;71657 03/12/98 E1460-396 TI&#xb9;78921 06/11/98 E1630-396 TI&#xb9;94881 12/14/98 E1631-396 TI&#xb9;94882 12/14/98 E1632-396 TI&#xb9;94883 12/14/98 Milk Milk Milk Filter Water 1-131 Ce-141 Cr-51 Cs-134 Cs-137 Mn-54 Fe-59 Zn-65 Co-60 1-131 Ce-141 Cr-51 Cs-134 C@-137 Mn-54 Fe-59 Zn-65 Co-60 1-131 Ce-141 Cr-Sl Cs-134 Cs-137 Mn-54 Fe-59 Zn45 Co-60 Sr-89 Sr-90 Ce-141 Cr-Sl Cs-134 Cs-137 Mn-54 Fe-59 Zn 65 Co.60 H.3 87 g 9 66 g 7 220 g 30 85+9 180~20 130 J 10 110 J 10 160 J 20 82+8 68 g 7 94 J 9 97 J 31 101 g I-79~8 112~11 58 g 9 143+14 157 R 16 65 g I 647 2 65 900 g 90 200+20 177 J 18 136 g 14 156 J 16 132+14 169+17 20~2 16/1 566 2 57 800 g 80 147 g 15 158 g 16 122 g 12 134~13 129~13 134+13 5500~200 82 J 4 70 J 4 201 g 10 84+4 161 J 8 133 g 7 95 g 5 142 g 7 85 g 4 67 g 3 99 g 5 132+7 95 g 5 70+4 106 g 5 45+2 122 g 6 143+7 71 J 4 746 g 37 979 J 49 220 g ll 183 g 9 142 J 7 148 2 7 140 J 7 178 g 9 69+3 41 J2 524 2 26 687 g 49 154 J 8 128+6 100 J 5 104 g 5 98 g 5 125 g 6 5980 2 299 1.06 0.94 1.09 1.01 1.12 0.98 1.16 1.13 0.96 1.01 0.95 0.73 1.06 1.13 1.06 1.29 1.17 1.10 0.92 0.87 0.92 0.91 0.97 0.96 1.05 0.94 0.95 0.29" 0.39"'.08 1.16 0.95 1.23 1.22 1.29 1.32 1.07 1.08 E1633-396 Tl&#xb9;94884 12/14/98 Water Am 241 Pu.239 8.3+1.5 9.8 g 1.8 7.9 g 0.4 8.9+0.4 1.05 1.10 6-11 1998 REMP ANNUAL REPORT TABLE 6-6(cont.)
1998 ANALYTlCS, INC.CROSS CHECK COMPARISON PROGRAM Footnotes:
a)Teledyne Results-counting error is two standard deviations.
Units are pCi/liter for water and milk.For gamma icsults, if two standard deviations are less than 10%, then a 10%error is reported.Units are total pCi for air particulate filters.b)Ratio of Teledyne Brown Engineering to Analytics results.Acceptance criteria are based on USNRC acceptance criteria described in USNRC Procedure 84750 dated March 15, 1994.c)Investigation in progress.1998 REMP ANNUAL REPORT 6-12


==6.0 UALITYASSURANCE==
==7.0 REFERENCES==
ANDUALITYCONTROLTheREMPisdesignedtomeetthequalityassurance andqualitycontrolcriteriaofRegulatory Guide4.15"'.Toaccomplish this,theREMPrequiresthatitsanalytical contractors meetthesecriteriaalso.In<epthauditsareperformed oftheREMPrecordsandactivities andtherecordsandactivities ofitssupportorganizations atleastannuallybytheSupplySystemQualityAssurance group.Qualityassurance andtechnical auditsoftheanalytical contractor (Teledyne BrownEngineering) arealsoconducted periodically toverifytheircompliance toregulatory andcontractual requirements.
Theadequacyoftheirqualityassurance programisalsoassessedduringtheaudits.Intercomparison
: programs, whichinvolvethecomparison ofSupplySystemanalytical meltsofsamplescontaining knownconcentrations ofvariousradionuclides, totheknownvaluesandalsowiththeicsultsreportedbyothermonitoring
: programs, areamajorcomponent ofthequalityassurance activities oftheREMP.Theprogramparticipates intheEnvironmental Protection Agency(EPA)andEnvironmental Measurements Laboratoiy (EML)inteicomparison programs.
Italsoparticipates inlocalandregionalintercomparison studies.Thefollowing sectionssummarize thequalityassurance andqualitycontrolaspectsoftheTLDandanalytical components oftheREIMP.6.1QualityControlFortheSupplySystemEnvironmental TLDProgramTheQualityControlProgramincludesthepieparation, processing andevaluation ofenvironmental TLDs.Tobeginwith,allenvironmental TLDs,including
: controls, whicharetobeusedinthesamequarter(oryearforannuals),
areannealedatthesametime.Thisallowsforuniformaccumulation ofandcornxtion forbackground radiation.
FromthetimetheTLDsan:annealedtothetimetheyareplacedinthefield,theyarestoolandtransported together.
OncethefieldTLDsarecollected, theyareagainstoredtogetherwiththecontrolsuntilprocessed.
ReaderQCdosimeters aa:preparedbytheTLDprocessor andserveasindicators thattheinvadercalibration issatisfactory andthattheTLDswerepmcessedcorrectly.
TheseTLDsareannealedjustpriortobeinggivenaknownexposure(typically 100mR)to'"Csandprocessed amongthefielddosimeters.
ThenumberofQAdosimeters usedduringeachpmcessing isgenerally 10%ofthenumberoffielddosimeters.
IfthemeanicaderQCdosimeter resultsvarybymorethan+5%fromthegivenexposure, theprocessor iscontacted andaninvestigation intothesourceofthedisciepancy isinitiated.
Evaluation ofthe1998readerQCdosimeter resultsindicated satisfactory agnmmentforallfourquartersandtheannualprocessing results.Controldosimeters (tripcontrols) areusedforeachsetoffielddosimeters tomonitorthecontribution oftheexposurereceivedbythefieldTLDswhileintransit.Theradiation background inthestorageareaisalsomonitorbyaseparatesetofcontroldosimeters (building controls).
Ifthetripcontrolresultsaregreatertlianthebuildingcontrolresults,thedifference betweenthetwoissubtracted fiomthefielddosimeters.
6-11998REMPANNUALREPORT Spikeddosimeters, whichareexposedbytheSupplySystem,areirradiated 25mRcesium-137 forquarterly dosimeters or85mRforannualdosimeters.
Thesespikeddosimeters aa:alsoprocessed withthefielddosimeters duringeachruntoverifytheaccuracyandconsistency oftheenvironmental TLDevaluations.
Allresultswerewithin,J5%
oftheknownexposureandaiepiovidedinTable6-1.Extrasetsofcontroldosimeters, knownaszerodosedosimeters, arealsoincludedwiththefielddosimeters forprocessing.
ThesezerodoseTLDsarestoredinashieldedcontainer throughout thequarter(oryearforannuals)andareusedasanadditional indication ofreaderperformance.
TheseTLDsmayalsobeusedassubstitutes ifafieldTLDislost.6.2QualityControlFortheAnalytical ProgramQualitycontrolfortheanalytical programinvolvestwocomponents:
thequalitycontmlactivities performed bytheSupplySystemandthequalitycontrolprogramoftheanalytical contractor, TeledyneBrownEngineering.
Bothofthesecomponents aredescribed inthefollowing sections.
6.2.1SupplySystemQualityControlActivities TheSupplySystemhasparticipated intheU.S.Department ofEnergy'sEnvironmental Measurements Laboratory (EML)QualityAssessment Programsince1987.Ingeneral,theTeledyneBrownicsultsayeedwiththeEMLvaluesasseeninTable6-2.Allresultswereeitheracceptable oracceptable withwarning.Duplicate samplesweresubmitted toTeledyneBrownforanalysisduring1998.Theseduplicates consisted oftwosetsofmilksamplesandonesetofairfiltersfromEML.Themilkduplicates weremarkedStation37andweresubmitted foranalysisatthesametimeasthemilksamplesfiomStation36.6.2.2TeledyneBrownEngineering QualityControlProgramThegoalofthequalitycontrolprogramatTeledyneBrownEngineering
-Envimnmental Servicesistopioduceanalytical icsultswhichareaccurate, preciseandsupported byadequatedocumentation.
Theprogramisbasedontherequirements of10CFR50,AppendixB,NuclearRegulatory Guide4.15andtheprogram,asdescribed inTeledyne's QualityAssurance Manual(IWI0032-395) andQualityControlManual(IWL-0032-365).
Allmeasuring equipment iscalibrated forefficiency atleastannuallyusingstandireference materialtraceable totheNationalInstitute ofStandards andTechnology (NIST).Foralphaandbetacounting, checksourcesarepreparedandcountedeachweekdaythecounterisinuse.Controlchartsaicmaintained withthine-sigma limitsspecified.
Backgiounds areusuallymeasuredatleastonceperweek."'998 REMPANNUALREPORT6-2 Thegammaspectrometers arecalibrated annuallywithaNIST-traceable standardreference materialselectedtocovertheenergyrangeofthenuclidestobemonitorforallofthegeometries measured.
Backgrounds aredetermined everyotherweekandchecksourcesarecountedweekly.Theenergyresolution andefficiency an:plottedattwoenergylevels(59.5and1332KeV)andheldwithinthree-sigma controllimits."'heefficiency oftheliquidscintillation countersisdetermined atleastannuaHybycountingNISTtraceable standards whichhavebeendilutedinaknownamountofdistilled waterandvariousamountsofquenching agent."'he background ofeachcounterismeasuredwitheachbatchofsamples.Acontrolchartismaintained forthebackground andchecksourcemeasurements asastability check.ResultsarereviewedbeforebeingenteredintothedatasystembytheQualityAssurance and/ortheDepartment Managerforreasonableness oftheparameters (background, efficiency, decay,etc.).Anyresultsthataresuspect,beinghigherorlowerthanresultsinthepast,arereturnedtothelaboratory forrecount.Ifalongercount,decaycheck,recountonanothersystemorrecalculation doesnotgiveacceptable icsultsbasedonexperience, anewaliquotisanalyzed.
Thecompleteinformation aboutthesampleiscontained ontheworksheets accompanying thesampleresults.TeledyneBrownalsoparticipates intheUSEPAInterlaboratory Comparison Pa)gramtothefullestextentpossible.
Thatis,theyparticipate intheprogramforallradioactive isotopespreparedandatthemaximum&cquencyofavailability.
Beginning with1996,theUSEPAdiscontinued providing milkandairparticulate filtersamples.Teledynepurchased comparable spikedsamplesfromAnalytics, Inc.Tables6-3and6-4presenttheTeledyneBrownqualitycontroldataicsultsforblanksandspikes,respectively.
Table6-5pmentstheresultsofthe1998EPAIntercomparison asicportedtotheSupplySystem.Footnotes inthetablerefertoinvestigations ofproblemsencountered inafewcasesandthestepstakenbyTeledyneBrowntopreventesurience.
Table6-6presentstheAnalytics CrossCheckComparison resultsfor1998.Nodeviations fromwrittenprocedures occurredduring1998.Asummaryofthequalitycontrolblankandspikedsampleresultsfollow.Iodine-131 Cartridges Ablankcharcoalfilterwasanalyzedwitheachgroupofsamplesassayed.Fifty-two blankswereanalyzedin1998.Theaverageactivitywas-1.8J10.0E-01totalpCi.Activities werecalculated withoutconsidering detection limits.Gross-Beta
-FiltersOneblankfilterwasmeasuredwitheachsetoffiltersassayed.Fifty-two blankswerecountedfor1998.Theaverageactivity1.0J0.2E+00totalpCi,whichindicated arelatively stablebackground forthefilterandthegrossbetaproportional counters.
6-31998REMPANNUALREPORT I-131-MilkAblankmilkwasanalyzedwitheachyoupofsamplesassayed.Themsultsshowedthattherewasnocontamination inthelaboratory orcountingarea.Themeasurements oftheblanksamplesindicated thattherewasnobiasonthelowbackground counters.
Theaverageactivityforeighteensamplesin1998was-1.3J9.8E-02pCi/liter withoutconsidering detection limits.InadditiontenblankswereanalyzedaspartoftheTeledyneBrownEngineering
-Environmental Services'uality controlprogram.Theaverageresultfor1998was5.3+15E-01pCi/liter.
Sr-90-MilkandWaterElevenblankwatersampleswereanalyzedduring1998.Theaverageresult,withoutconsidering thedetection limits,was1.2+1.9E-01pCi/liter.
Elevenspikedwatersampleswereanalyzedduring1998,Theaveragevalueofthesampleswas3.4J0.4E+01pCi/1comparedwithaspikelevelof3.5J0.6E+01pCi/1.During1998,atotaloftenspikedmilksampleswereanalyzed.
Theaveragevalueofthesampleswas3.2+0.9E+01pCi/1comparedwithaspikevalueof3.5J0.6E+01pCi/l.Theseresultswerewithinthelimitsasspecified bytheEPAIntercomparison StudiesProgram.Tenblankmilksampleswereanalyzedwithanaverageactivityof6.6J2.9E-01pCi/1ofSr-90,whichisthenaturalcontentofmilk.GrossBeta-WaterElevenblankswerepreparedfromdistilled water.Theaverageresultwithoutconsidering detection limitsfor1998was1.3J3.7E-01pCi/1.Elevengrossbetasampleswithaspikelevelof2.2+0.7E+01pCi/1wereanalyzedduring1998.Theaveragezesultwas2.1+0.3E+01pCi/1.Themsultswerewellwithintheguidelines outlinedinTable2,ofthedocument, "Environmental Radioactivity Laboratory Intercomparison StudiesProgram,"
EPA-600/4-81-004.
TritiuminWaterThirteenblanksampleswereanalyzedduring1998.Theaverageresult,withoutconsidering detection levels,was1.0J6.9E+01pCi/I.Thirty:ntritiumsampleswithaspikelevelof1.7J0.5E+03pCi/1wereanalyzedbyliquidscintillation countingduring1998.Theaverageresultwas1.5+0.2E+03pCi/I.GammaSpectroscopy Ablankwatersamplewasanalyzedweeklyinthegarrrmaspectroscopy laboratory.
Allnuclideswerelessthanthenormallevelofdetection indicating nocontamination.
SpikesamplesweremeasuredweeklyusingtheCs-137peakat662KcV.Theaverageactivityofelevenmeasurements during1998was2.2+0.05E+04pCi/1ascomparLdwithaspikelevelof2.0+0.3E+04pCi/l.1998REMPANNUALREPORT6-4 TABLE6-11998ENVIRONMENTAL SPIKEDDOSIMETER RESULTSDISTRIBUTION PERIODGIVENEXPOSUREmRREPORTEDEXPOSUREmRBIASFirstQuarterSecondQuarterThirdQuarterFourthQuarter24.025.025.025.085.023.123.223.424.325.124.523.824.524.425.124,224.080.680.480.1-3.8303-2.5-2.8+4.0-2.0-4.8-2.0-2.4+0.2303-4.1-5.2-5.4-5.86-51998REMPANNUALREPORT TABLE6-21998ENVIRONMENTAL MEASUREMENTS LABORATORY (EML)QUALITYASSESSMENT PROGRAMRESULTSSAMPLEREPORTEDEMLEMLRATIODATETYPE"NUCLIDERESULTERRORVALUEERRORREPORTED/EML 06/98AirMn-54(Bq/filter)
Co%0Sb-125Cs-137Gr-pCe-14406/98SoilK-40(Bq/kg)Sr-90Cs-1375.81E+008.71E+001.28E+011.22E+012.11E+007.36E+003.89E+021.30E+013.92E+022.5E-013.3E%16.3E+13.3EAI7.4E%25.7E<11.4E+012.2E+003.4E+00SA4E+009.09E+001.22E+011.19E+011.96E+008.21E+003.14E+021.31E+013.30E+024.9E%17.3EZl1.2E%19.6E%13.0E418.0EAl1.0E+012.8EAl9.3E+001.070.961.051.031.080.901.240.991.1906/98Vegetation K-408.38E+022.2E+017.07E+022.5E+011.18(Bq/kg)Co-601.33E+011.2E+001.06E+012.1E%11.26Cs-1372.23E+023.0E+001.82E+027.1E+001.2306/98WaterH-3(Bq/l)Mn-54Co-60Cs-137Gr-txGr-3.40E+025.61E+011.36E+014.72E+01L40E+035.3E+01+i4.8E+011.3E+008.0E%11.2E+001.1E+022.0E+002.18E+025.70E+011.36E+014.60E+011.42E+032.20E+036.5E+001.9E+001.2E+001.7E+001.0E+021.0E+021.560.981.001.030.990.02Bq=becquerel; theEMLresultsarereportedinbecquerel insteadofpicocuries.
Onepicocurie equals0.037becquerel SupplySystemresultwasenteredwrongonEMLdatabase.
Resultshouldhavebeen1.96E+03Bq/l.1998REMPANNUALREPORT6-6 TABLE6-31998TELEDYNEBROWNQUALIIYCONTROLDATA-BLANKSNUCLIDEMEDIUMNUMBERAVERAGERESULTUNITSI-131Sr-90H-3GrossBetaGammaGrossBetaI-131WaterWaterWaterWaterAPFilterCharcoal18()10(b)13(c)5252(c)(4)52(a)(c)-1.3+9.8E-025.3J15E-011.2+1.9E-011.0+6.9E+011.3J3.7E-011.0J0.2E+00-1.8+10E-01pCi/IpCi/1pCi/1pCi/1pCi/1pCi/ITotalpCiTotalpCiFootnotes:
Allnuclideslessthanminimumdetection levela)Thisaverageiscalculated fromtheSupplySystemqualitycontrolsampleswithoutconsidering detection limits.b)Thisisthenaturalcontentinmilk.c)Thein-houseweeklyqualitycontrolblanksforAPfiltersandcharcoals arecalculated intotalpCi.d)ThisaverageincludesonlytheblankAPfiltersanalyzedfortheSupplySystem.Ablankplanchette (counterbackground) andablankfilterarecountedwitheachsetoffiltersanalyzed(approximately 10setsperweek).6-71998REMPANNUALREPORT TABLE6-41998TELEDYNEBROWNQUAIZIYCONTROLDATA-SPIKESNUCLIDEMEDIUMNUMBER.AVERAGERESULTSPIKELEVELGrossBetaH-3Sr-90Sr-90Gamma'*~WaterWaterWaterMilkWater13102.1g0.3E+011.5g0.2E+033.4g0.4E+013.2+0.9E+012.2+0.7E+011.7g0.5E+033.5+0.6E+013.5+0.6E+012.2+0.05E+042.0+0.3E+04Footnotes:
a)MeasuredCs-137peakat662KeV.1998REMPANNUALREPORT6-8 TABLE6-51998EPAINTERCOMPARISON PROGRAMRESULTSCOLLECTION ISOTOPEDATEMEDIUM-WATERCi/literTIRESULTS<iEPARESULTS+~
OTHERLABS"~Sr-89Sr-90Sr-89Sr-90Sr-89Sr-90Sr-89Sr-90Gr-AlphaGr-BetaGr-AlphaGr-BetaGr-AlphaGr-BetaGr-AlphaGr-BetaI-131I-131Ra-226Ra-228Ra-226Ra-228Ra-226Ra-228Ra-226Ra-228Ra-226Ra-22801/16/9801/16/9804/21/9804/21/9807/17/9807/17/9810/20/9810/20/9801/30/9801/30/9804/21/9804/21/9807/24/9807/24/9810/20/9810/20/9802/06/9809/11/9802/13/9802/13/9804/21/9804/21/9806/12/9806/12/9809/18/9809/18/9810/20/9810/20/985.00g1.7331.67+0.584.6721.1521.67+1.1521.00+1.006.3320.5818.33+1.538.33+1.1533.00J2.655.60g0.9050.00+1.73102.00+6.565.4320.6414.67+2.0821.67+2.3174.67g7.64110.00+0.005.93+0.5514.67g0.5832.00+2.0015.00+0.008.50g0.204.4720.851.93g0.211.5320.466.7020.354.6720.251.90g0.208.025.032.0+5.06.0g5.018.025.021.0+5.07.0g5.019.0J5.08.0g5.030.527.63.9J5.054.4213.694.7g10.07.2+5.012.8g5.030.1+7.594.0g10.0104.9+10.56.1+2.016.0+2.433.328.315.022.39.3+2.34.9g0.72.1+0.51.7g0.35.7J1.44.5g0.71.5+0.49.33g4.7029.5123.396.1522.5317.06+2.7520.5323.506.82g1.8018.25+3.337.24g1.6121.3625.99744+2.5953.26+9.7397.73J9.537.2721.9813.23g2.8430.01+5.1594.20+10.64t~105.74+5.436.70+1.1716.05g1.6731.89+5.9314.5721.709.5021.614.70g0.702.62g0.641.82+0.295.76+0.824.5320.981.92+0.51H-303/13/981833.33g57.742155.0+348.02159.472234.20Co%0Cs-134Cs-137Co-60Zn-65Cs-134Cs-137Ba-133Co-60Cs-134Cs-137Co-6004/21/9804/21/9804/21/9806/05/9806/05/9806/05/9806/05/9806/05/9810/20/9810/20/9810/20/9811/11/9852.33R1.5321.00g1.0011.67g0.5813.00g1.00111.67f2.5232.33g0.5837.67g2.0835.00g2.6522.33g1.156.67g0.5856.3323.7938.67+2.5250.0g5.022.0g5.010.0R5.012.0+5.0104.0g10.031.0+5.035.0+5.040.0g5.021.0+5.06.025.050.0g5.038.025.049.65g2.2520.74+2.2910.82g1.7212.74+1.81108.4527.5428.42+2.1636.13+2.0638.11+2.8421.7722.03640+1.5750.88g2.72t'~38.17+2.386-91998REMPANNUALREPORT TABLE6-5(cont.)1998EPAINIERCOMPARISON PROGRAMRESULTSISOTOPECOLLECTION DATETrRESULTS<iEPARESULTS+'THER LABS'n45Cs-134Cs-137Ba-13311/11/9811/11/9811/11/9811/11/98140.67g10.97103.00+2.00115.33+1.5346.3322.52131.0J13.0105.0+5.0111.0+6.056.0R6.0137.2117.6597.11g6.14113.38+5.4253.11g3.64Footnotes:
a)TeledyneResults-AveragePonesigma.UnitsarepCi/incrfor<<~icraodinilkexceptKisinmg/liter.
UnitsaretotalpCiforairparticulate filters.b)EPAResults-Expectedlaboratory precision (IsigmaiUnnsarepCi'leerfor<<sterandmilkexceptKisinmg/liter.
UnitsaretotalpCiforairparticulate filters.C)Averageconcentration gonesigma,basedonrangeofvaluescoc>>uotcccd ln>motherlabs.d)ThespecialEPAinstmctions concerning multiplecsap>ration<<ithc>>o.cntratcd nitricacid(topurge)chlorides derivedfromHClpreservative wereomittedbyoversight.
Thechlondcacau>cgreater>ct(aha>rptionandleadtolowerresults.Twoadditional aliquotsusingtowevaporations withconcentrated nitricacid<<crcanalyzedTheresults,whencorrected fordecayofSr-89,were87and83pCi/liter, whichcomparefavorably withtheEPAresulte)Aninvestigation isbeingconducted; resultwillhc~callableshortly,1998REMPANNUALREPORT6-10 TABLE6-61998ANALYTICS, INC.CROSSCHECKCOMPARISON PROGRAMSAMPLEIDMEDIANUCLIDETIRESULToANALYTICS RESULTRATIO"IE1346-396 TI&#xb9;7165703/12/98E1460-396 TI&#xb9;7892106/11/98E1630-396 TI&#xb9;9488112/14/98E1631-396 TI&#xb9;9488212/14/98E1632-396 TI&#xb9;9488312/14/98MilkMilkMilkFilterWater1-131Ce-141Cr-51Cs-134Cs-137Mn-54Fe-59Zn-65Co-601-131Ce-141Cr-51Cs-134C@-137Mn-54Fe-59Zn-65Co-601-131Ce-141Cr-SlCs-134Cs-137Mn-54Fe-59Zn45Co-60Sr-89Sr-90Ce-141Cr-SlCs-134Cs-137Mn-54Fe-59Zn65Co.60H.387g966g7220g3085+9180~20130J10110J10160J2082+868g794J997J31101gI-79~8112~1158g9143+14157R1665gI647265900g90200+20177J18136g14156J16132+14169+1720~216/1566257800g80147g15158g16122g12134~13129~13134+135500~20082J470J4201g1084+4161J8133g795g5142g785g467g399g5132+795g570+4106g545+2122g6143+771J4746g37979J49220gll183g9142J714827140J7178g969+341J2524226687g49154J8128+6100J5104g598g5125g6598022991.060.941.091.011.120.981.161.130.961.010.950.731.061.131.061.291.171.100.920.870.920.910.970.961.050.940.950.29"0.39"'.08 1.160.951.231.221.291.321.071.08E1633-396 Tl&#xb9;9488412/14/98WaterAm241Pu.2398.3+1.59.8g1.87.9g0.48.9+0.41.051.106-111998REMPANNUALREPORT TABLE6-6(cont.)
1998ANALYTlCS, INC.CROSSCHECKCOMPARISON PROGRAMFootnotes:
a)TeledyneResults-countingerroristwostandarddeviations.
UnitsarepCi/liter forwaterandmilk.Forgammaicsults,iftwostandarddeviations arelessthan10%,thena10%errorisreported.
UnitsaretotalpCiforairparticulate filters.b)RatioofTeledyneBrownEngineering toAnalytics results.Acceptance criteriaarebasedonUSNRCacceptance criteriadescribed inUSNRCProcedure 84750datedMarch15,1994.c)Investigation inprogress.
1998REMPANNUALREPORT6-12


==7.0REFERENCES==
1.U.S.Nuclear Regulatory Commission,"Programs For Monitoring Radioactivity in the Environs of Nuclear Power Plants," Regulatory Guide 4.1, Revision 1, April 1975.2.U.S.Nuclear Regulatory Commission,"Environmental Technical Specifications For Nuclear Power Plants," Regulatory Guide 4.8, December 1975.3.U.S.Nuclear Regulatory Commission,"An Acceptable Radiological Environmental Monitoring Program," Assessment Branch Technical Position Revision 1, November 1979.4.U.S.Nuclear Regulatory Commission,"Quality Assurance For Radiological Environmental Monitoring Program (Normal Operations), Effluent Streams and the Environment," Regulatory Guide 4.15, Revision 1, February 1979.5.U.S.Nuclear Regulatory Commission,"Performance, Testing and Procedural Specifications For Thermoluminescence Dosimetry-Environmental Applications," Regulatory Guide 4.13, Revision 1, July 1977.6.Energy Facility Site Evaluation Council, Resolution No.260, January 1992.7.Washington Public Power Supply System Nuclear Plant No.2, Operating License NSF-21, Technical S ecificati n Section 5.5.1, 5.5.4, and 5.6.2 8.WNP-2 Offsite Dose Calculation Manual (ODCM).9.Code of Federal Regulations, Title 10 Part 20,"Standards For Protection Against Radiation." 10.Code of Federal Regulations, Title 10 Part 50,"Domestic Licensing of Production and Utilization Facilities." 11.Washington Administrative Code 246-290,"Group A Public Water Systems." 12.Washington Administrative Code 173-200,"Water Quality Standards for Ground Water of the State of Washington." 13.Washington Administrative Code 173-201A,"Water Quality Standards for Surface Waters of the State of Washington." 14.Robertson, D.E., and J.J.Fix,"Association of Hanford Origin Radionuclides With Columbia River Sediment", BNWL-2305, August 1977.15.Energy Facility Site Evaluation Council, Resolution No.259, amended November 1994.N 16.Energy Facility Site Evaluation Council, Resolution No.278, approved May 8, 1995.7-1 1998 REMP ANNUAL REPORT 17.Teledyne Brown Engineering
-Environmental Services PRO-032-27,"Calibration and Control of Alpha/Beta Counters," 18.Teledyne Brown Engineering
-Environmental Services PRO-042-44,"Calibration and Control of Gamma Ray Spectrometers." 19.Teledyne Brown Engineering
-Environmental Services PRO-052-35,"Determination of Tritium by Liquid Scintillation." 1998 REMP ANNUAL REPORT 7-2 8.0 1 M2VIP MH'ORT 7<&RATA Corrections to errors found in the 1997 Radiological Environmental Monitoring Program Annual Report are listed below.Pa e 4-14 Table 4-2: Two stations in north sector have wrong distance.Station 47 and Station 57 should both be 0.9 miles and 1448 meters.Pa e 4-15 Table 4-2: Station 65 in the south sector should read 8.7 miles and 13999 meters estimated distance.Pa e 5-14 Table 5-1: Mean cesium-137 result in annual soil, previous operational should read 235.3 pCi/kg.Pa e 5-16 Table 5-1: Mean cesium-137 result in river sediment, previous operational should read 317.8 pCi/kg.8-1 1998 REMP ANNUAL REPORT I I WASHINGTON PUBLIC POWBR 4N SUPPLY SYSTEM WASHINGTON PUBLIC POWER SUPPLY SYSTEM NUCLEAR PLANT 2 1998 DATA TABLES TABLES A and B JANUARY 1 to DECEMBER 31, 1998 RADIOLOGICAL
%PA~ON V0~2TTAL MONITORING PROGRAM Prepared by J.E.McDonald and L.S.Schleder Washington Public Power Supply System Richland, WA and C.A.Mendola Teledyne Brown Engineering Environmental Services Westwood, NJ S I~g i 5 I 1 S DATA TABLES TABLE A'OVIINE RESULTS TABLE B: SPECIAL I&#xc3;ZEREST SAMPLE RESULTS TABLE A'OUTINE RESULTS A-1.1 1998 Quarterly TLD Results A-1.2 1998 Annual TLD Results A-1.3 1998 TLD Results-Summary A-2.1 Gross Beta On Air Particulate Filters A-2.2 Gross Beta On Air Particulate Filters-Summary A-3.1 Gamma Spectrometry of Particulate Filters A-3.2 Gamma Spectrometry of Particulate Filters-Summary A-4.1 I-131 in Charcoal Cartridges A-4.2 A-5.1 A-5.2 A-6.1 I-131 in Charcoal Cartridges
-Summary Gross Beta in Water Gross Beta in Water-Summary Tritium in Water A-6.2 Tritium in Water-Summary A-7.1 A-7.2 A-8.1 A-8.2 A-9.1 A-9.2 A-10.1 A-10.2 A-11.1 A-11.2 A-12.1 A-12.2 Gamma Spectrometry of Water Gamma Spectrometry of Water-Summary Gamma Spectrometry of Soil Gamma Spectrometry of Soil-Summary Gamma Spectrometry of Sediment Gamma Spectrometry of Sediment-Summary Gamma Spectrometry of Fish Gamma Spectrometry of Fish-Summary I-131 in Milk I-131 in Milk-Summary Gamma Spectrometry of Milk Gamma Spectrometry of Milk-Summary I 5 1 8 DATA TABLES A-13.1 Gamma Spectrometry of Broadleaf in Lieu of Milk A-13.2 Gamma Spectrometry of Broadleaf in Lieu of Milk-Summary A-14.1 Gamma Spectrometry of Roots A-14.2 Gamma Spectrometry of Roots-Summary A-15.1 Gamma Spectrometry of Fruit A-15.2 Gamma Spectrometry of Fruit-Summary A-16.1 Gamma Spectrometry of Vegetables A-16.2 Gamma Spectrometry of Vegetables
-Summary


1.U.S.NuclearRegulatory Commission, "Programs ForMonitoring Radioactivity intheEnvironsofNuclearPowerPlants,"Regulatory Guide4.1,Revision1,April1975.2.U.S.NuclearRegulatory Commission, "Environmental Technical Specifications ForNuclearPowerPlants,"Regulatory Guide4.8,December1975.3.U.S.NuclearRegulatory Commission, "AnAcceptable Radiological Environmental Monitoring Program,"
1998 DATA TABL TABLE B: SPECIAL INTEREST SAMPLE RESULTS B-2.1 Gamma Spectrometry of Storm Drain Water B-2.2 Gamma Spectrometry of Storm Drain Water-Summary B-3.1 Gross Beta in Storm Drain Water B-3.2 Gross Beta in Storm Drain Water-Summary B-4.1 Tritium in Storm Drain Water B-4.2 Tritium in Storm Drain Water-Summary B-5.1 Gamma Spectrometry of Storm Drain Sediment B-5.2 Gamma Spectrometry of Storm Drain Sediment-Summary B-6.1 B-6.2 B-7.1 B-7.2 B-8.1 B-8.2 B-9.1 B-9.2 B-10.1 B-10.2 B-11.1 B-11.2'-12.1 B-12.2 B-13.1 B-13.2 Gamma Spectrometry of Storm Drain Soil Gamma Spectrometry of Storm Drain Soil-Summary Gamma Spectrometry of Storm Drain Vegetation Gamma Spectrometry of Storm Drain Vegetation
Assessment BranchTechnical PositionRevision1,November1979.4.U.S.NuclearRegulatory Commission, "QualityAssurance ForRadiological Environmental Monitoring Program(NormalOperations),
-Summary Gross Alpha in Sanitary Waste Treatment Water Gross Alpha in Sanitary Waste Treatment Water-Summary Gross Beta in Sanitary Waste Treatment Water Gross Beta in Sanitary Waste Treatment Water-Summary Gamma Spectrometry of Sanitary Waste Treatment Water Gamma Spectrometry of Sanitary Waste Treatment Water-Summary Tritium in Sanitary Waste Treatment Water Tritium in Sanitary Waste Treatment Water-Summary Gamma Spectrometry of Sanitary Waste Treatment Sediment Gamma Spectrometry of Sanitary Waste Treatment Sediment-Summary Gamma Spectrometry of Station 118 Soil Gamma Spectrometry of Station 118 Soil-Summary I
EffluentStreamsandtheEnvironment,"
LOCATION 19 8 TABLE A-1.1 UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.239 0.249 0.239 0.260 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.236 0.234 0.241 0.243 0.233 0.229 0.230 0.240 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/9&03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.204 0.218 0.202 0.218 0.215 0.217 0.205 0.223 0.223 0.222 0.217 0.230 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.253 0.231 0.242 0.239'.216 0.259 0.253 0.265 LOCATION 10 8 TABLE A-1.1 (cont.)UARTKRLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.234 0.213 0.211 0.217 0.239 0.236 0.226 0.237 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.229 0.235 0.233 0.238 12 13 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.248 0.256 0.248 0.266 0.238 0.240 0.234 0.246 14 15 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.234 0.235 0.229 0.240 0.250 0.253 0.250 0.263 16 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.238 0.242 0.243 0.243 LOCATION 17 1 98 TABLE A-l.1 (cont.)UARTKRLY TLD R ULT Results in mR/Day COLLECTION PEMOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.245 0.256 0.251 0.259 18 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98.to 12/31/98 0.239 0.256 0.239 0.245 19 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.243 0.250 0.250 0.260 20 21 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.246 0.239 0.246 0.255 0.226 0.229 0.225 0.232 22 23 24 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/3 l/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.233 0.240 0.237 0.246 0.235 0.235 0.230 0.237 0.229 0.254 0.231 0.257 LOCATION 25 1 98 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98'6/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.243 0.254 0.247 0.251 40 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.210 0.221 0.212 0.225 41 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.245 0.252 0.236 0.250 42 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.240 0.243 0.247 0.241 43 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 (a)0.238 0.240 0.236 45 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.225 0.235 0.222 0.244 0.229 0.230 0.242 0.236 46 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.272 0.306 0.300 0.311 (a)TLD missing LOCATION 47 49 50 1 8 TABLE A-l.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.218 0.219 0.211 0.227 0.239 0.219 0.233 0.251 0.230 0.240 0.226 0.264 51 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.225 0.233 0.226 0.244 53 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.247 0.253 0.245 0.272 54 55 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.232 0.253 0.235 0.253 0.244 0.240 0.235 0.246 56 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.237 0.234 0.234 0.259 LOCATION 65 19 8 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.222 0.234 0.217 0.238 71 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.286 0.254 0.283 0.305 72 73 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.272 0.258 0.273 0.286 0.234 0.228 0.228 0.241 74 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.249 0.250 0.253 0.267 75 12/30/97 to 03/27/98 , 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.239 0.235 0.238 0.251 76 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.250 0.231 0.244 0.248 77 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.238 0,230 0.241 0.252 LOCATION 1998 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.229 0.238 0.229 0.243 79 80 81-'12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.231 0.244 0.242 0.249 0.226 0.231 0.224 0.239 0.225 0.238 0.228 0.245 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.241 0.251 0.241 0.258 83 84 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.239 0.242 0.244 0.249 0;244 0.253 0.242 0.274 85 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.243 0.249 0.258 0.262 LOCATION TABLE A-1.1 (cont.)1 98 UARTKRLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.277 0.254 0.274 0.293 119 119-Control 120 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.242 0.250 0.238 0.266 0.249 0.234 0.242 0.250 0.254 0.248 0.241 0.261 LOCATION 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 40 41 42 43 45 46 47 TABLE A-1.2 1998 A5INUAL TLD RESULTS Results in mtuDay COLLECTION PERIOD 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/3 l/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 RESULT 0.220 0.217 0.213 0.194 0.194 0.200 0.210 0.240 0.203 0.218 0.220 0.242 0.223 0.215 0.233 0.225 0.225 0.238 0.242 0.233 0.202 0.229 0.209 0.217 0.223 0.197 0.223 0.220 0.195 0.200 0.217 0.283 0.209 LOCATION 49 50 51 53 54 55 56 65 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 119 119-Control 120 TABLE A-1.2 (cont.)1998 ANNUAL TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12'/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 RESULT 0.221 0.228 0.216 0.237 0.226 0.210-0.223 0.219 0.254 0.248 0.222 0.242 0.223 0.220 0.220 0.220 0.222 0.231 0.215 0.216 0.226 0.225 0.241 0.263 0.219 0.227 0.232 TABLE A-1.3 19 S TLD R ULTS-
Regulatory Guide4.15,Revision1,February1979.5.U.S.NuclearRegulatory Commission, "Performance, TestingandProcedural Specifications ForThermoluminescence Dosimetry-Environmental Applications,"
 
Regulatory Guide4.13,Revision1,July1977.6.EnergyFacilitySiteEvaluation Council,Resolution No.260,January1992.7.Washington PublicPowerSupplySystemNuclearPlantNo.2,Operating LicenseNSF-21,Technical Secificati nSection5.5.1,5.5.4,and5.6.28.WNP-2OffsiteDoseCalculation Manual(ODCM).9.CodeofFederalRegulations, Title10Part20,"Standards ForProtection AgainstRadiation."
==SUMMARY==
10.CodeofFederalRegulations, Title10Part50,"Domestic Licensing ofProduction andUtilization Facilities."
Results in mR/Day NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER=SAMPLES POSITIVE UARTERLY TLD RESULTS TLD (I)TLD (C)0.242 0.219 0.202 0.211 0.311 0.234 235 4 235 TLD (I)TLD (C)0.223 0.203 ANNUAL TLD RESULTS 0.194 0.283 0.203 0.203 59 1 59 1 I
11.Washington Administrative Code246-290,"GroupAPublicWaterSystems."
R BETA TABLE A-2.1 AIR P RTI LATE FII TER LOCATION COLLECTION PERIOD Results in pCi/cubic meter RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-0 1/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (a)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/9S-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/9S 07/27/9iS-08/03/9iS 08/03/98-08/10/98 08/10/98-08/
12.Washington Administrative Code173-200,"WaterQualityStandards forGroundWateroftheStateofWashington."
l 7/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/9S 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/9iS-09/28/9S 1.3 1.4 2.2 4.7 9.2 1.8 5.6 6.7 7.7 1.1 8.9 1.5 4 9 7.8 6.9 1.2 1.0 7.7 1.1 4.6 1.1 6.2 1.0 7.4 6.5 5.0 9.0 1.1 9.8 1.1 1.4 1.3 6.0 1.1 1.8 2.1 l.3 1.7 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-02 E-02 E-03 E-02 E-02.E-02 E-02 E-02 E-02 2P 2Q 2.0 1.7 2.1 2.0 1.7 2 1.9 2.0 2 P 2.0 1.7 2.0 2.0 2.0 2.0 1.9 2.0 1.8 4.0 25 2Q 1.8 1.7 1.7 2 Q 2Q 1.8 2.0 2P 2P 1.8 2 P 2.0 2P 2 P 2P 2P E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume duc to poivcr outage.Not included in averages.
13.Washington Administrative Code173-201A, "WaterQualityStandards forSurfaceWatersoftheStateofWashington."
TABLE A-2.1 (Cont.)AIR P RTI I TE kILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.5 E-02 1.0 E-02 8.4 E-03 3.5 E-02 1.4 E-02 1.9 E-02 1.6 E-02 5.5 E-03 8.9 E-03 7.3 E-03 1.4 E-02 1.4 E-02 2.5 E-02 2.0 E-03 2.0 E-03 2.1 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.6 E-03 2.1 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)rR 8 BETA AIR PARTI UI YE FIL ERS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 (3)07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.3 1.6 1.9 5.7 1.0 1.8 5.5 6.4 9.8 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 9.9 1.4 7.0 7.8 6.1 1.2 1.6 2.5 1.1 5.1 8.3 5.0 1.2 7.3 6.9 4 3 1.2 1.2 2 1.9 1.5 1.0 1.5 2 P 2.2 1.4 1.4 1.5 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 6.7 E-03 2.0 2P 2.0 1.8 2.0 2.0 1.7 2.1 2 Q 1.8 2 Q 2 Q 1.8 2 P 2 P 2 P 2 Q 3.0 2 Q 1.8 1.6 1.9 2Q 1.8 1.7 1.7 2 P 2 P 2 P 4.0 2 P 2.0 2 P 2 P 2 P 2 P 2.0 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 , E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Unit failure;low sample volume.
14.Robertson, D.E.,andJ.J.Fix,"Association ofHanfordOriginRadionuclides WithColumbiaRiverSediment",
TABLE A-2.1 (Cont.)R BET N AIR PARTI Results in pCi/cubic meter TF FII TER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-1 1/02/98 11/02/98-11/09/98 11/09/98-11/16/98 (a)11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.7 E-02 1.3 E-02 9.0 E-03 4.3 E-02 1.5 E-02 2.0 E-02 1.2 E-02 7.3 E-03 8.2 E-03 8.1 E-03 1.4 E-02 1.6 E-02 2.7 E-02 2.0 E-03 2.0 E-03 2.1 E-03 3.0 E-03 2.0 E-03 2.0 E-03 4.0 E-03 1.7 E-03 2.0 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (a)Power off at unit.
BNWL-2305, August1977.15.EnergyFacilitySiteEvaluation Council,Resolution No.259,amendedNovember1994.N16.EnergyFacilitySiteEvaluation Council,Resolution No.278,approvedMay8,1995.7-11998REMPANNUALREPORT 17.TeledyneBrownEngineering
TABLE A-2.1 (Cont.)vR S BET N AIR PARTI I TE FII TER Results in pCi/cubic meter LOCATION COLLECTION-PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98;09/21/98 09/21/98-09/28/98 1.0 1.6 1.9 3.1 1.1 1.5 4.5 5.0 7.0 1.2 7.2 1.3 6.1 7.6 5.7 1.1 1.3 2.3 1.2 4.7 9.1 3.4 8.5 7.8 8.0 7.2 14 1.4 1.2 1.5 1.6 1.5 1.0 l.l l.7 2.1 1.4 1.3 1.7 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 2 Q 2.0 2.0 1.6 2.0 2.0 1.8 2.0 1.8 2.0 1.9 2Q 1.8 1.9 1.9 2.0 2.0 3.0 2Q 1.8 1.6 1.8 1.9 1.8 1.8 1.8 2.0 2.0 2.0 2 P 2Q 2Q 2.0 2.0 2Q 2 P 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)R 8 BETA N AIR AR I LATE lII.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.9 E-03 6.8 E-03 3.5 E-02 1.3 E-02 1.8 E-02 1.1 E-02 5.4 E-03 6.9 E-03 5.1 E-03 1.2 E-02 1.2 E-02 2.5 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.6 E-03 2.0 E-03 1.6 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)vR BFTA'IR PARTI Results in pCi/cubic meter ATE FILTFR LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/)
-Environmental ServicesPRO-032-27, "Calibration andControlofAlpha/Beta Counters,"
2/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 (a)02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/1 5/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/9iS-07/27/98 07/27/9S-OS/03/98 08/03/98-08/10/9iS 08/l 0/9S-OS/17/98 08/17/9iS-08/24/98 08/24/98-08/31/98 08/31/9S-09/08/98 09/08/9S-09/l 4/98 09/14/98-09/21/98 09/2 l/9iS-09/28/9S 1.1 1.3 1.7 6.2 1.2).8 1 7 7.7 9.0 7.5 1.6 6.0 6.3 3.9 9.7 1.3'7'7 1.0 4.5 8.3 3.8 1.4 8.3 7.8 5.8 1.2 1.3 l.2 l.4 l.7 1.4 8 o I.1 1.9 2.2 1.4 1.2 1.5 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E Q2 E-02 E-02 E-02 E-02 E-03 E-02 E 02 E-02 E-02 E-02 E-02 2.0 2.0 2.0 1.8 2.0 2.0 1.4 1.9 1.9 1.9 1.9 2.0 1.8 1.9 1.8 1.9 2.0 3.0 2.0 1.8 1.6 1.9 2Q 1.8 1.8 1.8 2.0 2Q 2Q 2.0 2.0 2.0).9 2.0 2.0 2.0 2.0 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Filter light in disposition.
18.TeledyneBrownEngineering
Denotes a result less than thc detection limit.
-Environmental ServicesPRO-042-44, "Calibration andControlofGammaRaySpectrometers."
TABLE A-2.1 (Cont.)R 8<TA N RP Results in pCi/cubic meter E FlI.TER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.5 E-02 8.8 E-03 6.6 E-03 4.2 E-02 1.5 E-02 2.2 E-02 1.3 E-02 6.2 E-03 1.0 E-02 9.1 E-03 1.9 E-02 1.4 E-02 3.1 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.9 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)R BETA N AIR PARTI LATF F LTHR Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-0 1/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 (a)05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/9S 08/10/98-08/17/98 08/17/98-OS/24/98 08/24/98-08/3 I/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 1.3 1.8 E-02 E-02 E-02 1.4 4.7 49 8.2 1.0 7.5 1.4 4.8 5.6 5.5 1.2 1.1 2.7 1.0 5.3 8.5 5.4 I 2 9 2 5.6 4.6 9.5 9.8 I.I 1.0 I.5 1.1 9.5 1.0 l.4 2 P 1.2 I.p l.2 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 , E-03 E-02 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 4.1 E-03 1.1 E-02 2.0 2.0 2.0 1.7 2.0 2 P 1.6 2.0 1.9 2.0 1.9 2.0 1.7 1.8 1.9 2.0 2.0 4.0 2.0 1.8 1.6 2.0 2 Q 1.9 1.6 1.7 2P 2.0 2 P 2.0 2.0 2Q 2 P 2 P 2Q 2 Q 2 Q 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume due to unit failure.
19.TeledyneBrownEngineering
TABLE A-2.1 (Cont.)vR BETA N AIR PARTI LATE F<II TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-1 1/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.2 E-03 5.3 E-03 3.2 E-02 1.2 E-02 1.9 E-02 1.1 E-02 6.2 E-03 8.1 E-03 4.2 E-03 1.1 E-02 1.2 E-02 2.1 E-02 2.0 E-03 1.8 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.6 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)HFTA AIR P RTI L'FII R Results in pCi/cubic meter , LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY
-Environmental ServicesPRO-052-35, "Determination ofTritiumbyLiquidScintillation."
'8 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/1 7/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/1 6/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-OS/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/1 3/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/]0/98-08/17/98 08/17/98-08/24/98 08/24/98-08/3]/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 1.4 1.8 4.0 7.0 1.5 3.7 5 2 7.0 9.8 8.3 1.4 4.9 6.0 4.9 1.1 1.1 2 P 8.6 3.1 7.6 29 1.1 7.0 7.7 3.1 9.]8.5 9.8 1.2 8.5 1.1 6.7 1.2 1.9 2.1]4 1.5 1.4 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03, E-03*E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2 Q 2.0 1.7 2.0 2 P 1.6 2.0 1.8 2.0 2P 2.0 1.7 1.9 1.9 2 P 2.0 3.0 1.9 1.7 1.5 1.8 2.0 1.8 1.8 1.6 2.0 1.9 1.8 2 P 1.8 2 Q 1.8 2.0 2.0 2.0 2 P 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)vR BETA N AIR P RTI I E FILTER Results in pCi/cubic meter., LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.3 E-02 1.1 E-02 5.9 E-03 3.9 E-02 1.4 E-02 1.9 E-02 1.5 E-02 7.2 E-03 7.6 E-03 7.0 E-03 1.2 E-02 1.2 E-02 2.9 E-02 2.0 E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)S BEMATA AIR PARTI I.ATE FIIT<R Results in pCi/cubic meter LOCATION M COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-'05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/9S-07/13/98 07/l 3/98-07/20/98 07/20/98-07/27/98 07/27/9S-08/03/98 08/03/')S-QS/10/98 OS/l 0/98-08/17/98 08/l 7/')8-08/24/<)
1998REMPANNUALREPORT7-2 8.01M2VIPMH'ORT7<&RATACorrections toerrorsfoundinthe1997Radiological Environmental Monitoring ProgramAnnualReportarelistedbelow.Pae4-14Table4-2:Twostationsinnorthsectorhavewrongdistance.
8 08/24/98-08/3 l/98 08/51/94-09/()8/9S 09/QS/98-09/l a/98 09/l 4/98-09/2 l/98 09/2 l/98-09/28/98 9.1 1.4 1.8 2.7 8.3 1.7 3.6 3.8 8.5 8.7 1.0 1.6 4.3 7.0 3.6 1 2 1.3 2 Q 1.3 4.7 7.9 3.5 9.3 7.2 7.6 4.5 1.1 1.2 94 1.4 1.7 1.1 9.0 1.2 1.6 1.6 1.3 1.3 1.4 E-03 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2 P 2Q 1.6 2.1 2 P 1.6 1.9 1.9 1.9 2 P 2 P 1.7 1.9 1.8 2.0 2Q 2.0 2.0 1.8 1.6 1.8 2.0 1.8 1.7 1.7 2 P 2.0 1.8 2.0 2.0 2 P 2.0 2 P 2P 2 Q 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 LOCATION TABLE A-2.1 (Cont.)R BETA'IR P RTI Results in pCi/cubic meter COLLECTION PERIOD TE I ILTFR RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.2 E-02 7.4 E-03 6.0 E-03 , 2.9 E-02 1.1 E-02 1.7 E-02 1.0 E-02 7.1 E-03 4.7 E-03 3.7 E-03 6.0 E-02 1.2 E-02 1.9 E-02 2.0 E-03 1.8 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 1.9 E-03 1.5 E-03 1.7 E-03 2.0 E-03 2.0 E-03 TABLE A-2.1 (Cont.)8 8<TA N AIR PA.RTIC I AT<.FILT<R Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 Ol/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98
Station47andStation57shouldbothbe0.9milesand1448meters.Pae4-15Table4-2:Station65inthesouthsectorshouldread8.7milesand13999metersestimated distance.
, 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-OS/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/9S-OS/31/98 08/31/98-09/OS/98 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/98-09/28/98 1.1 1.0 1.9 3.4 1.7 42 5.6 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 1.5 4.7 4.5 9.7 1.0 2.2 9.6 8.8 3.9 9.0 8.2 5.9 4.6 9.9 7.3 8.9 1.1 1.5 9.7 7.1 9.3 1.6 1.7 9.8 1.1 1.3 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-02 6.8 E-03 1.0 E-02 9.2, E-03 2Q 2 P 2.0 1.6 2.1 2.0 1.6 2 1.8 2Q 2.0 2 P 1.7 1.9 1~9 1.9 2Q 3.0 1.9 1.7 1.6 1.9 2.0 1.8 1.6 1.7 2 1.8 1.8 2 P 2.0 2P 1.9 2 P 2.0 2 P 2.1 2.0 2 Q E-03 E-03, E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)vR BETA N AIR P RTI LAT i FILTER Results in pCi/cubic meter LOCATION COLLECTION
Pae5-14Table5-1:Meancesium-137 resultinannualsoil,previousoperational shouldread235.3pCi/kg.Pae5-16Table5-1:Meancesium-137 resultinriversediment, previousoperational shouldread317.8pCi/kg.8-11998REMPANNUALREPORT II WASHINGTON PUBLICPOWBR4NSUPPLYSYSTEMWASHINGTON PUBLICPOWERSUPPLYSYSTEMNUCLEARPLANT21998DATATABLESTABLESAandBJANUARY1toDECEMBER31,1998RADIOLOGICAL
'PERIOD RESULT OVERALL UNCERTAINTY 21 09/28/98-10/05/98 (a)10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6.E-02 1.2 E-02 5.7 E-03 4.0 E-02 1.5 E-02 2.1 E-02 1.4 E-02 8.0 E-03 7.9 E-03 6.0 E-03 1.3 E-02 1.4 E-02 2.8 E-02 2.0 E-03 2.0 E-03 1.9 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.8 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (n)Power off due to maintenance work.
%PA~ONV0~2TTALMONITORING PROGRAMPreparedbyJ.E.McDonaldandL.S.SchlederWashington PublicPowerSupplySystemRichland, WAandC.A.MendolaTeledyneBrownEngineering Environmental ServicesWestwood, NJ SI~gi5I 1SDATATABLESTABLEA'OVIINERESULTSTABLEB:SPECIALI&#xc3;ZERESTSAMPLERESULTSTABLEA'OUTINERESULTSA-1.11998Quarterly TLDResultsA-1.21998AnnualTLDResultsA-1.31998TLDResults-SummaryA-2.1GrossBetaOnAirParticulate FiltersA-2.2GrossBetaOnAirParticulate Filters-SummaryA-3.1GammaSpectrometry ofParticulate FiltersA-3.2GammaSpectrometry ofParticulate Filters-SummaryA-4.1I-131inCharcoalCartridges A-4.2A-5.1A-5.2A-6.1I-131inCharcoalCartridges
TABLE A-2.1 (Cont.)BETA N AIR PARTI I ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 23 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 , 1.4 2.2 4.7 8.9 1.8 3.2 49 6.9 1~2 8.8 1.4 6.6 6.3 4.9 1.3 1.2 2.2 2 4.5 92 3.9 1.1 7.9 6.7 4.8 1.0 1.3 2 1.4 1.6 1.3 8 2 9.S 1.8 2.2 1.5 1.3 1.3 E-02 E-02 E-02 E-03, E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-03 E-03 E-02 E-02 E-02 E-02 E-02 2 Q 2 P 2P 1.7 2.1 2.0 1.5 2.0 1.8 2.0 2.0 2.0 1.8 1.9 1.9 2 P 2.0 3.0 2.0 1.8 1.6 1.9 2 Q 1.8 1.7 1.7 2 P E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 2.0 2 P 2.0 2.0 1.9 2 Q 2.0 2P 2 P 2.0 2 Q E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 2.0, E-03 R BI<'.T TABLE A-2.1 (Cont.)AIR ARTI LATE I<'I<R Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 23 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.8 E-03 4.5 E-03 3.6 E-02 1.4 E-02 2.0 E-02 1.4 E-02 6.1 E-03 6.9 E-03 6.1 E-03 1.4 E-02 1.1 E-02 3.0 E-02 2.0 E-03 1.9 E-03 1.9 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 vR TABLE A-2.1 (Cont.)BETA AIR PARTI LATE FII TER Results in pCi/cubic meter LOCATION COLLECTION FERIOD RESULT OVERALL UNCERTAINTY 40 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/9S 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/9S 07/27/9S-OS/03/9S 08/03/9$-08/l 0/9S 08/l 0/9S-OS/l 7/9$0$/l 7/9$-0S/24/9$08/24/94-OS/~
-SummaryGrossBetainWaterGrossBetainWater-SummaryTritiuminWaterA-6.2TritiuminWater-SummaryA-7.1A-7.2A-8.1A-8.2A-9.1A-9.2A-10.1A-10.2A-11.1A-11.2A-12.1A-12.2GammaSpectrometry ofWaterGammaSpectrometry ofWater-Summary GammaSpectrometry ofSoilGammaSpectrometry ofSoil-SummaryGammaSpectrometry ofSedimentGammaSpectrometry ofSediment-SummaryGammaSpectrometry ofFishGammaSpectrometry ofFish-SummaryI-131inMilkI-131inMilk-SummaryGammaSpectrometry ofMilkGammaSpectrometry ofMilk-Summary I5 18DATATABLESA-13.1GammaSpectrometry ofBroadleaf inLieuofMilkA-13.2GammaSpectrometry ofBroadleaf inLieuofMilk-SummaryA-14.1GammaSpectrometry ofRootsA-14.2GammaSpectrometry ofRoots-SummaryA-15.1GammaSpectrometry ofFruitA-15.2GammaSpectrometry ofFruit-SummaryA-16.1GammaSpectrometry ofVegetables A-16.2GammaSpectrometry ofVegetables
l/t)ll 08/31/9$-09/0$/t)8 09/0$/9$-09/l 4/t)8 09/I 4/9$-09/2 l/9$09/2 l/9$-09/2$/9$1.1 1.3 1.9 3.8 8.7 1.6 5.3 5.3 6.8 1.1 8.8 1.4 7.1 7.8 5.2 1.1 1.1 2 Q 1.2 3.4 7.6 3.7 1.1 7.5 6.9 3.6 8.7 1.1 8.0 9.5 1.4 9.7 6.6 1.3 1.9 2.1 1.6 1.5 1.6 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-02 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2P 2Q 2.0 1.7 2.1 2P 1.7 2 Q 1.8 2 P 2.0 2 P 1.8 1.9 1.9 2.0 2.0 3.0 2.0 1.7 1.5 1.9 2 P 1.8 1.7 1.6 2.0 2 P 1.7 1.9 2 P 2.0 1.8 2.0 2.0 2P 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)R 8 HFT N AIR P RTI UIATE FI TiR Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 40 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6 E-02 9.4 E-03 7.5 E-03 3.7 E-02 1.2 E-02 2.0 E-02 1.1 E-02 7.2 E-03 7.5 E-03 6.2 E-03 1.3 E-02 1.4 E-02 2.8 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)BETA N AIR PARTI LATF.FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (a)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/9S-07/27/98 07/27/98-08/03/98 08/03/98-OS/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/9S-09/08/98 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/98-09/28/98 1 2 1.5 2.2 5.2 1.1 1.8 5.1 5.8 8.9 1.0'1.0'.8 5.4 7.6 5.1 1.2 1.3 2.2 1.1 6.0 5 4 4.7 8.8 6.7 6.2 4.6 8.3 1.4 1.1 1.3 1.9 1.3 8.3 2 1.8 1.9 1.4 1.2 1.6 E-02 E-02 E-02 E-03 E-02 E-02, E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2P 2.0 1.7 2.0 2.0 1.6 2.1 1.9 2.0 2.0 2.0 1.8 1.9 1.9 2 Q 2.0 3.0 2.0 1.9 8.0 2.2 1.9 1.7 1.7 1.7 2Q 2Q 2.0 2.0 2.0 2 P 1.9 2.0 2.0 2.0 2.0 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume due to unit failure.Denotes a result less than thc detection limit.Low sample volume due to unit failure.
-Summary
TABLE A-2.1 (Cont.)R BETA IR P RTI LATE<<II ER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 48 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-1 1/09/98 (a)11/09/98-1 1/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6 E-02 1.1 E-02 7.1 E-03 3.9 E-02 1.4 E-02 2.3 E-02 1.2 E-02 6.0 E-03 7.5 E-03 5.9 E-03 1.5 E-02 1.4 E-02 2.7 E-02 2.0 E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 9.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (a)Power off;low sample volume.Not included in averages.~
vR TABLE A-2.1 (Cont.)BFT W AIR PARTI ATF.FILTL<R Results in pCi/cubic mctcr LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 57 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 (8)05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.4 1.6 2.3 5.8 1.0 1.7 5.2 5.7 6.2 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 8.3 1.5 6.7 6.7 5 2 1.2 1.2 2.4 1.2 x 2 8 9.7 5.0 I 2 8.7 8.6 6.6 1.2 1.4 I.I 1.4 1.9 1.5 1.0 I.I 1.9 2.1 I.4 1.5 1.4 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 1.1'E-02 2Q 2 P 2.0 1.8 2.0 2.0 1.6 2.1 1.8 2 P 2 Q 2.0 1.8 1.9 1.9 2Q 2 Q 3.0 2 P 2.6 1.6 1.9 2P 1.8 1.8 1.8 2 P 2 P 2.0 2.0 2 P 2P 2 P 2 P 2.0 2 P 2 Q 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume.Denotes a result less than the detection limit.Low sample volume.
TABLE A-2.1 (Cont.)ROSS BETA N AIR PARTICUI ATI".I'II.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 57 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.3 E-02 1.1 E-02 6.9 E-03 4.0 E-02 1.5 E-02 2.1 E-02 1.4 E-02 8.1 E-03 7.8 E-03 7.4 E-03 1.3 E-02 1.3 E-02 2.5 E-02 2.0'E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.8 E-03 2.0 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.2'RO S BETA ON'AIR PARTI I.ATE FII.TERS-8 MMARY Results in pCi/cubic mctcr NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Gr-Beta (I)Gr-Beta (C)1.17E-02 1.06E-02 1.7E-03 2.7E-03 4.3E-02 29E 02 572 52 569 52 L (I)Indicator Stations (C)Control Station TABLE A-3.1 AMMA PE TR METRY F PARTI Results in pCi/cubic meter LATF.FILTER LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.12"-1.22"'.21<292"-2.52": 193"'-1.17" 5.03 9.17~5.97":-1 59"'.94 x-1 71 x 2P9"-8.44" 3.73 E-02 E-03 E-04 E-04 E-04 E-04 E-03 E-04 E-02 E-04 E-04 E-04 E-04 E-05 E-04 E-05 7.89 3.00 5.61 2.09 2.30 2.30 3.92 3.61 1.04 2.79 7.50 1.96 2.03 1.93 3.53 3.27 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 06/29/98-09/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 1.62": 1.19"':-4.30 E-pl E-03 E-04": 8.53" 1.07%-2.35"505 E-05 E-04 E-03 E-04~-1.82 E-04 1.12 2.83 6.28 1.64 1.90 1.89 3.40 3.35 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-I 34.Cs-137 Ra-226 Th-228 7.05~2.84"-1.94":-9.86~9.29'7 la~22P*-7.21 E-02 E-04 E-04 E-04 E-05 E-04 E-03 E-05 8.26 3.04 6.04 2.07 2.14 2.08 3.67 3.39 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than'the detection limit.
TABLE A-3.1 (Cont.)XAAM A PE TR METRY F PARTI I.ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-l06 Cs-I 34 Cs-137 R;t-226 TI)-228 6.79*-1.10~1.14"'-1.44" 8.32"'.77":-1.23" 4.26 9.79"'.26 3 9P"-3.41"-1.46"-I 08"-3.08"'-3.27 1.62 6.I 8"QPQ': (S.63" 6.90"-I 3 I 1.3()I 09 x'(7g ((9" 1.99'" I 46"'-I&#xc3;9 x-3.66 E-02 E-03 E-04 E-03 E-05 E-05 E-03 E-04 E-02 E-04 E-04 E-04 E-04 E-04 E-03 E-04 E-01 E-03 E-04 E+00 E-06 E-05 E-03 E-04 E-0" E-03 E-04 F-04 E-04 E-04 E-04 E-04 6.50 4.20 5.53 1.77 2.37 2.07 2 74 2.61 9.33 2.19 6.1 1 1.58 1.67 1.59 3.81 3.23 9.96 2.28 5.87 1.51 1.55 1.47 2.66 2.57 7.99 6.29 7.19 2.30 2.72 2.50 3.40 3.13 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc detection limit.
+AMMA PE TR TABLE A-3.1 (Cont.)METRY F PARTI I ATE FII TERS Results in'pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 CG-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 7.06"'-6.99&113": 1.57 x x 3$9":-3.76":-1.83 9.25":-2.17"-4.06 19": 6.57 I 39'":-7.65 x 432 1.48" 1.93": 1.84"'.18": 0.00" 9.89 x gp5"'.37 8.58 A 4'73 A'7P9"" ppp'": 2.70": 1.84"-2.33 x 571 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-05 E-03 E-05 E-04 E-04 E-05 E-pl E-03 E-04 E-05 E+00 E-05 E-03 E-04 E-02 E-04 E-04 E+00 E-05 E-04 E-03 E-04 7.00 5.57 6.08 2.34 2 4P 57 3.35 2.96 8.17 4.04 6.61 1.93 2.16 1.92 2.44 2.55 9.50 4.05 6.14 1.84 2.04 1.89 2.54 2.62 9.14 2.21 5.44 1.71 1.86 1.69 3.14 3.19 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit.
AM A PF TR TABLE A-3.1 (Cont.)METRY F PARTI LATE FII.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.77"-4.07" 1.39" 1.97*1.07":-1.08*-4.07~-1.37 1.02 4.77" 2.50":-1.07": 303"-2.58"-1 9Q"666 1.36" 146":-2.39"-5.67 x 751 A 1.00":-1.44"'-8.76 8.80" 1.83":-3.69": 8.74"000" 1.18"3.38'7 PQ E-02 E-04 E-04 E-04 E-04 E-04 E-04 E-04 E-01 E-03 E-04 E-03 E-05 E-04 E-03 E-04 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-05 E-02 E-04 E-04 E-04 E+00 E-04 E-04 E-05 8.20 3.00 4.62 1.71 1.77 1.60 3.19 2.88 9.28 1.94 6.83 1.86 1.86 2.14 3.06 3.05 9.10 2.62 5.49 1.43 1.46 1.46 2.52 2.53 7.09 3.46 5.13 1.76 1.78 1.74 2.44 2.39 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit.
TABLE A-3.1 (Cont.)GRAMMA SPECTR METRY F PARTI I ATE FILTER Results in pCi/cubic rnetcr COLLECTION LOCATION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/28/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-128 Be-7 K-40 Ru-l03 Ru-106 Cs-134 Cs-137 R:t-226 I h-228 6.65":-1.37": 3.91": 2.70":-6.44"'.53": 853 2.23 9.99": 135"-2.45"-1.02"-8.85 x 716"-2.54~-7.26 1.35": 1.76" 3.70*9.73":-7.65 x'7 14":-6.04": 5.03 7.77"'-8.14"-1.35"'.06'1.37":-8.84<<-3.04":-2 43 E-02 E-03 E-05 E-04 E-05 E-04 E-04 E-04 E-02 E-03 E-04 E-03 E-06 E-06 E-03 E-05 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-05 E-02 E-04 E-04 E-04 E-05 E-05 E-04 E-04 5.79 349 4.61 1.65 1.84 1.79 2.46 2.41 9.10 2.96 6.52 1.93 2.06 1.92 2 40 2.48 9.08 2.94 6.00 1.89 2.02 1.95 2.35 2.40 9.37 3.12 5.71 1.89 1.89 2.10 3.70 3.55 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc detection litnit.
TABLE A-3.1 (Cont.)rAMMA SPE TR METRY F PARTI I ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 8.12": 1.58":-9.56 x 3 0'7~1.50"-1.77 x 2pg x 552 8.73 x 6+4 x 8/7" 9.51~8.31"-2.01"-7.13" 1.66 1.37"''3.00": 3.19"-4.39"-1.65"'.26*-1.18": 474 8.62 4.65":.-1.66": 1.79 2 42" 1.46"-1.50~3.08 E-02 E-03 E-05 E-04 E-04 E-04 E-03 E-05 E-02 E-04 E-05 E-04 E-05 E-04 E-04 E-05 E-01 E-03 E-04 E-04 E-05 E-04 E-04 E-04 E-02 E-03 E-04 E-04 E-05 E-04 E-03 E-04 8.35 2.92 5.46 1.97 2.20 2.08 3.69 3.50 8.03 2.61 6.41 1.54 1.66 1.87 2.78 2.68 8.89 2.79 6.01 1.71 1.87 2.06 2.88 2.92 8.36 2.69 5.18 1.73 1.87 1.90 3.37 3.06 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit.
TABLE A-3.1 (Cont.)AMMA PFCTR METRY F PARTI Results in pCi/cubic mctcr LATE FILTER LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9A 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 6.87 x g 99"-3.04"-1 95"'.19"'.29 x 402"'.69 9.71~2.74 x 25'7"'.1.12 x 455 x 1 8'7"-9.89~-8.60 1.48":-3.46"-5.05"-1.02 337 154": 973": 935 6.76"'-3.85"ppp" 7.49" 0.00" 9.89 x 6+9": 6.00 E-02 E-04 E-04 E-04 E-04 E-04 E-03 E-05 E-02 E-03 E-04 E-03 E-05 E-05 E-06 E-05 E-pl E-03 E-05 E-03 E-05 E-04 E-04 E-04 E-02 E-04 E+00 E-04 E+00 E-05 E-04 E-04 8.46 3.19 6.27 1.95 2.32 2.10 3.87 3.46 1.10 6.00 9.47 2.57 2.85 2.59 3.48 3.50 1.19 6.23 9.12 2.56 2.68 2.62 3.69 3.82 7.20 2.55 4.73 1.64 1.60 1.57 3.81 3.46 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes n result less than the dctcction limit.
+AMMA PE TR TABLE A-3.1 (Cont.)METRY F PARTI ULATE<FIL'TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 21 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Ci-137 Rtt-226 I'l-228 6.05": 9.76~3.65":-2.06": 1.48~-8.78*-3.05 x 1.00 1 9'7" 2.29": 8.06 x 3'98~-1.06"145" 5.43 1.38'": 3.12'"'.85'09 7><)7.90 E-02 E-04 E-04 E-04 E-04 E-05 E-03 E-04 E-01 E-03 E-04 E-04 E-05 E-05 E-03 E-04 E-01 E-04 E-04 E-04 E-05 E-05 E-04 E-04 E-02 E-03 E-04 E-04 E-06 E-05 E-04 E-04 6.60 4.27 5.45 1.94 2.25 2.01 2.68 2.59 1.02 3.42 7.80 1.91 1.96 1.93 3.74 3.40 1.13 3.07 6.96 1.96 1.95 1.93 3.64 3.40 6.79 3.95 5.44 1.80 2.00 1.88 2.37 2.57 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit.
TABLE A-3.1 (Cont.)AMMA SPECTROMETRY OF PARTICUI,ATE FII.TERS Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL'NCERTAINTY 23 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-l3 7 R't-226 Th-228 6.96":-I 36 x 373": 8.08 x+87": 1.48":-1.49": 2.71 9.81 2.74":-8.17":-1.60":-3.15"645":-1.22":-8.82 1.28"-5.57 x 577 x'734 x 543": 8.73":.-~79':-3.28 6.50 x$09'2.00<<524"-1.30'":-9.61 x 1+5" 5.00 E-02 E-02 E-04 E-04 E-04 E-05 E-03 E-04 E-02 E-02'-05 E-03 E-05 E-06 E-03 E-05 E-pl E-04 E-04 E-03 E-05 E-05 E-03 E-05 E-02 E-03 E-05 E-04 E-04 E-05 E-04 E-04 7.06 5.29 6.26 2.20 2.59 2.34 3.35 3.08 9.58 4.94 8.10 2.20 2.43 2.24 2.91 2.81 1.00 4.80 8.20 2.19 2.40 2.1 I 2.77 2.90 7.17 2.71 5.57 1.80 1.89 2.26 3.06 2.89 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc dctcction limit.
GRAMMA PECTR TABLE A-3.1 (Cont.)METRY F PARTI LATE FILTERS Results in pCi/cubic mctcr LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 40 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103'u-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 CN-137 Ra-226 Th-228 Be-7 K-40 Ru-I 03 Ru-l06 Cs-l34 Cs-l37 R;t-226 Th-228 8.63"-1.76"-1.65*1.48'.88"-1.08" 3.16*-8.86 1.07+419 x-3 57"-1.10 x 7/8 x 152~-4.31 x 449 1.73 pg" 1.54"'.08 x 55/'"'.89 x')19"'" 1.00 7.62" 7.06:.ppp'00'"'-5.06'" 6.20"'.20"'.52 E-02 E-03 E-04 E-03 E-04 E-05 E-03 E-05 E-pl E-04 E-05 E-04 E-05 E-04 E-04 E-04 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-03 E-02 E-04 E+00 E+00 E-05 E-05 E-04 E-04 8.13 2.63 4.59 1.77 2.07 1.78 3.18 2.99 1.08 3.18 7.1 1 1.89 2 02 2.07 3.62 3.52 1.24 2.76 7.28 1.78 2.10 2.07 3.49 3.84 7.06 3.09 5.10 1.76 1.88 1.78 2.37 2.33 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Dcnotcs a result less than thc dctcction litnit.
GAMMA SPECTR TABLE A-3.1 (Cont.)METRY Ol PARTICUI ATE FILTERS Results in pCi/cuhic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 7.62 x'757":-2.66"'-2.71"-7.16*0.00"'.62":-6.09 E-02 E-03 E-05 E-04 E-06 E+00 E-03 E-06 6.34 3.64 4.59 1.69 1.92 1.70 2 47 2.35 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 03/30/98-06/29/98 Be-7 K-40 RU-103 Ru-106, Cs-134 Cs-137 Ra-226 Th-228 8.86 6.79"-I P4" 1.83 x g 34"-I 50"'-1.27 E-02 E-03 E-04 E-03 E-05 E-04 E-03 E-04 E-03 E-04 E-04 1.48 1.69 1.67 2.72 2.55 E-03 E-04 8.21 E-03 2.92 E-03 5.89 E-04 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-l06 Cs-134 Cs-I 37 Rtt-226 Th-228 Be-7 K-4()I(tt-I 03 Rtt-l()6 ('i-I 34 (i-l 37 I<:t-22(i I'It-228 1.50": 648 v.3'35" 5.95" I.l I": 6.36':.1.67'"-9 40 7.56:.1.75'3.54'I.19'"" 7.88".I.90'2.18':-5.51 E-01 E-04 E-04 E-05 E-04 E-05 E-03 E-07 E P2 E-03 E-05 E-03 E-05 E-04 E-03 E-05 8.62 2.48 4.91 1.34 1.52 1.47 2.56 2 40 7.67 2.85 5.53 1.59 1.79 2.15 2 84 2.70 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the tleteetion lintit.
GAMMA SPE TR TABLE A-3.1 (Cont.)ETRY F PARTI UI ATF.FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 57 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.60": 1.19~7.30 x"546": 443":-3 79"'-1.42 9.90":-3.81 x 466 x 1+9 x": 757"-4 64"'.38 1.34":-5 93":-4 30"ppp":-1 30": 8.40""-" 04": 1.49 7.87'": 7.59 x" 0.00":-8.96":-9.07": 3.90": 3.37 E-02 E-03 E-05 E-03 E-05 E-05 E-04 E-04 E-02 E-03 E-05 E-03 E-04 E-05 E-03 E-04 E-01 E-03 E-04 E+00 E-04 E-05 E-03 E-04 E-02 E-04 E-04 E+00 E-05 E-05 E-03 E-04 8.40 2.93 5.43 1.85 2.06 2.09 3.67 3.47 9.34 4.82 8.48 2.12 2.25 2.19 2.81 2.96 1.01 4.44 7.15 2.08 2.20 2.15 2.85 2.90 9.49 6.22 7.96 2.50 2.85 2.56 3.58 3.62 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit.
TABLE A-3.2 (Cont.)C" AMMA PE TR MIs TRY OF PARTI I.ATE FILTERS-


1998DATATABLTABLEB:SPECIALINTERESTSAMPLERESULTSB-2.1GammaSpectrometry ofStormDrainWaterB-2.2GammaSpectrometry ofStormDrainWater-SummaryB-3.1GrossBetainStormDrainWaterB-3.2GrossBetainStormDrainWater-SummaryB-4.1TritiuminStormDrainWaterB-4.2TritiuminStormDrainWater-SummaryB-5.1GammaSpectrometry ofStormDrainSedimentB-5.2GammaSpectrometry ofStormDrainSediment-SummaryB-6.1B-6.2B-7.1B-7.2B-8.1B-8.2B-9.1B-
==SUMMARY==
Results in pCi/cubic meter NUCLIDE NUMBER AVERAGE LOW NUMBER HIGH SAMPLES POSITIVE Be-7 (I)Be-7 (C)9.83E
'2/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/9S 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98
'2/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/9S 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98
'.7.94x4'83A'704"-3.07"000"'.78"1.81"-2.07'":2.63"1.48+9.63"-3.77"-5.21"5.79~1.44"3.09"'-3.90"8.68"-1.50x354":-5.09--2.84*1.11":1.73":2.68x":-4.48":-6.87":.2.46x+30'2.38'"-I.12"4.68"'.03":-3.33"-R85<-3.39x961E-04E-03E-03E-03E+00E-04E-03E-03E-03E-03E-04E-03E-04E-04E-03E-03E-03E-04E-03E-04E-03E-03E-03E
'.7.94 x 4'83 A'704"-3.07"000"'.78" 1.81"-2.07'": 2.63" 1.48+9.63"-3.77"-5.21"5.79~1.44" 3.09"'-3.90" 8.68"-1.50 x 3 54":-5.09--2.84*1.1 1": 1.73": 2.68 x":-4.48":
-10/21/98-10/29/98 11/06/98-11/12/98 11/12/98-11/72/98
-10/21/98-10/29/98 11/06/98-11/12/98 11/12/98-11/72/98
":2.8xI8xI8":1.99.37.33.6"'.02.63.775.2xI93.1x23x293.234"2.8x423.89":303.04.74278":1.63.0757":2.634":3.25.6344.83.5":1.74.65.8E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E-01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+002.08E+002.01E+002.05E+002.06E+001.70E+002.8E+002.5E+001.9E+001.96E+001.7E+002.2E+001.68E+002.2E+002.02E+002.1E+002.00E+002.07E+001.9E+002.1E+002.05E+005.42E+001.9E+001.98E+001.73E+002.1E+002.0E+001.9E+002.47E+001.89E+002.0E+002.01E+001.89E+002.06E+002.42E+00241E+002.5E+002.41E+002.1E+002.0E+002.05E+002.3E+002.3E+00(a)Grabsample;grossbetaanalysisnotperformed.
": 2.8 x I 8 x I 8": 1.9 9.3 7.3 3.6"'.0 2.6 3.7 7 5.2 x I 9 3.1 x 2 3 x 29 3.2 34" 2.8 x 4 2 3.8 9":30 3.0 4.7 4 2 7 8": 1.6 3.0 7 5 7": 2.6 3 4": 3.2 5.6 3 4 4.8 3.5": 1.7 4.6 5.8 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 2.08 E+00 2.01 E+00 2.05 E+00 2.06 E+00 1.70 E+00 2.8 E+00 2.5 E+00 1.9 E+00 1.96 E+00 1.7 E+00 2.2 E+00 1.68 E+00 2.2 E+00 2.02 E+00 2.1 E+00 2.00 E+00 2.07 E+00 1.9 E+00 2.1 E+00 2.05 E+00 5.42 E+00 1.9 E+00 1.98 E+00 1.73 E+00 2.1 E+00 2.0 E+00 1.9 E+00 2.47 E+00 1.89 E+00 2.0 E+00 2.01 E+00 1.89 E+00 2.06 E+00 2.42 E+00 2 41 E+00 2.5 E+00 2.41 E+00 2.1 E+00 2.0 E+00 2.05 E+00 2.3 E+00 2.3 E+00 (a)Grab sample;gross beta analysis not performed.
Denotesaresultlessthanthcdctcction limit.
Denotes a result less than thc dctcction limit.
TABLEB-3.1(Cont.)RSBETAINTORMDRAINWATERResultsinpCi/liter LOCATIONCOLLECTION PERIODRESULTOVERALLUNCERTAINTY 10111/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/18/98 12/21/98-12/29/98 3.9E+00"'.1E+004.1E+004.7E+00"5.8E-012.1E+001.88E+002.0E+002.0E+005.61E-01Denotesaresultlessthanthcdctcction limit.
TABLE B-3.1 (Cont.)R S BETA IN TORM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 11/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/18/98 12/21/98-12/29/98 3.9 E+00"'.1 E+00 4.1 E+00 4.7 E+00" 5.8 E-01 2.1 E+00 1.88 E+00 2.0 E+00 2.0 E+00 5.61 E-01 Denotes a result less than thc dctcction limit.
TABLEB-3.2+ROSSBETAINSTRMDRA'INWATER-SUMMARYResultsinpCi/liter NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEStation101-OutfallGrossBeta(I)3.27E+003.0E-019.3E+004722g)Indicator Stations II TRIITABLEB-4.1INTRMDRAIResultsinpCi/liter WATERLOCATIONCOLLECTION PERIODRESULTOVERALLUNCERTAINTY 10112/29/97-01/07/98 Ol/16/98-01/26/98 01/29/98-02/10/98 02/10/98-02/16/98 02/19/98-02/26/98 03/02/9803/03/9803/05/98-03/10/98 03/13/98-03/19/98 03/23/98-04/03/98 04/09/98-04/17/98 04/21/98-04/23/98 04/23/98-04/24/98 04/24/98-05/03/98 05/07/98-05/09/98 05/13/98-05/15/98 05/19/98-05/23/98 05/28/98-06/03/98 06/05/98-06/10/98 06/15/98-06/17/98 06/17/9806/17/98-06/18/98 06/18/98-06/24/98 06/25/98-07/01/98 07/02/98-07/06/98 07/09/98-07/15/98 07/17/98-07/22/98 07/23/98-07/26/98 07/31/98-08/04/98 08/05/98-08/l I/9808/11/98-08/16/98 08/17/98-08/21/98 08/24/98-08/3 l/9809/03/98-09/10/98 09/10/98-09/17/98 09/17/98-09/70/98 09/24/98-09/28/98 10/01/98-10/08/98 10/09/98-10/18/98 10/19/98-10/70/98 10/21/98-10/79/98 (a)(a)(b)(c)1.21.59.51.13.8X+597*-2.32.9"2.8*2.61.7*-7.1*7.0"2.8*-2.838"2.4x47'755'7x55"7.325"403"5.8l.6"').0"8.5"1.03.03.7"4.12.7'"8.8E+03E+03E+02E+03E+02E+02E+01E+00E+00E+02E+01E+OI~E+02E+02E+00E+01E+01E+01E+01E+00E+01E+00E+01E+01E+01E+01E+02E+01E+01E+01E+02E+01E+01E+02E+02E+02E+O1E+02E+Ol2.02.02.32.01.09.18.88.55.91.09.69.211.09.658.369.268.489.S69.519.388.929.618.829.168.658.591.09.119.028.979.09.951.701.711.81.81.051.11.76E+02E+02E+02E+02E+02E+01E+01E+01E+01E+02E+01E+01E+02E+01E+OlE+01E+01E+01E+01E+01E+01E+00E+01E+01E+01E+01E+02E+01E+01E+01E+01E+01E+02E+02E+02E+02E+02E+02E+02(a)Grabsample(b)Grabsample;tritiumanalysisnotpcrformcd.
TABLE B-3.2+ROSS BETA IN ST RM DRA'IN WATER-
(c)Tritiumanalysisnotpcrformcd.
Dcnotcsaresultlessthanthcdctcction limit.
TABLEB-4.1(Cont.),TRITIUMINSTRMDRAINWATFRResultsinpCi/liter LOCATIONCOLLECTION PERIODRESULTOVERALLUNCERTAINTY 10111/06/98-11/12/98 11/12/98-11/22/98 11/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/19/98 12/21/98-12/29/98 6.0E+024.5E+025.9E+025.4E+022.1E+021.0E+033.7E+031.3E+021.8E+021.8E+021.3E+021.1E+021.0E+022.0E+02 TABLEB-4.2TRITIUMINTRMDRAINWATER-8MMARYResultsinpCi/liter NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEtation101-utfallH-3(I)3.25E+02-5.2E+013.7E+0346190)Indicator Stations IlIII STORMDRAINVEGETATION RESULTS I
TABLEB-7.1AMMAPETRMETRYFTRMDRAINVEvETATINResultsinpCi/kilogram LOCATION101COLLECTION PERIOD08/17/98NUCLIDEBe-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228RESULT*1.23E+023.02E+03*2.24E+00"1.05E+00*2.43E+00A-3.78E+00*2.68E+01*6.59E+00*1.75E+01*-1.48E+01*-1.21E+00*-4.97E+00*-5.87E+00,*-3.21E+01+4.44E+01OVERALLUNCERTAINTY 1.25E+022.60E+021.28E+011.32E+012.83E+011.26E+012.85E+012.59E+011.34E+011.38E+011.42E+015.28E+011.94E+012.38E+022.08E+01Dcnotcsaresultlessthanthedetection limit.
TABLEB-7.2+AMMAP<TRME<TRYITRMDRAIVEETAIResultsinpCi/kilogram NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEBe-7(I)K-40(I)Mn-54(I)Co-60(I)Co-58(I)Cs-134(I)Cs-137(I)Nb-95(I)Zr-95(I)Zn-65(I)Fe-59(I)Ba-140(I)La-140(I)1.23E+02'.02E+032.24E+00-3.78E+00 1.05E+00-1.48E+01
-1.21E+00 1.75E+01.6.59E+002.68E+012.43E+00-4.97E+00
-5.87E+00 1.23E+023.02E+032.24E+00-3.78E+00 1.05E+00-1.48E+01
-1.21E+00 1.75E+016.59E+002.68E+012.43E+00-4.97E+00
-5.87E+00 1.23E+023.02E+032.24E+00-3.78E+00 1.05E+00-1.48E+01
-1.21E+00 1.75E+016.59E+002.68E+012.43E+00-4.97E+00
-5.87E+00 0(I)Indicator Stations TABLEB-5.1CAMMASPECTRMETRYFTRMDRAINSEDIMENTResultsinpCi/kilogram LOCATION101COLLECTION PERIOD03/25/9806/18/98NUCLIDEK-40Co-57Co-60Zn-65Co-58Mn-54Cs-134Cs-137CG-141Ra-226EU-152Th-228K-40Co-57Co-60Zn-65Co-58Mn-54Cs-134Cs-137Ce-141Ra-226Eu-152Th-228RESULT4.49E+03":-4.27E+002.07E+02"9.05E+00"-7.10E+00"'.06E+00"5.17E+003.80E+01~1.51E+008.10E+02"3.64E+013.63E+025.22E+03":-2.07E+001.40E+02"5.63E-OI"'-8.68E+00"'.12E-01":1.92E+014.44E+01":6.72E+008.41E+02*2.23E+014.34E+02OVERALLUNCERTAINTY 1.79E+025.32E+001.36E+011.50E+015.68E+005.78E+006.44E+008.55E+001.00E+011.55E+022.66E+011.41E+011.89E+025.26E+001.18E+011.31E+015.23E+005.73E+006.39E+008.54E+009.30E+001.50E+022.67E+011.85E+01Denotesaresultlessthanthcdetection limit.
TABLEB-5.2AMAPETRMETRYFTRMDRAINEDIME<NT-ResultsinpCi/kilogram ARYNUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEtation101-tttfa)1K-40(I)Mn-54(I)Co-57(I)Co-58(I)Co-60{I)Zn-65(I)Cs-134{I)Cs-137{I)Ce-141{I)RR-226(I)Eu-152{I)Th-228(I)4.86E+031.59E+00-3.17E+00
-7.89E+00 1.74E+024.81E+001.22E+014.12E+014.12E+008.26E+022.94E+013.99E+024.49E+031.12E-01-4.27E+00
-8.68E+00 1.40E+025.63E-015.17E+003.80E+011.51E+008.10E+022.23E+013.63E+02'.22E+033.06E+00-2.07E+00
-7.10E+00 2.07E+029.05E+001.92E+01444E+016.72E+008.41E+023.64E+014.34E+022(I).Indicator Stations TABLEB-6.1AMAPETRMETRYF7RMDRAINIIResultsinpCi/kilogram LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 101A101B101A101B101A03/25/9803/25/9806/30/9806/30/9809/17/98Be-7K-40Mn-54Cs-134Cs-137Ra-226Th-228Be-7K-40Mn-54Cs-134Cs-137Ra-226Th-228Be-7K-40Mn-54Cs-134Cs-137Ra-226Th-228Be-7K-40Mn-54Cs-134Cs-137Ra-226Th-228Be-7K-40Mn-54Cs-134Cs-137Ra-226Th-2281.101.55":8.35"2.683.647.965.481.04149*4.18+2.783.676.894.941.011.54*2.75+2.923.028.355.251.851.46"3.36*2.473.086.775.041.341.47*6.42"'.313.307.821.68E+02E+04E-02E+01E+01E+02E+02E+02E+04E+00E+01E+01E+02E+02E+02E+04E+00E+01E+01E+02E+02E+02E+04E+00E+OlE+01E+02E+02E+02E+04E+00E+01E+01E+02E+025.832.755.456.486.951.531.475.762.925.746.497.461.581.495.863.086.067.096.321,511.597.263.276.867.648.631.731.636.972.956.327.317.271.552.10E+01E+02E+00E+00E+00E+02E+01E+01E+02E+00E+00E+00E+02E+01E+01E+02E+00E+00E+00E+02E+01E+01E+02E+00E+00E+00E+02E+01E+OlE+02E+00E+00E+00E+02E+01Denotesaresultlessthanthedetection limit.
TABLEB-6.1AMAPETRME<TRYFTRMDRAIIIResultsinpCi/kilogram LOCATION101BCOLLECTION PERIOD09/17/98NUCLIDEBe-7K-40Mn-54Cs-134Cs-137Ra-226Th-228RESULT1.81E+021.62E+04"4.44E+00*1.65E+012.99E+018.85E+025.61E+02OVERALLUNCERTAINTY 7.55E+013.10E+026.09E+007.13E+007.78E+001.64E+021.62E+01Dcnotcsaresultlessthanthcdctcction limit.
vATABLEB-6.2PKTRMETRYFTRMDRAINII-ResultsinpCi/kilogram ARYNUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEBe-7(I)K-40(I)Mn-54(I)Cs-134(I)Cs-137(I)1.36E+021.52E+043.54E+002.47E+013.28E+01Th-228(I)4.67E+02Ra-226(I)'.77E+021.01E+021.46E+048.35E-02.
1.65E+012.99E+016.77E+021.68E+021.85E+021.62E+046.42E+002.92E+013.67E+018.85E+025.61E+02(I)Indicator Stations TABLEB-8.1RALPHAINANITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODRESULTOVERALLUNCERTAINTY 102A102CPriortoDischarge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/9805/20/9810/21/9810/21/98*1.5E+00*2.5E-01*2.2E-01*1.4E+00*-8.5E-01*1.0E+00*0.0E+00*4.9E-01*2.0E-01+1.9E+00*6.4E-01*0.0E+00*6.8E-01*2.4E+00A6.4E-01*0.0E+001.61E+001.79E+001.58E+002.02E+001.04E+001.43E+001.71'E+001.54E+001.23E+001.74E+001.55E+002.86E+001.36E+002.45E+001.13E+009.54E-01Dcnotcsaresultlessthanthc.dctcction limit.
TABLEB-8.2PROSAlPHAINANITARYWATETREATMENT WATER-MMARYResultsinpCi/liter NUCLIDEAVERAGELOW102AHIGHNUMBERNUMBERSAMPLESPOSITIVEGr-Alpha(I)5.63E-01-8.5E-011.9E+0012Gr-Alpha(I)5.90E-01102-PriortoDisehare-6.8E-012.4E+00g)Indicator Stations TABLEB-9.1RSBETAISNITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODRESULTOVERALLUNCERTAINTY 102A102CPriortoDischarge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/01/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/9805/20/9810/21/9810/21/983.2E+013.1E+012.1E+012.9E+012.4E+014.1E+013.6E+013.5E+011.7E+012.9E+012.5E+013.3E+013.2E+013.3E+014.1E+014.1E+012.0E+002.0E+002.0E+002.0E+002.0E+003.0E+003.0E+003.0E+002.0E+002.0E+002.0E+004.0E+004.0E+004.0E+003.0E+003.0E+00 TABLEB-9.2RBETANANITARYWA TETETENTWATER-ARYNUCLIDEAVERAGEResultsinpCi/liter LOWHIGHNUMBERNUMBERSAMPLESPOSITIVE102AGr-Beta(I)2.94E+011.7E+014.1E+0112122-PriortoDichareGr-Beta(I)3.65E+013.2E+014.1E+01(I)Indicator Stations AMMPETRMETRYTABLEB-1p.IFANITARYWTETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIOD'UCLIDE RESULTOVERALLUNCERTAINTY 102BMonthlyHeadworks 01/21/9802/25/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228*-7.545.68*1.03A-6.05"1.73"1.69*2.07"-2.26*6.50*-4.40"8.65"2.93*-2.47+-4.64"-5.88xppp*2.00*-1.80199*2.07*7.2314"-1.91x7243593'71"-9.3535"-4.25'719E-01E+01E+00E-01E+00E+00E+00E+00E-01E-01E-plE+00E-01E+OlE-01E+00E+01E+00E-01E+00E-01E-01E-01E-01E-02E+00E-01E-01E+01E-011.702.841.831.863.901.813.893.611.862.031.996.472.473.653.091.312.201.391.402.931.573.182.701.441.591.834.311.893.342.73E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00Denotesaresultlessthanthedetection limit.
TABLEB-10.1(Cont.)AMAPETRMETRYFAITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102BMontMyHeadworks03/18/9804/15/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140,Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228":370&#xb9;-L68":5.38&#xb9;-6.21*'7.60*-9.79*-1.20"-1.49*2.29*1.68*1.06&#xb9;-3.638-6.54*-2.17*-3.93"1.09"-5.19"5.57*-7.82"1.32":5.09"'.2.19&#xb9;3.34&#xb9;1.86&#xb9;-1.22x124"-6.58"-1.97&#xb9;-1.35E+00E+01E-01E-01E-01E-01E+00E-01E+00E-01E+00E+00E-01E+01E-01E+01E+01E-01E-01E+00E-01E+00E+00E+00E+00E+00E-01E+00E+01E-021.312.751.461.433.031.482.992.891.471.641.634.461.752.982.611.382.881.481.483.011.473.192.901.461.641.664.591.743.082.56E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00&#xb9;Denotesaresultlessthanthedetection limit.
TABLEB-1p.1(Cont.)AMMAPECTRMETRYFANITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102DNorthStabilization Pond05/12/9811/17/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"ppp":-3.98"-2.73"-5.02"ppp":8.67"2.06":2.44":8.63":9794995*3.18":-1.28":-5.27"-6.03*1.72x193"'-6.54":-1.21":2.94":2.00"-105"41P"'.95"'-1.77"'.39":4.38"-2.18":-1.48"-2.96E+00E+00E+00E-plE+00E-01E+00E+00E-02E-02E-01E+00E+00E+00E-01E+01E+00E-01E+00E+00E-01E+00E+00E+00E+00E+00E+00E+00E+02E+001.50E+012.27E+011.44E+001.56E+003.27E+001.65E+003.24E+003.05E+001.51E+001.71E+001.74E+005.23E+002.05E+004.01E+013.11E+001.85E+013.26E+011.97E+001.96E+004.30E+001.91E+004.29E+004.00E+002.08E+002.17E+002.28E+007.35E+002.80E+003.49E+013.20E+00Denotesaresultlessthanthedctcction limit.
TABLEB-10.1(Cont.)AAPETRME<TRYFANITARY%TE<TRAMENT&ATResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102ESouthStabilization Pond05/12/9811/17/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-l40Ra-226Th-228*-3.61*1.15*1.39"3.82*1.41"-2.70*1.89*-7.31~1.48*1.31*1.31*2.14*-2.09*-5.33+-6.294931*-9.06*-7.19"-1.25*5.37*9.46"1.83'-1.89"'.27*-7.75"1.60":1.26"-7.19":-1.16'6.57E+00E+01E+00E-02E+00E+00E-01E-01E+00E+00E+00E+00E+00E+01E+00E+00E+01E-02E+00E+00E-01E+00E+00E-01E-01E+00E+00E-01E+02E-011.25E+011.94E+011.26E+001.30E+002.56E+001.26E+002.66E+002.70E+001.35E+001.39E+001.54E+004.31E+001.72E+003.34E+012.80E+002.06E+015.01E+012.14E+002.23E+004.81E+002.11E+004.93E+004.45E+002.31E+002.29E+002.37E+009.22E+003.50E+004.18E+013.55E+00Denotesaresultlessthanthcdctcction limit.
vAMMATABLEB-10.1(Cont.)TRMETRYFANITRYWATETREATETWTERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102A01/06/98-02/03/98 02/03/98-03/03/98 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228~-3.51"6.84*-6.26*-8.01~1.21*9.05*1.16~7.94+2.46*-1.18*1.16"-1.44*7.59+-7.28*-8.49*6.56*1.28*1.14*5.09*2.96~5.26*-4.51+-2.61*3.32*1.82~195*1.96"-6.36*-7.53*8.08E-01E+00E-01E-01E+00E-01E+00E-01E+00E-01E+00E+00E-01E+01E-02E+00E+01E+00E-01E+00E-01E+00E-01E+00E-01E-01E+00E-01E+01E+001.10E+011.69E+011.22E+001.23E+002.65E+001.39E+002.66E+002.40E+001.27E+001.35E+001.34E+003.92E+001.77E+002.34E+012.04E+001.76E+013.94E+011.90E+001.97E+004.27E+001.94E+004.30E+003.77E+002.01E+002.22E+002.12E+006.23E+002.50E+003.50E+013.19E+00Denotesaresultlessthanthedctcction limit.
TABLEB-10.1(Cont.)vMMAPETRMETRYF'NITRYWATETREATENResultsinpCi/liter WATERCOLLECTION
~LOCATION..PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102A03/03/98-04/01/98 04/01/98-05/06/98 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"-4.48A6.00*-9.00"'.79*7.38"'.66*1.94~1.64":-7.28*9.78":8.65*1.47"-4.71+1.10~-6.64+-6.72A2.58"9.2027*1.65*5.18x544":-190"1.63"1.20~4.67*7.16"-1.17*1.62A39'7E+00E+00E-02E-01E-01E-01E+00E+00E-01E-02E-01E+00E-01E+00E+00E+00E+01E-01E-01E+00E-01E-01E+00E+00E-OIE-01E+00E+00E+01E+001.51E+012.35E+011.52E+001.57E+003.14E+001.71E+003.18E+003.21E+001.58E+001.70E+001.73E+004.88E+002.06E+004.10E+013.29E+001.62E+013.40E+011.77E+001.79E+003.64E+001.74E+003.72E+003.63E+001.83E+001.96E+001.92E+006.38E+002.36E+003.54E+013.06E+00Denotesaresultlessthanthedetection limit.
TABLEB-10.1(Cont.)AMMAPERMETRYFANITARYWATETREATMETWATERResultsinpCi/liter LOCATION102CPriortoDischarge COLLECTION PERIOD05/20/98NUCLIDEBe-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228797"'.74"1.20*-2.98"1.65*-7.83~-1.52"8.69*1.72*0.00*1.79+-2.68*4.63*-5.76*-2.33E+00E+01E+00E-01E+00E-01E+00E-01E+00E+00E+00E+00E-01E+01E+00RESULTOVERALLUNCERTAINTY 1.69E+012.04E+011.36E+001.54E+003.56E+001.44E+003.09E+003.29E+001.67E+001.51E+001.55E+001.19E+014.58E+003.46E+012.96E+0005/20/98Be-7K-40Mn-54Co-58FG-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137BQ-140La-140Ra-226Th-228*5.52*-8.19*4.49"-104"'.76"-7.86"2.84*1.69~2.34"-3.97"3.48*-3.75*-7.04*-5.59":6.03E+00E+01E-01E+00E+00E-01E+00E-01E+00E-01E+00E+00E+00E+01E-01'.00E+013.60E+011.86E+002.1,4E+004.79E+001.85E+003.97E+004.39E+002.19E+001.98E+002.04E+001.51E+016.10E+003.38E+013.08E+00Denotesaresultlessthanthedetection limit.
TABLEB-10.1(Cont.)AMMAPETRMETRYF<AITRVWASTETRE<.ATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102CPriortoDischarge 10/21/9810/21/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140LB-140Ra-226Th-228'-9.71":-9.82"8.15"1.64x249"-1.05*-3.77*-3.06*9.10*3.85"-4.18"'-7.45"0.00~-1.19"-6.59*1.35"-2.60"'-1.28"-4.91*3.15*6.53A4.10*0.00"1.60*2.80":9.33"-1.56"'.03"'-6.66":3.46E+00E+00E-01E+00E-01E+00E+00E+00E-01E-02E+00E-01E+00E+01E+00E+00E+01E-01E-01E+00E-01E+00E+00E+00E-01E-01E+00E-01E+00E+001.90E+015.27E+012.08E+002.12E+004.23E+002.07E+004.69E+004.14E+002.15E+002.41E+002.31E+006.58E+002.56E+004.24E+013.59E+001.32E+012.85E+011.44E+001.45E+002.94E+001.47E+003.11E+002.90E+001.49E+001.63E+001.64E+004.55E+001.72E+002.96E+012.61E+00Denotesaresultlessthanthedctcction limit.
TABLEB-10.1(Cont.)GRAMMAPETRMETRYFANITARYWATETREATMFNT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102BMonthlyHeadworks 09/23/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"'.03"-6.47"-8.54*2.00"'-1.17"0.00"2.33"1.13"-1.08"'-2.70"-7.29E+00E-01E-01E+00E+00E+00E+00E-01E+00E+01E-02x101E+01"'.15E+00":1.56E+00<<-1.39E+001.532.341.631.633441.933.823.461.691.841.895.332.273.483.11E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+0010/21/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"'.41"-5.29*4.46'72000"1.57":1.6591":1.67*-8.21"'.61441":-2.15x234"'-2.48E-01E+01E-01E-01E+00E+00E+00E+00E+00E-01E-01E+00E-01E+01E-011.623.521.821.783.641.853.623.591.761.991.975.312.153.372.92E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00Denotesaresultlessthanthcdctcction limit.
TABLEB-10.1(Cont.)AMMAPETRETRYFANITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102BMonthlyHeadworks 11/18/9812/16/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228+6.34~3.05"6.58"-1.00*3.63+6.21*2.47"'.92A1.23*4.29*-4.06*6.58"3.53*2.58"1.04*-4.05*-6.54~4.89~3.03*1.57+4.39*-1.89*-2.17"2.05A-3.28"'.68~-1.43"615"-7.48x524E+00E+00E-01E+00E+00E-01E-01E-01E+00E-01E+00E-01E-01E+01E+01E+00E+00E-01E-01E+00E-01E+00E+00E+00E-01E+00E+00E-01E+00E+001.663.631.791.803.681.864.043.491.751.942.035.712.353.283.011.231.951.221.272.491.412.542.451.391.441.514.151.923.472.89E+01E+OlE+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00Denotesaresultlessthanthedetection limit.
TABLEB-10.1(Cont.)+AMMAPETRMETRYFANITRYWATETREATENTWATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102BMonthlyHeadworks05/20/9806/17/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-9S.Cs-134Cs-137Ba-140La-140Ra-226TH-228"'.49":-4.14x59p":-5.433.23"-1.93":2.50"-1.30"1.48x220*1.06"-4.11"-1PP~-3.76"-140":5.86"5.58"-4.50%-4.52"1.16"-9.33*-4.56":-8.62"1.20":-9.78x-112*2.08":-5.10"-4.03"1.99E+00E+01E-01E-01E+00E-01E+00E-01E+00E+00E+00E+00E+00E+01E+01E+00E+01E-02E-02E+00E-01E-01E-02E+00E-02E+00E-01E+00E+01E+001.892.721.791.894.081.994.083.991.922.261.997.313.084.913.871.512.441.541.493.221.723.463.061.591.601.664.902,184.053.25E+01'+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00Denotesaresultlessthanthedctcction limit.
TABLEB-10.1(Cont.)AMMAPETRMTRYFANITARYWATETREATMETWATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102BMonthlyHeadworks 07/15/9808/19/98Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"-2.01*1.71"'-1.36~-7.33"'-3.21"1.67~-1.84*-1.90"6.30*2.52":2.08"-6.00*1.15+-4.46*1.67"-147"3.77"3.79"-5.16*0.00"9.80":3.98*1.47"6.08*1.32~1.16"-7.25"-3.464Q7'774E+00E+01E+00E-01E-01E+00E+00E+00E-01E+00E+00E+00E+00E+01E+00E+01E+00E+00E-01E+00E-01E+00E+00E-01E+00E+00E-01E+00E+OlE+001.832.711.892.104.362.354.363.981.972.162.216.753.744.003.631.732.692.032.023.972.053.943.661.932.132.245.592.594.083.50E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00E+01E+01E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+00Denotesaresultlessthanthcdctcction limit.
TABLEB-10.1(Cont.)MMAPETRMETRYFANITARYWTETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102A05/06/98-06/03/98 06/03/98-07/01/98 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228":350":-7.60347-161x783"'-9.88"-2.74"-1.97"'.64"1.28*2.02"-9.24"'-2.02*-4.29"4.78+-3.59"3.19~1.30+-8.52"114"1.20":5.68'-6.84~1.10":-4.88"1.51"559"-8.94"-5.15":-1.59E+00E+00E-01E-01E-01E-01E+00E+00E+00E+00E+00E+00E+00E+01'-01E+00E+01E+00E-01E+00E+00E-01E-01E+00E-01E+00E+00E-02E+01E-022.20E+014.45E+012.21E+002.42E+005.10E+002.23E+004.90E+004.64E+002.49E+002.53E+002.42E+001.07E+014.45E+004.05E+013.66E+001.45E+012.39E+011.58E+001.48E+002.94E+001.70E+003.31E+003.24E+001.43E+001.69E+001.77E+004.63E+002.09E+004.07E+013.26E+00Denotesaresultlessthanthedete<<tion limit.
TABLEB-10.1(Cont.)AMMAPETRMETRYFANITARYWATE.TREATM
<NTWATERResultsinpCi/liter LOCATION102ACOLLECTION PERIOD07/01/98-08/05/98 NUCLIDEBe-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228"2.83":9.92"166"1.36"155"1.91"118"'-5.60"1.35"-1.36"661"-1.17"-1.36E-01E-02E+00E-01E+00E-01E+00E-01E-01E+00E-01E+02E+00RESULT":1.14,E+01":-7.96E+01OVERALLUNCERTAINTY 2.10E+014.41E+012.18E+002.17E+004.81E+002.17E+004.67E+004.57E+002.22E+002.37E+002.31E+008.94E+003.41E+003.97E+013.55E+0008/05/98-09/02/98 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228":8.26":-1.24"'.52~-9.62"1.49":1.34"-105":1.11"2.10"'.84"3.52":3.38":2.94"-7.96x423E+00E+01E+00E-02E+00E+00E+00E+00E+00E+00E+00E+00E+00E+01E+002.05E+014.41E+012.16E+002.13E+004.69E+002.13E+004.61E+004.33E+002.17E+002.31E+002.36E+008.42E+003.38E+004.04E+013.50E+00Denotesaresultlessthanthcdctcction limit.
TABLEB-10.1(Cont.)+AMMAPETRMETRYFANITARYWATETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102A09/02/98-10/06/98 10/06/98-11/03/98 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228":1.63":-2.92"-2.46"-9.91"'.38"5.96"7.21"-1.36":9.42"0.00"3.59":-1.17"6.13"5.50*-3.00"4.24":6.42*4.64~1.56":-4.78":-3.76":1.16~0.00xI18":1.24"5.50"'-1.05"'-6.12+7.00E+01E+01E+00E-01E+00E-01E+00E+00E-01E+00E+00E+01E-01E+00E+00E+00E+00E-01E-01E-01E-01E+00E+00E+00E+00E-01E+00E+00E+01E-012.01E+012.66E+011.94E+001.87E+004.46E+002.01E+004.26E+004.14E+002.06E+002.07E+002.30E+008.41E+004.29E+004.33E+013.85E+001.53E+012.46E+011.50E+001.51E+00,3.10E+001.55E+003.30E+003.12E+001.62E+001.77E+001.66E+004.82E+002.02E+004.05E+013.47E+00Denotesaresultlessthanthedetection limit.
TABLEB-10.1(Cont.)AMMAPETRMETRYFANITARYWTETREATMENT WATERResultsinpCifliterLOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102A11/03/98-12/01/98 12/01/98-01/05/99 Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137Ba-140La-140Ra-226Th-228Be-7K-40Mn-54Co-58Fe-59Co-60Zn-65Zr-95Nb-95Cs-134Cs-137BB-140La-l40Ra-226Th-228":-334"-1.31"9.14"5.96x384":-3.21":-2.13"140~1.92*3.55~1.29"4.89":7.06":133":-2.05":509":9.18":-6.93":-1.48":2.88":1.5350'7x+63"1.16"-5.90"1.7048'7"ppp":-1.68x'746E+00E+01E-01E-01E-01E+00E+00E+00E+00E-01E+00E-01E-02E+OlE-01E+00E+01E-01E+00E+00E+00E-01E+00E+00E-01E+00E+00E+00E+O1E+001.27E+011.96E+011.29E+001.33E+002.55E+001.30E+002.54E+002.52E+001.36E+001.42E+001.41E+004.29E+001.74E+003.29E+012.70E+001.97E+013.11E+012.21E+002.28E+004.78E+002.41E+004.83E+004.48E+002.29E+002.42E+002.36E+007.80E+003.03E+004.05E+013.61E+00Denotesaresultlessthanthcdetection limit.
TABLEB-10.2AMMAPETRMETRYFANITRYWATETREATMENT WAT.R-~MMRResultsinpCilliter NUCLIDEAVERAGELOWHIGHNUMBER.NUMBERSAMPLESPOSITIVE1028-MonthlyHeadworks Be-7(I)K-40(I)Mn-54(I)Co-58(I)Fe-59(I)Co-60(I)Zn-65(I)Zr-95(I)Nb-95(I)Cs-134(ICs-137(I)Ba-140(I)La-140(I)Ra-226(I)Th-228(I)2.04E+00-5.73E-01 5.38E-01-5.30E-01 1.35E+004.54E-015.68E-011.69E-011.10E+003.14E-013.12E-01-1.50E+00
-9.56E-O1-2.29E+Ol
-7.82E-OI-1.47E+01
-5.29E+01
-1.80E+00
-1.39E+00
-3.21E-01
-9.79E-01
-1.89E+00
-2.26E+00
-1.17E+00
-1.22E+00
-4.06E+00
'6.00E+00
-5.10E+00
-4.64E+01
-l40E+Ol1.09E+015.68E+013.79E+003.03E-013.63E+001.69E+003.98E+003.34E+002.29E+002.52E+002.33E+002.93E+001~15E+002.58E+011.04E+011212121212121212121212121212120(I)Indicator Stations TABLEB-10.2("AMMA%PETRMETRYFANITARYWASTETREATMENT WATER-*.ResultsinpCi/liter NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVE102-PriortoDisehnreBe-7K-40Mn-54(I)-2.70E+00 (I)-2.51E+01 (I)5.84E-01Co-58(I)-4.73E-02 Fe-59(I)2.08E+00Co-60(I)-4.92E-01 Zn-65(I)4.13E-01Zr-95(I)-5.06E-01 Nb-95(I)1.64E+00Cs-134(I)-1.96E-02 Cs-137(I)5.06E-01Ba-140(I)'2.18E+00 La-140(I)-1.49E+00 Ra-226(I)-3.30E+0lTjl-228(I)-1.21E+00
-9.71E+00
-8.19E+01
-1.28E-01
-1.04E+00
-2.49E-01
-1.05E+00
-3.77E+00
-3.06E+00 9.10E-01-3.97E-01
-4.18E+00
-3.75E+00
-7.04E+00
-5.76E+0I-6.59E+00 5.52E+001.74E+011.20E+001.64E+003.76E+006.53E-014.10E+008.69E-OI2.34E+002.80E-01348E+00-7.45E-01 6.03E-OI-6.66E+00 346E+00g)Indicator Stations TABLEB-10.2AMMAPF.TRMETRYFANITARYWATETREATMENT WATER-MMARYResultsinpCi/liter NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVE1020-Northtabilization PondBe-7(I)K-40(I)Mn-54(I)Co-58(I)Fe-59(I)Co-60(I)Zn-65(I)Zr-95(I)Nb-95(I)Cs-134(I)Cs-137(I)Ba-140(I)La-140(I)Ra-226(I)Th-228(I)8.60E+00-2.96E+00
-1.69E+00
-8.56E-01 1.47E+005.34E-015.05E-013.27E+001.52E+00-8.36E-01 1.69E+003.78E+00-1.73E+00
-7.66E+01
-1.78E+00 0.00E+00-3.98E+00
-2.73E+00
-1.21E+00 0.00E+002.00E-01-1.05E+00 2.44E+008.63E-02-1.77E+00 9.95E-013.18E+00-2.18E+00
-1.48E+02
-2.96E+00 1.72E+01-1.93E+00
-6.54E-01
-5.02E-01 2.94E+008.67E-012.06E+004.10E+002.95E+009.79E-022.39E+004.38E+00-1.28E+00
-5.27E+00
-6.03E-01 20eg)Indicator Stations TABLEB-10.2AMMAPETRTRYFANITARYWATETREATENTWATER-"NUCLIDEResultsinpCi/liter AVERAGELOWHIGH102K-outhtabilization PondNUMBERNUMBERSAMPLESPOSITIVEBe-7(I)K-40(I)Mn-54(I)Co-58(I)Fe-59(I)Co-60(I)Zn-65(I)Zr-95(I)Nb-95(I)Cs-134(I)Cs-137(I)Ba-140(I)La-140(I)Ra-226(I)Th-228(I)-6.46E+00
-3.96E+01 6.59E-01-6.06E-01 3.39E+00-8.77E-01 1.01E+00-1.31E+00 1.15E+002.68E-011.46E+001.70E+00-1.40E+00
-8.47E+01
-2.82E+00
-9.31E+00
-9.06E+01
-7.19E-02-1.25E+00 1.41E+00-2.70E+00 1.89E-01-1.89E+00 8.27E-01-7.75E-01 1.31E+001.26E+00-2.09E+00
-l.16E+02-6.29E+00
-3.61E+00 1.15E+011.39E+003.82E-025.37E+009.46E-011.83E+00-7.31E-01 1.48E+001.31E+001.60E+002.14E+00-7.19E-01
-5.33E+01 6.57E-01(I)Indicator Stations TABLEB-10.2AMMA,PF.TRMETRYFANITARYWATETREATMENT WATER-SUMMARYResultsinpCi/liter NUCLIDEBe-7(I)K-40(I)Mn-54(I)Co-58(I)Fe-59(I)Co-60(I)Zn-65(I)Zr-95(I)Nb-95(I)Cs-134(I)Cs-137(I)Ba-140(I)La-140(I)Ra-226(I)Th-228(I)AVERAGE3.07E+003.31E+002.52E-OI-2.14E-OI"1.12E+002.37E-OI3.50E-OI-3.06E-OI1.49E+002.80E-OI1.42E+002.56E-OI-3.27E-02
-4.01E+01 8.52E-03LOW102A-6.72E+00
-7.96E+01
-2.46E+00
-1.48E+00
-7.83E-OI-3.21E+00
-4.51E+00
-2.63E+00
-7.28E-OI-5.90E-OI1.35E-OI-1.17E+01-2.02E+00
-I.17E+02-6.64E+00 1.63E+019.18E+011.52E+006.79E-OI2.96E+001.53E+007.21E+001.64E+003.32E+001.84E+003.59E+007.16E+002.94E+001.62E+018.08E+00NUMBERNUMBERSAMPLESPOSITIVE121212121212121212121212121212g)Indicator Stations IIIIII TRITITABLEB-11.1MINANITARYWASTETREATMENT WATERResultsinpCi/liter LOCATIONCOLLECTION DATERESULTEFTFKf<<OVERALLUNCERTAINTY H-3102A01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-1 1/03/9811/03/98-12/01/98 12/01/98-01/05/99 5.33.93.84.21.62.01.11.35.04.74.254E+03E+03E+03E+03E+04E+04E+04E+04E+03E+03E+03E+033.02.02.02.01.01.01.01.03.03.02.02.0E+02E+02E+02E+02E+03E+03E+03E+03E+02E+02E+02E+02H-3102B01/21/9802/25/9803/18/9804/15/9805/20/9806/17/9807/15/9808/19/9809/23/9810/21/9811/18/9812/16/98onthlHeadwotks5.1"'.36.61.07.11.8"'.94.71.24.0207.8E+02E+02E+02E+03E+03E+03E+01E+02E+03E+02E+03E+022.01.98.01.03.02.09.21.02.01.22.01.3E+02E+02E+01E+02E+02E+02E+01E+02E+02E+02E+02E+02H-3102C05/10/9805/20/9810/21/9810/2l/984.85.31.11.1E+02E+02E+03E+031.21.21.01.0E+02E+02E+02E+02Dcnotcsaresultlessthanthcdetection limit.
TABLEB-11.1(cont.)ITIINNITARYWETRKAENTWTERResultsinpCi/liter LOCATIONCOLLECTION DATERESULTOVERALLUNCERTAINTY H-3102D05/12/9811/17/98orthtahilizati nPonds6.7E+021.2E+031.2E+021.0E+02H-3102E05/12/9811/17/98outhtabilizati nPonds5.5E+021.3E+031.2E+022.0E+02 TABLEB-11.2(Cont.)TRITIMINANITARYWATKTRKATMFNT WTKR-MMARYResultsinpCi/liter NUCLIDEAVERAGELOWHIGHNUMBERNUMBERSAMPLESPOSITIVEH-3(I)3.74E+03llamles5.9E+012.0E+043230H-3(I)102-A8.04E+03FFTFEffluen3.8E+032.0E+041212H-3(I)102-B1.34E+03onthlHeadworks5.9E+017.1E+031210H-3(I)102-C8.03E+02PriortDischare4.8E+021.1E+03Northtabilization PondsH-3(I)102-D9.35E+026.7E+021.2E+03H-3(I)102-E9.25E+02Southtahilization Ponds5.5E+021.3E+03(I)Indicator Stations II TABLEB-12.1AMMAPETRMRYFANITARYWATETRFATMFTEDIMENResultsinpCi/kilogram LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 102D102D102D04/21/9810/27/9811/17/98K-40Co-57Co-60Cs-134Cs-137Ra-226Eu-152Th-228K-40Co-57Co-60Cs-134Cs-137Ra-226Eu-152Th-228K-40Co-57Co-60Cs-134Cs-137Ra-226EU-152Th-2281.04E+04"'-3.32E+001.64E+02*3.23E+011.32E+021.19E+03*3.40E+015.46E+028.98E+03*-2.51E-012.11E+03"'.57E+017.20E+011.51E+03*8.79E+014.48E+021.32E+04*-7.47E+00*4.85E+00"4.58E+01*1.59E+011.54E+03*6.31E+019.67E+02701E+021.85E+013.97E+012.58E+014.08E+015.49E+021.16E+024.67E+016.58E+021.99E+011.00E+023.10E+014.01E+016.58E+021.04E+024.87E+013.27E+028.88E+009.23E+001.06E+019.91E+002.70E+024.95E+012.43E+01Denotesaresultlessthanthedetection limit.
TABLEB-12.2AMMAPETRMETRYFANITARYWATETREATMENT EDIMET-SIIMMARVResultsinpCi/kilogram NUCLIDEAVERAGELOWHIGHNUMBERSAMPLESNUMBERPOSITIVEK-40Co-57Co-60Cs-134Cs-137Ra-226EU-152Th-228(I).1.09E+04(I)-3.68E+00 (I)7.60E+02(I)3.46E+01(I)7.33E+01(I)1.41E+03(I)6.17E+01(I)6.54E+028.98E+03-7.47E+00 4.85E+002.57E+011.59E+011.19E+033.40E+014.48E+021.32E+04-2.51E-01 2.11E+034.58E+011.32E+021.54E+038.79E+019.67E+02g)Indicator Stations STATION118SOILRESULTS III TABLEB-13.1AMMAPETRMETRYFSTATIN118SII.ResultsinpCi/kilogram LOCATIONCOLLECTION PERIODNUCLIDERESULTOVERALLUNCERTAINTY 11806/09/98Be-7K-40Cs-134Cs-137Ra-226Th-2281.71E+021.31E+04*2.18E+01*1.37E+016.40E+025.21E+026.27E+012.59E+026.00E+005.76E+001.44E+021.42E+01Denotesaresultlessthanthedetection limit.
TABLEB-13.2AMMAPETRMETRYFATIN1188IL-MMRYResultsinpCi/kilogram NUCLIDEAVERAGE'OWHIGHNUMBERNUMBERSAMPLESPOSITIVEBe-7(I)K-40(I)Cs-134(I)Cs-137(I)'a-226(I)Tjl-228(I)1.71E+021.31E+042.18E+011.37E+016.40E+025.21E+021.71E+021.31E+042.18E+011.37E+016.40E+025.21E+021.71E+021.31E+042.18E+011.37E+016.40E+025.21E+02(I)Indicator Stations WASHINGTON PUIILICPOWER4NSUPPLYSYSTEMWASHINGTON PUBLICPOWERSUPPLYSYSIKMNVCLKARPLANT21997AN1'AJALRADIOLOGICAL ENVIRON1UIENTAL OPERATING REPORTJANUARY1toDECEMBER31,1997RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMPreparedbyJ.E.McDonaldandL,S.SchlederWashington PublicPowerSupplySystemRichland, WAandC.A.MendolaTeledyneBrownEngineering Environmental ServicesWestwood, NJ TABLEOFCONTENTS1.0EXECUTIVE SUMMARY2.0DEFINITIONS


==3.0INTRODUCTION==
==SUMMARY==
Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Station 101-Outfall Gross Beta (I)3.27E+00 3.0E-01 9.3E+00 47 22 g)Indicator Stations I I TRI I TABLE B-4.1 IN T RM DRAI Results in pCi/liter WATER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 12/29/97-01/07/98 Ol/16/98-01/26/98 01/29/98-02/10/98 02/10/98-02/16/98 02/19/98-02/26/98 03/02/98 03/03/98 03/05/98-03/10/98 03/13/98-03/19/98 03/23/98-04/03/98 04/09/98-04/17/98 04/21/98-04/23/98 04/23/98-04/24/98 04/24/98-05/03/98 05/07/98-05/09/98 05/13/98-05/15/98 05/19/98-05/23/98 05/28/98-06/03/98 06/05/98-06/10/98 06/15/98-06/17/98 06/17/98 06/17/98-06/18/98 06/18/98-06/24/98 06/25/98-07/01/98 07/02/98-07/06/98 07/09/98-07/15/98 07/17/98-07/22/98 07/23/98-07/26/98 07/31/98-08/04/98 08/05/98-08/l I/98 08/11/98-08/16/98 08/17/98-08/21/98 08/24/98-08/3 l/98 09/03/98-09/10/98 09/10/98-09/17/98 09/17/98-09/70/98 09/24/98-09/28/98 10/01/98-10/08/98 10/09/98-10/18/98 10/19/98-10/70/98 10/21/98-10/79/98 (a)(a)(b)(c)1.2 1.5 9.5 1.1 3.8 X+59 7*-2.3 2.9" 2.8*2.6 1.7*-7.1*7.0" 2.8*-2.8 3 8" 2.4 x 4 7'7 5 5'7 x 55" 7.3 2 5"40 3" 5.8 l.6"').0" 8.5" 1.0 3.0 3.7" 4.1 2.7'" 8.8 E+03 E+03 E+02 E+03 E+02 E+02 E+01 E+00 E+00 E+02 E+01 E+OI~E+02 E+02 E+00 E+01 E+01 E+01 E+01 E+00 E+01 E+00 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+01 E+02 E+01 E+01 E+02 E+02 E+02 E+O1 E+02 E+Ol 2.0 2.0 2.3 2.0 1.0 9.1 8.8 8.5 5.9 1.0 9.6 9.21 1.0 9.65 8.36 9.26 8.48 9.S6 9.51 9.38 8.92 9.61 8.82 9.16 8.65 8.59 1.0 9.11 9.02 8.97 9.0 9.95 1.70 1.71 1.8 1.8 1.05 1.1 1.76 E+02 E+02 E+02 E+02 E+02 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+02 E+01 E+Ol E+01 E+01 E+01 E+01 E+01 E+01 E+00 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+01 E+01 E+01 E+02 E+02 E+02 E+02 E+02 E+02 E+02 (a)Grab sample (b)Grab sample;tritium analysis not pcrformcd.(c)Tritium analysis not pcrformcd.
Dcnotcs a result less than thc dctcction limit.
TABLE B-4.1 (Cont.), TRITIUM IN ST RM DRAIN WATFR Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 11/06/98-11/12/98 11/12/98-11/22/98 11/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/19/98 12/21/98-12/29/98 6.0 E+02 4.5 E+02 5.9 E+02 5.4 E+02 2.1 E+02 1.0 E+03 3.7 E+03 1.3 E+02 1.8 E+02 1.8 E+02 1.3 E+02 1.1 E+02 1.0 E+02 2.0 E+02 TABLE B-4.2 TRITIUM IN T RM DRAIN WATER-8 MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE tation 101-utfall H-3 (I)3.25E+02-5.2E+01 3.7E+03 46 19 0)Indicator Stations I l I I I STORM DRAIN VEGETATION RESULTS I
TABLE B-7.1 AMMA PE TR METRY F T RM DRAIN VE vETATI N Results in pCi/kilogram LOCATION 101 COLLECTION PERIOD 08/17/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 RESULT*1.23 E+02 3.02 E+03*2.24 E+00" 1.05 E+00*2.43 E+00 A-3.78 E+00*2.68 E+01*6.59 E+00*1.75 E+01*-1.48 E+01*-1.21 E+00*-4.97 E+00*-5.87 E+00,*-3.21 E+01+4.44 E+01 OVERALL UNCERTAINTY 1.25 E+02 2.60 E+02 1.28 E+01 1.32 E+01 2.83 E+01 1.26 E+01 2.85 E+01 2.59 E+01 1.34 E+01 1.38 E+01 1.42 E+01 5.28 E+01 1.94 E+01 2.38 E+02 2.08 E+01 Dcnotcs a result less than the detection limit.
TABLE B-7.2+AMMA P<TR ME<TRY I T RM DRAI VE ETA I Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Co-60 (I)Co-58 (I)Cs-134 (I)Cs-137 (I)Nb-95 (I)Zr-95 (I)Zn-65 (I)Fe-59 (I)Ba-140 (I)La-140 (I)1.23E+02'.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01.6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 1.23E+02 3.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01 6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 1.23E+02 3.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01 6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 0 (I)Indicator Stations TABLE B-5.1 CAMMA SPECTR METRY F T RM DRAIN SEDIMENT Results in pCi/kilogram LOCATION 101 COLLECTION PERIOD 03/25/98 06/18/98 NUCLIDE K-40 Co-57 Co-60 Zn-65 Co-58 Mn-54 Cs-134 Cs-137 CG-141 Ra-226 EU-152 Th-228 K-40 Co-57 Co-60 Zn-65 Co-58 Mn-54 Cs-134 Cs-137 Ce-141 Ra-226 Eu-152 Th-228 RESULT 4.49 E+03":-4.27 E+00 2.07 E+02" 9.05 E+00"-7.10 E+00"'.06 E+00" 5.17 E+00 3.80 E+01~1.51 E+00 8.10 E+02"3.64 E+01 3.63 E+02 5.22 E+03":-2.07 E+00 1.40 E+02" 5.63 E-O I"'-8.68 E+00"'.12 E-01": 1.92 E+01 4.44 E+01": 6.72 E+00 8.41 E+02*2.23 E+01 4.34 E+02 OVERALL UNCERTAINTY 1.79 E+02 5.32 E+00 1.36 E+01 1.50 E+01 5.68 E+00 5.78 E+00 6.44 E+00 8.55 E+00 1.00 E+01 1.55 E+02 2.66 E+01 1.41 E+01 1.89 E+02 5.26 E+00 1.18 E+01 1.31 E+01 5.23 E+00 5.73 E+00 6.39 E+00 8.54 E+00 9.30 E+00 1.50 E+02 2.67 E+01 1.85 E+01 Denotes a result less than thc detection limit.
TABLE B-5.2 A MA PE TR METRY F T RM DRAIN EDIME<NT-Results in pCi/kilogram ARY NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE tation 101-tttfa)1 K-40 (I)Mn-54 (I)Co-57 (I)Co-58 (I)Co-60{I)Zn-65 (I)Cs-134{I)Cs-137{I)Ce-141{I)RR-226 (I)Eu-152{I)Th-228 (I)4.86E+03 1.59E+00-3.17E+00-7.89E+00 1.74E+02 4.81E+00 1.22E+01 4.12E+01 4.12E+00 8.26E+02 2.94E+01 3.99E+02 4.49E+03 1.12E-01-4.27E+00-8.68E+00 1.40E+02 5.63E-01 5.17E+00 3.80E+01 1.51E+00 8.10E+02 2.23E+01 3.63E+02'.22E+03 3.06E+00-2.07E+00-7.10E+00 2.07E+02 9.05E+00 1.92E+01 444E+01 6.72E+00 8.41E+02 3.64E+01 4.34E+02 2 (I).Indicator Stations TABLE B-6.1 A MA PE TR METRY F 7 RM DRAIN II Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101A 101B 101A 101B 101A 03/25/98 03/25/98 06/30/98 06/30/98 09/17/98 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 1.10 1.55": 8.35" 2.68 3.64 7.96 5.48 1.04 149*4.18+2.78 3.67 6.89 4.94 1.01 1.54*2.75+2.92 3.02 8.35 5.25 1.85 1.46" 3.36*2.47 3.08 6.77 5.04 1.34 1.47*6.42"'.31 3.30 7.82 1.68 E+02 E+04 E-02 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+Ol E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 5.83 2.75 5.45 6.48 6.95 1.53 1.47 5.76 2.92 5.74 6.49 7.46 1.58 1.49 5.86 3.08 6.06 7.09 6.32 1,51 1.59 7.26 3.27 6.86 7.64 8.63 1.73 1.63 6.97 2.95 6.32 7.31 7.27 1.55 2.10 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+Ol E+02 E+00 E+00 E+00 E+02 E+01 Denotes a result less than the detection limit.
TABLE B-6.1 AM A PE TR ME<TRY F T RM DRAI II Results in pCi/kilogram LOCATION 101B COLLECTION PERIOD 09/17/98 NUCLIDE Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 RESULT 1.81 E+02 1.62 E+04"4.44 E+00*1.65 E+01 2.99 E+01 8.85 E+02 5.61 E+02 OVERALL UNCERTAINTY 7.55 E+01 3.10 E+02 6.09 E+00 7.13 E+00 7.78 E+00 1.64 E+02 1.62 E+01 Dcnotcs a result less than thc dctcction limit.
vA TABLE B-6.2 PK TR METRY F T RM DRAIN II-Results in pCi/kilogram ARY NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Cs-134 (I)Cs-137 (I)1.36E+02 1.52E+04 3.54E+00 2.47E+01 3.28E+01 Th-228 (I)4.67E+02 Ra-226 (I)'.77E+02 1.01E+02 1.46E+04 8.35E-02.1.65E+01 2.99E+01 6.77E+02 1.68E+02 1.85E+02 1.62E+04 6.42E+00 2.92E+01 3.67E+01 8.85E+02 5.61E+02 (I)Indicator Stations TABLE B-8.1 R ALPHA IN ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 102A 102C Prior to Discharge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/98 05/20/98 10/21/98 10/21/98*1.5 E+00*2.5 E-01*2.2 E-01*1.4 E+00*-8.5 E-01*1.0 E+00*0.0 E+00*4.9 E-01*2.0 E-01+1.9 E+00*6.4 E-01*0.0 E+00*6.8 E-01*2.4 E+00 A 6.4 E-01*0.0 E+00 1.61 E+00 1.79 E+00 1.58 E+00 2.02 E+00 1.04 E+00 1.43 E+00 1.71'E+00 1.54 E+00 1.23 E+00 1.74 E+00 1.55 E+00 2.86 E+00 1.36 E+00 2.45 E+00 1.13 E+00 9.54 E-01 Dcnotcs a result less than thc.dctcction limit.
TABLE B-8.2 PRO S Al PHA IN ANITARY WA TE TREATMENT WATER-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW 102A HIGH NUMBER NUMBER SAMPLES POSITIVE Gr-Alpha (I)5.63E-01-8.5E-01 1.9E+00 12 Gr-Alpha (I)5.90E-01 102-Prior to Disehar e-6.8E-01 2.4E+00 g)Indicator Stations TABLE B-9.1 R S BETA I S NITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 102A 102C Prior to Discharge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/01/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/98 05/20/98 10/21/98 10/21/98 3.2 E+01 3.1 E+01 2.1 E+01 2.9 E+01 2.4 E+01 4.1 E+01 3.6 E+01 3.5 E+01 1.7 E+01 2.9 E+01 2.5 E+01 3.3 E+01 3.2 E+01 3.3 E+01 4.1 E+01 4.1 E+01 2.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 3.0 E+00 3.0 E+00 3.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 4.0 E+00 4.0 E+00 4.0 E+00 3.0 E+00 3.0 E+00 TABLE B-9.2 R BETA N ANITARYWA TET E T ENTWATER-ARY NUCLIDE AVERAGE Results in pCi/liter LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 102A Gr-Beta (I)2.94E+01 1.7E+01 4.1E+01 12 12 2-Prior to Di char e Gr-Beta (I)3.65E+01 3.2E+01 4.1E+01 (I)Indicator Stations AMM PE TR METR Y TABLE B-1 p.I F ANITARY W TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD'UCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 01/21/98 02/25/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228*-7.54 5.68*1.03 A-6.05" 1.73" 1.69*2.07"-2.26*6.50*-4.40" 8.65" 2.93*-2.47+-4.64"-5.88 x ppp*2.00*-1.80 1 99*2.07*7.23 14"-1.91 x 724 3 59 3'71"-9.35 35"-4.25'7 19 E-01 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E-01 E-pl E+00 E-01 E+Ol E-01 E+00 E+01 E+00 E-01 E+00 E-01 E-01 E-01 E-01 E-02 E+00 E-01 E-01 E+01 E-01 1.70 2.84 1.83 1.86 3.90 1.81 3.89 3.61 1.86 2.03 1.99 6.47 2.47 3.65 3.09 1.31 2.20 1.39 1.40 2.93 1.57 3.18 2.70 1.44 1.59 1.83 4.31 1.89 3.34 2.73 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit.
TABLE B-10.1 (Cont.)A MA PE TR METRY F A ITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B MontMy Head works 03/18/98 04/15/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140, Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 370&#xb9;-L68": 5.38&#xb9;-6.21*'7.60*-9.79*-1.20"-1.49*2.29*1.68*1.06&#xb9;-3.63 8-6.54*-2.17*-3.93" 1.09"-5.19" 5.57*-7.82" 1.32": 5.09"'.2.19&#xb9;3.34&#xb9;1.86&#xb9;-1.22 x 124"-6.58"-1.97&#xb9;-1.35 E+00 E+01 E-01 E-01 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+01 E-01 E+01 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+01 E-02 1.31 2.75 1.46 1.43 3.03 1.48 2.99 2.89 1.47 1.64 1.63 4.46 1.75 2.98 2.61 1.38 2.88 1.48 1.48 3.01 1.47 3.19 2.90 1.46 1.64 1.66 4.59 1.74 3.08 2.56 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00&#xb9;Denotes a result less than the detection limit.
TABLE B-1 p.1 (Cont.)AMMA PECTR METRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102D North Stabilization Pond 05/12/98 11/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"ppp":-3.98"-2.73"-5.02"ppp": 8.67" 2.06": 2.44": 8.63": 979 4995*3.18":-1.28":-5.27"-6.03*1.72 x 193"'-6.54":-1.21": 2.94": 2.00"-1 05"41P"'.95"'-1.77"'.39": 4.38"-2.18":-1.48"-2.96 E+00 E+00 E+00 E-pl E+00 E-01 E+00 E+00 E-02 E-02 E-01 E+00 E+00 E+00 E-01 E+01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+00 1.50 E+01 2.27 E+01 1.44 E+00 1.56 E+00 3.27 E+00 1.65 E+00 3.24 E+00 3.05 E+00 1.51 E+00 1.71 E+00 1.74 E+00 5.23 E+00 2.05 E+00 4.01 E+01 3.11 E+00 1.85 E+01 3.26 E+01 1.97 E+00 1.96 E+00 4.30 E+00 1.91 E+00 4.29 E+00 4.00 E+00 2.08 E+00 2.17 E+00 2.28 E+00 7.35 E+00 2.80 E+00 3.49 E+01 3.20 E+00 Denotes a result less than the dctcction limit.
TABLE B-10.1 (Cont.)A A PE TR ME<TRY F ANITARY%TE<TR A MENT&AT Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102E South Stabilization Pond 05/12/98 11/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-l40 Ra-226 Th-228*-3.61*1.15*1.39"3.82*1.41"-2.70*1.89*-7.31~1.48*1.31*1.31*2.14*-2.09*-5.33+-6.29 4 931*-9.06*-7.19"-1.25*5.37*9.46" 1.83'-1.89"'.27*-7.75" 1.60": 1.26"-7.19":-1.16'6.57 E+00 E+01 E+00 E-02 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-02 E+00 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E+00 E-01 E+02 E-01 1.25 E+01 1.94 E+01 1.26 E+00 1.30 E+00 2.56 E+00 1.26 E+00 2.66 E+00 2.70 E+00 1.35 E+00 1.39 E+00 1.54 E+00 4.31 E+00 1.72 E+00 3.34 E+01 2.80 E+00 2.06 E+01 5.01 E+01 2.14 E+00 2.23 E+00 4.81 E+00 2.11 E+00 4.93 E+00 4.45 E+00 2.31 E+00 2.29 E+00 2.37 E+00 9.22 E+00 3.50 E+00 4.18 E+01 3.55 E+00 Denotes a result less than thc dctcction limit.
vAMMA TABLE B-10.1 (Cont.)TR METRY F ANIT RY WA TE TREAT E T W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 01/06/98-02/03/98 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228~-3.51" 6.84*-6.26*-8.01~1.21*9.05*1.16~7.94+2.46*-1.18*1.16"-1.44*7.59+-7.28*-8.49*6.56*1.28*1.14*5.09*2.96~5.26*-4.51+-2.61*3.32*1.82~195*1.96"-6.36*-7.53*8.08 E-01 E+00 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+01 E-02 E+00 E+01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E-01 E-01 E+00 E-01 E+01 E+00 1.10 E+01 1.69 E+01 1.22 E+00 1.23 E+00 2.65 E+00 1.39 E+00 2.66 E+00 2.40 E+00 1.27 E+00 1.35 E+00 1.34 E+00 3.92 E+00 1.77 E+00 2.34 E+01 2.04 E+00 1.76 E+01 3.94 E+01 1.90 E+00 1.97 E+00 4.27 E+00 1.94 E+00 4.30 E+00 3.77 E+00 2.01 E+00 2.22 E+00 2.12 E+00 6.23 E+00 2.50 E+00 3.50 E+01 3.19 E+00 Denotes a result less than the dctcction limit.
TABLE B-10.1 (Cont.)v MMA PE TR METRY F'NIT RY WA TE TREAT EN Results in pCi/liter WATER COLLECTION
~LOCATION..PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 03/03/98-04/01/98 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-4.48 A 6.00*-9.00"'.79*7.38"'.66*1.94~1.64":-7.28*9.78": 8.65*1.47"-4.71+1.10~-6.64+-6.72 A 2.58" 9.20 27*1.65*5.18 x 544":-1 90" 1.63" 1.20~4.67*7.16"-1.17*1.62 A 39'7 E+00 E+00 E-02 E-01 E-01 E-01 E+00 E+00 E-01 E-02 E-01 E+00 E-01 E+00 E+00 E+00 E+01 E-01 E-01 E+00 E-01 E-01 E+00 E+00 E-OI E-01 E+00 E+00 E+01 E+00 1.51 E+01 2.35 E+01 1.52 E+00 1.57 E+00 3.14 E+00 1.71 E+00 3.18 E+00 3.21 E+00 1.58 E+00 1.70 E+00 1.73 E+00 4.88 E+00 2.06 E+00 4.10 E+01 3.29 E+00 1.62 E+01 3.40 E+01 1.77 E+00 1.79 E+00 3.64 E+00 1.74 E+00 3.72 E+00 3.63 E+00 1.83 E+00 1.96 E+00 1.92 E+00 6.38 E+00 2.36 E+00 3.54 E+01 3.06 E+00 Denotes a result less than the detection limit.
TABLE B-10.1 (Cont.)AMMA PE R METRY F ANITARY WA TE TREATME T WATER Results in pCi/liter LOCATION 102C Prior to Discharge COLLECTION PERIOD 05/20/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 7 97"'.74" 1.20*-2.98" 1.65*-7.83~-1.52" 8.69*1.72*0.00*1.79+-2.68*4.63*-5.76*-2.33 E+00 E+01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E+01 E+00 RESULT OVERALL UNCERTAINTY 1.69 E+01 2.04 E+01 1.36 E+00 1.54 E+00 3.56 E+00 1.44 E+00 3.09 E+00 3.29 E+00 1.67 E+00 1.51 E+00 1.55 E+00 1.19 E+01 4.58 E+00 3.46 E+01 2.96 E+00 05/20/98 Be-7 K-40 Mn-54 Co-58 FG-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BQ-140 La-140 Ra-226 Th-228*5.52*-8.19*4.49"-1 04"'.76"-7.86" 2.84*1.69~2.34"-3.97"3.48*-3.75*-7.04*-5.59": 6.03 E+00 E+01 E-01 E+00 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+01 E-01'.00 E+01 3.60 E+01 1.86 E+00 2.1,4 E+00 4.79 E+00 1.85 E+00 3.97 E+00 4.39 E+00 2.19 E+00 1.98 E+00 2.04 E+00 1.51 E+01 6.10 E+00 3.38 E+01 3.08 E+00 Denotes a result less than the detection limit.
TABLE B-10.1 (Cont.)AMMA PE TR METRY F<A IT RV WASTE TRE<.ATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102C Prior to Discharge 10/21/98 10/21/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 LB-140 Ra-226 Th-228'-9.71":-9.82" 8.15" 1.64 x 249"-1.05*-3.77*-3.06*9.10*3.85"-4.18"'-7.45" 0.00~-1.19"-6.59*1.35"-2.60"'-1.28"-4.91*3.15*6.53 A 4.10*0.00" 1.60*2.80": 9.33"-1.56"'.03"'-6.66": 3.46 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E-02 E+00 E-01 E+00 E+01 E+00 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 1.90 E+01 5.27 E+01 2.08 E+00 2.12 E+00 4.23 E+00 2.07 E+00 4.69 E+00 4.14 E+00 2.15 E+00 2.41 E+00 2.31 E+00 6.58 E+00 2.56 E+00 4.24 E+01 3.59 E+00 1.32 E+01 2.85 E+01 1.44 E+00 1.45 E+00 2.94 E+00 1.47 E+00 3.11 E+00 2.90 E+00 1.49 E+00 1.63 E+00 1.64 E+00 4.55 E+00 1.72 E+00 2.96 E+01 2.61 E+00 Denotes a result less than the dctcction limit.
TABLE B-10.1 (Cont.)GRAMMA PE TR METRY F ANITARY WA TE TREATMFNT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 09/23/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.03"-6.47"-8.54*2.00"'-1.17" 0.00" 2.33" 1.13"-1.08"'-2.70"-7.29 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+01 E-02 x 101 E+01"'.15 E+00": 1.56 E+00<<-1.39 E+00 1.53 2.34 1.63 1.63 3 44 1.93 3.82 3.46 1.69 1.84 1.89 5.33 2.27 3.48 3.11 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 10/21/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.41"-5.29*4.46'72 000" 1.57": 1.65 91": 1.67*-8.21"'.61 441":-2.15 x 234"'-2.48 E-01 E+01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E-01 E+01 E-01 1.62 3.52 1.82 1.78 3.64 1.85 3.62 3.59 1.76 1.99 1.97 5.31 2.15 3.37 2.92 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit.
TABLE B-10.1 (Cont.)AMMA PE TR ETRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 11/18/98 12/16/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228+6.34~3.05" 6.58"-1.00*3.63+6.21*2.47"'.92 A 1.23*4.29*-4.06*6.58" 3.53*2.58" 1.04*-4.05*-6.54~4.89~3.03*1.57+4.39*-1.89*-2.17" 2.05 A-3.28"'.68~-1.43"615"-7.48 x 524 E+00 E+00 E-01 E+00 E+00 E-01 E-01 E-01 E+00 E-01 E+00 E-01 E-01 E+01 E+01 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+00 1.66 3.63 1.79 1.80 3.68 1.86 4.04 3.49 1.75 1.94 2.03 5.71 2.35 3.28 3.01 1.23 1.95 1.22 1.27 2.49 1.41 2.54 2.45 1.39 1.44 1.51 4.15 1.92 3.47 2.89 E+01 E+Ol E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit.
TABLE B-10.1 (Cont.)+AMMA PE TR METRY F ANIT RY WA TE TREAT ENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Head works 05/20/98 06/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-9S.Cs-134 Cs-137 Ba-140 La-140 Ra-226 TH-228"'.49":-4.14 x59p":-5.43 3.23"-1.93": 2.50"-1.30" 1.48 x 220*1.06"-4.1 1"-1 PP~-3.76"-1 40": 5.86" 5.58"-4.50%-4.52" 1.16"-9.33*-4.56":-8.62" 1.20":-9.78 x-1 12*2.08":-5.10"-4.03" 1.99 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+01 E+01 E+00 E+01 E-02 E-02 E+00 E-01 E-01 E-02 E+00 E-02 E+00 E-01 E+00 E+01 E+00 1.89 2.72 1.79 1.89 4.08 1.99 4.08 3.99 1.92 2.26 1.99 7.31 3.08 4.91 3.87 1.51 2.44 1.54 1.49 3.22 1.72 3.46 3.06 1.59 1.60 1.66 4.90 2,18 4.05 3.25 E+01'+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the dctcction limit.
TABLE B-10.1 (Cont.)AMMA PE TR M TRY F ANITARY WA TE TREATME T WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 07/15/98 08/19/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-2.01*1.71"'-1.36~-7.33"'-3.21" 1.67~-1.84*-1.90" 6.30*2.52": 2.08"-6.00*1.15+-4.46*1.67"-1 47" 3.77" 3.79"-5.16*0.00" 9.80": 3.98*1.47" 6.08*1.32~1.16"-7.25"-3.46 4 Q7'7 74 E+00 E+01 E+00 E-01 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+Ol E+00 1.83 2.71 1.89 2.10 4.36 2.35 4.36 3.98 1.97 2.16 2.21 6.75 3.74 4.00 3.63 1.73 2.69 2.03 2.02 3.97 2.05 3.94 3.66 1.93 2.13 2.24 5.59 2.59 4.08 3.50 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit.
TABLE B-10.1 (Cont.)MMA PE TR METRY F ANITARY W TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 05/06/98-06/03/98 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 350":-7.60 3 47-1 61 x 783"'-9.88"-2.74"-1.97"'.64" 1.28*2.02"-9.24"'-2.02*-4.29"4.78+-3.59" 3.19~1.30+-8.52"114" 1.20": 5.68'-6.84~1.10":-4.88" 1.51"559"-8.94"-5.15":-1.59 E+00 E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01'-01 E+00 E+01 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 E-02 E+01 E-02 2.20 E+01 4.45 E+01 2.21 E+00 2.42 E+00 5.10 E+00 2.23 E+00 4.90 E+00 4.64 E+00 2.49 E+00 2.53 E+00 2.42 E+00 1.07 E+01 4.45 E+00 4.05 E+01 3.66 E+00 1.45 E+01 2.39 E+01 1.58 E+00 1.48 E+00 2.94 E+00 1.70 E+00 3.31 E+00 3.24 E+00 1.43 E+00 1.69 E+00 1.77 E+00 4.63 E+00 2.09 E+00 4.07 E+01 3.26 E+00 Denotes a result less than the dete<<tion limit.
TABLE B-10.1 (Cont.)AMMA PE TR METRY F ANITARY WA TE.TREATM<NT WATER Results in pCi/liter LOCATION 102A COLLECTION PERIOD 07/01/98-08/05/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"2.83": 9.92"166" 1.36"155" 1.91"118"'-5.60" 1.35"-1.36"661"-1.17"-1.36 E-01 E-02 E+00 E-01 E+00 E-01 E+00 E-01 E-01 E+00 E-01 E+02 E+00 RESULT": 1.14, E+01":-7.96 E+01 OVERALL UNCERTAINTY 2.10 E+01 4.41 E+01 2.18 E+00 2.17 E+00 4.81 E+00 2.17 E+00 4.67 E+00 4.57 E+00 2.22 E+00 2.37 E+00 2.31 E+00 8.94 E+00 3.41 E+00 3.97 E+01 3.55 E+00 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 8.26":-1.24"'.52~-9.62" 1.49": 1.34"-1 05": 1.11" 2.10"'.84" 3.52": 3.38": 2.94"-7.96 x 423 E+00 E+01 E+00 E-02 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 2.05 E+01 4.41 E+01 2.16 E+00 2.13 E+00 4.69 E+00 2.13 E+00 4.61 E+00 4.33 E+00 2.17 E+00 2.31 E+00 2.36 E+00 8.42 E+00 3.38 E+00 4.04 E+01 3.50 E+00 Denotes a result less than thc dctcction limit.
TABLE B-10.1 (Cont.)+AMMA PE TR METRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 1.63":-2.92"-2.46"-9.91"'.38" 5.96"7.21"-1.36": 9.42"0.00" 3.59":-1.17" 6.13" 5.50*-3.00" 4.24": 6.42*4.64~1.56":-4.78":-3.76": 1.16~0.00 x I 18": 1.24"5.50"'-1.05"'-6.12+7.00 E+01 E+01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+01 E-01 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+01 E-01 2.01 E+01 2.66 E+01 1.94 E+00 1.87 E+00 4.46 E+00 2.01 E+00 4.26 E+00 4.14 E+00 2.06 E+00 2.07 E+00 2.30 E+00 8.41 E+00 4.29 E+00 4.33 E+01 3.85 E+00 1.53 E+01 2.46 E+01 1.50 E+00 1.51 E+00, 3.10 E+00 1.55 E+00 3.30 E+00 3.12 E+00 1.62 E+00 1.77 E+00 1.66 E+00 4.82 E+00 2.02 E+00 4.05 E+01 3.47 E+00 Denotes a result less than the detection limit.
TABLE B-10.1 (Cont.)AMMA PE TR METRY F ANITARY W TE TREATMENT WATER Results in pCifli ter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 11/03/98-12/01/98 12/01/98-01/05/99 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BB-140 La-l40 Ra-226 Th-228":-3 34"-1.31" 9.14" 5.96 x 384":-3.21":-2.13"140~1.92*3.55~1.29"4.89": 7.06":133":-2.05":509": 9.18":-6.93":-1.48": 2.88": 1.53 5 0'7 x+63" 1.16"-5.90" 1.70 4 8'7"ppp":-1.68 x'746 E+00 E+01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E-01 E-02 E+Ol E-01 E+00 E+01 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+O1 E+00 1.27 E+01 1.96 E+01 1.29 E+00 1.33 E+00 2.55 E+00 1.30 E+00 2.54 E+00 2.52 E+00 1.36 E+00 1.42 E+00 1.41 E+00 4.29 E+00 1.74 E+00 3.29 E+01 2.70 E+00 1.97 E+01 3.11 E+01 2.21 E+00 2.28 E+00 4.78 E+00 2.41 E+00 4.83 E+00 4.48 E+00 2.29 E+00 2.42 E+00 2.36 E+00 7.80 E+00 3.03 E+00 4.05 E+01 3.61 E+00 Denotes a result less than thc detection limit.
TABLE B-10.2 AMMA PE TR METRY F ANIT RY WA TE TREATMENT WAT.R-~MM R Results in pCilliter NUCLIDE AVERAGE LOW HIGH NUMBER.NUMBER SAMPLES POSITIVE 1028-Monthly Headworks Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)2.04E+00-5.73E-01 5.38E-01-5.30E-01 1.35E+00 4.54E-01 5.68E-01 1.69E-01 1.10E+00 3.14E-01 3.12E-01-1.50E+00-9.56E-O 1-2.29E+Ol-7.82E-O I-1.47E+01-5.29E+01-1.80E+00-1.39E+00-3.21E-01-9.79E-01-1.89E+00-2.26E+00-1.17E+00-1.22E+00-4.06E+00'6.00E+00-5.10E+00-4.64E+01-l 40E+Ol 1.09E+01 5.68E+01 3.79E+00 3.03E-01 3.63E+00 1.69E+00 3.98E+00 3.34E+00 2.29E+00 2.52E+00 2.33E+00 2.93E+00 1~15E+00 2.58E+01 1.04E+01 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 0 (I)Indicator Stations TABLE B-10.2 (" AMMA%PE TR METRY F ANITARY WASTE TREATMENT WATER-*.Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 102-Prior to Disehnr e Be-7 K-40 Mn-54 (I)-2.70E+00 (I)-2.51E+01 (I)5.84E-01 Co-58 (I)-4.73E-02 Fe-59 (I)2.08E+00 Co-60 (I)-4.92E-01 Zn-65 (I)4.13E-01 Zr-95 (I)-5.06E-01 Nb-95 (I)1.64E+00 Cs-134 (I)-1.96E-02 Cs-137 (I)5.06E-01 Ba-140 (I)'2.18E+00 La-140 (I)-1.49E+00 Ra-226 (I)-3.30E+0 l Tjl-228 (I)-1.21E+00-9.71E+00-8.19E+01-1.28E-01-1.04E+00-2.49E-01-1.05E+00-3.77E+00-3.06E+00 9.10E-01-3.97E-01-4.18E+00-3.75E+00-7.04E+00-5.76E+0 I-6.59E+00 5.52E+00 1.74E+01 1.20E+00 1.64E+00 3.76E+00 6.53E-01 4.10E+00 8.69E-OI 2.34E+00 2.80E-01 3 48E+00-7.45E-01 6.03E-OI-6.66E+00 3 46E+00 g)Indicator Stations TABLE B-10.2 AMMA PF.TR METRY F ANITARY WA TE TREATMENT WATER-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 1020-North tabilization Pond Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)8.60E+00-2.96E+00-1.69E+00-8.56E-01 1.47E+00 5.34E-01 5.05E-01 3.27E+00 1.52E+00-8.36E-01 1.69E+00 3.78E+00-1.73E+00-7.66E+01-1.78E+00 0.00E+00-3.98E+00-2.73E+00-1.21E+00 0.00E+00 2.00E-01-1.05E+00 2.44E+00 8.63E-02-1.77E+00 9.95E-01 3.18E+00-2.18E+00-1.48E+02-2.96E+00 1.72E+01-1.93E+00-6.54E-01-5.02E-01 2.94E+00 8.67E-01 2.06E+00 4.10E+00 2.95E+00 9.79E-02 2.39E+00 4.38E+00-1.28E+00-5.27E+00-6.03E-01 2 0 e g)Indicator Stations TABLE B-10.2 AMMA PE TR TRY F ANITARY WA TE TREAT ENT WATER-" NUCLIDE Results in pCi/liter AVERAGE LOW HIGH 102K-outh tabilization Pond NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)-6.46E+00-3.96E+01 6.59E-01-6.06E-01 3.39E+00-8.77E-01 1.01E+00-1.31E+00 1.15E+00 2.68E-01 1.46E+00 1.70E+00-1.40E+00-8.47E+01-2.82E+00-9.31E+00-9.06E+01-7.19E-02-1.25E+00 1.41E+00-2.70E+00 1.89E-01-1.89E+00 8.27E-01-7.75E-01 1.31E+00 1.26E+00-2.09E+00-l.16E+02-6.29E+00-3.61E+00 1.15E+01 1.39E+00 3.82E-02 5.37E+00 9.46E-01 1.83E+00-7.31E-01 1.48E+00 1.31E+00 1.60E+00 2.14E+00-7.19E-01-5.33E+01 6.57E-01 (I)Indicator Stations TABLE B-10.2 AMMA, PF.TR METRY F ANITARY WA TE TREATMENT WATER-


3.1SiteDescription 3.2ProgramBackground 3.3ProgramObjectives
==SUMMARY==
Results in pCi/liter NUCLIDE Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)AVERAGE 3.07E+00 3.31E+00 2.52E-OI-2.14E-O I" 1.12E+00 2.37E-OI 3.50E-OI-3.06E-O I 1.49E+00 2.80E-OI 1.42E+00 2.56E-OI-3.27E-02-4.01E+01 8.52E-03 LOW 102A-6.72E+00-7.96E+01-2.46E+00-1.48E+00-7.83E-O I-3.21E+00-4.51E+00-2.63E+00-7.28E-O I-5.90E-O I 1.35E-OI-1.17E+01-2.02E+00-I.17E+02-6.64E+00 1.63E+01 9.18E+01 1.52E+00 6.79E-OI 2.96E+00 1.53E+00 7.21E+00 1.64E+00 3.32E+00 1.84E+00 3.59E+00 7.16E+00 2.94E+00 1.62E+01 8.08E+00 NUMBER NUMBER SAMPLES POSITIVE 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 g)Indicator Stations I I I I I I TRITI TABLE B-11.1 M IN ANITARY WASTE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION DATE RESULT EFTF Kf<<OVERALL UNCERTAINTY H-3 102A 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-1 1/03/98 11/03/98-12/01/98 12/01/98-01/05/99 5.3 3.9 3.8 4.2 1.6 2.0 1.1 1.3 5.0 4.7 4.2 54 E+03 E+03 E+03 E+03 E+04 E+04 E+04 E+04 E+03 E+03 E+03 E+03 3.0 2.0 2.0 2.0 1.0 1.0 1.0 1.0 3.0 3.0 2.0 2.0 E+02 E+02 E+02 E+02 E+03 E+03 E+03 E+03 E+02 E+02 E+02 E+02 H-3 102B 01/21/98 02/25/98 03/18/98 04/15/98 05/20/98 06/17/98 07/15/98 08/19/98 09/23/98 10/21/98 11/18/98 12/16/98 onthl Headwot ks 5.1"'.3 6.6 1.0 7.1 1.8"'.9 4.7 1.2 4.0 20 7.8 E+02 E+02 E+02 E+03 E+03 E+03 E+01 E+02 E+03 E+02 E+03 E+02 2.0 1.9 8.0 1.0 3.0 2.0 9.2 1.0 2.0 1.2 2.0 1.3 E+02 E+02 E+01 E+02 E+02 E+02 E+01 E+02 E+02 E+02 E+02 E+02 H-3 102C 05/10/98 05/20/98 10/21/98 10/2 l/98 4.8 5.3 1.1 1.1 E+02 E+02 E+03 E+03 1.2 1.2 1.0 1.0 E+02 E+02 E+02 E+02 Dcnotcs a result less than thc detection limit.
TABLE B-11.1 (cont.)ITI IN NITARY W E TRKA ENT W TER Results in pCi/liter LOCATION COLLECTION DATE RESULT OVERALL UNCERTAINTY H-3 102D 05/12/98 11/17/98 orth tahilizati n Ponds 6.7 E+02 1.2 E+03 1.2 E+02 1.0 E+02 H-3 102E 05/12/98 11/17/98 outh tabilizati n Ponds 5.5 E+02 1.3 E+03 1.2 E+02 2.0 E+02 TABLE B-11.2 (Cont.)TRITI M IN ANITARY WA TK TRKATMFNT W TKR-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE H-3 (I)3.74E+03 ll am les 5.9E+01 2.0E+04 32 30 H-3 (I)102-A 8.04E+03 FFTF Effluen 3.8E+03 2.0E+04 12 12 H-3 (I)102-B 1.34E+03 onthl Head works 5.9E+01 7.1E+03 12 10 H-3 (I)102-C 8.03E+02 Prior t Dischar e 4.8E+02 1.1E+03 North tabilization Ponds H-3 (I)102-D 9.35E+02 6.7E+02 1.2E+03 H-3 (I)102-E 9.25E+02 South tahilization Ponds 5.5E+02 1.3E+03 (I)Indicator Stations I I TABLE B-12.1 AMMA PE TR M RY F ANITARY WA TE TRFATMF T EDIMEN Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102D 102D 102D 04/21/98 10/27/98 11/17/98 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 EU-152 Th-228 1.04 E+04"'-3.32 E+00 1.64 E+02*3.23 E+01 1.32 E+02 1.19 E+03*3.40 E+01 5.46 E+02 8.98 E+03*-2.51 E-01 2.11 E+03"'.57 E+01 7.20 E+01 1.51 E+03*8.79 E+01 4.48 E+02 1.32 E+04*-7.47 E+00*4.85 E+00" 4.58 E+01*1.59 E+01 1.54 E+03*6.31 E+01 9.67 E+02 7 01 E+02 1.85 E+01 3.97 E+01 2.58 E+01 4.08 E+01 5.49 E+02 1.16 E+02 4.67 E+01 6.58 E+02 1.99 E+01 1.00 E+02 3.10 E+01 4.01 E+01 6.58 E+02 1.04 E+02 4.87 E+01 3.27 E+02 8.88 E+00 9.23 E+00 1.06 E+01 9.91 E+00 2.70 E+02 4.95 E+01 2.43 E+01 Denotes a result less than the detection limit.
TABLE B-12.2 AMMA PE TR METRY F ANITARY WA TE TREATMENT EDIME T-SIIMMARV Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER SAMPLES NUMBER POSITIVE K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 EU-152 Th-228 (I).1.09E+04 (I)-3.68E+00 (I)7.60E+02 (I)3.46E+01 (I)7.33E+01 (I)1.41E+03 (I)6.17E+01 (I)6.54E+02 8.98E+03-7.47E+00 4.85E+00 2.57E+01 1.59E+01 1.19E+03 3.40E+01 4.48E+02 1.32E+04-2.51E-01 2.11E+03 4.58E+01 1.32E+02 1.54E+03 8.79E+01 9.67E+02 g)Indicator Stations STATION 118 SOIL RESULTS I I I TABLE B-13.1 AMMA PE TR METRY F STATI N 118 S II.Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 118 06/09/98 Be-7 K-40 Cs-134 Cs-137 Ra-226 Th-228 1.71 E+02 1.31 E+04*2.18 E+01*1.37 E+01 6.40 E+02 5.21 E+02 6.27 E+01 2.59 E+02 6.00 E+00 5.76 E+00 1.44 E+02 1.42 E+01 Denotes a result less than the detection limit.
TABLE B-13.2 AMMA PE TR METRY F ATI N 118 8 IL-MM RY Results in pCi/kilogram NUCLIDE AVERAGE'OW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Cs-134 (I)Cs-137 (I)'a-226 (I)Tjl-228 (I)1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 (I)Indicator Stations WASHINGTON PUIILIC POWER 4N SUPPLY SYSTEM WASHINGTON PUBLIC POWER SUPPLY SYSIKM NVCLKAR PLANT 2 1997 AN1'AJAL RADIOLOGICAL ENVIRON1UIENTAL OPERATING REPORT JANUARY 1 to DECEMBER 31, 1997 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM Prepared by J.E.McDonald and L,S.Schleder Washington Public Power Supply System Richland, WA and C.A.Mendola Teledyne Brown Engineering Environmental Services Westwood, NJ TABLE OF CONTENTS 1.0 EXECUTIVE


==4.0 PROGRAMDESCRIPTION==
==SUMMARY==
4.1SampleLocations 4.2LandUseCensus4.3SamplingMethods4.3.1DirectRadiation 4.3.2AirborneParticulate/Iodine 4.3.3Water4.3.4Soil4.3.5Sediment4.3.6Fish4.3.7Milk4.3.8GardenProduce4.3.9Vegetation 4.4Analytical Procedures 4.4.1GrossBetaActivityonParticulate Filters4.4.2Measurement ofGammaEmitters4.4.3GrossBetaActivityinWater4.4.4Iodine-131 inWater4;4.5TritiuminWater4.4.6Strontium-89 and90inWater,MilkandSoil4.4.7Iodine-131 inMilk4.5DataAnalysisMethods2-13-13-13-13-24-14-14-14-24-24-34-34-44-54-54-54-64-64-64-64-64-74-74-84-84-84-9 TABLEFCONTENTS5.0RESULTSANDDISCUSSION 5.1DirectRadiation 5.2AirborneParticulate/Iodine 5.3Water5.4Soil5.5RiverSediment5.6Fish5.7Milk5.8GardenProduce5-15-45-55-65-65-75-75-76.05.9SpecialInterestSamplingLocations 5.9.1StormDrainPond(Station101)5.9.2SanitaryWasteTreatment Facility(Station102)5.9.3Containerized StorageArea(Station118)5.9.4CoolingTowerSedimentDisposalArea(Station119)5.9.5SprayPondDrainField5.101997SampleDeviations QUALITYASSURANCE ANDQUALITYCONTROL6.1QualityControlFortheSupplySystemEnvironmental TLDProgram6.2QualityControlFortheAnalytical Program6.2.1SupplySystemQualityControlActivities 6.2.2TeledyneBrownEngineering QualityControlProgram5-75-75-95-9s~~5-105-116-16.16-26-26-


==27.0REFERENCES==
==2.0 DEFINITIONS==


8.01996REMPREPORTERRATA7-18-1 LISTOFTABLES4-14-24-34-45-15-25-35-45-55-66-36-46-56-66-7Radiological Environmental Monitoring ProgramPlanREMPSampleLocations BySector1997FiveMileLandUseCensusResultsComparison ofTeledyneNominalLowerLimitsofDetection WithOffsiteDoseCalculation ManualRequirements Radiological Environmental Monitoring ProgramComparative Summary1997SampleDeviations Radiological Environmental Monitoring ProgramSummaryMeanQuarterly TLDDataSummaryForThePreoperational andOperational PeriodsAnnualTLDDataSummaryForthePreoperational andOperational Periods1997MeanQuarterly VersusAnnualTLDData1997Environmental SpikedDosimeter Results1997Environmental Measurements Laboratory (EML)QualityAssessment ProgramResults1997TeledyneBrownQualityControlData-Blanks1997TeledyneBrownQualityControlData-Spikes1997EPAIntercomparison ProgramResults1997Analytics, Inc.CrossCheckComparison Program1996QualityAssurance TaskForceIntercomparison StudyHanford100AreaSoilSample4-104-144-174-185-125-175-185-285-305-326-56-66-76-86-96-126-14 LISTOFFIGURES3-14-14-24-34-45-15-25-35-45-55-65-7AverageWindDirection During1997REMPSamplingLocations Withinthe10-MileRadiusREMPSamplingLocations Outsidethe10-MileRadiusREMPSamplingLocations Sunnyside/Grandview AreaREMPNearPlantSamplingLocations SiteBoundaryQuarterly TLDs-1984-96Hi/Low/Mean vs.1997AnnualMeanbySectorNear-Plant Quarterly TLDs-1984-96Hi/Low/Mean vs.1997AnnualMeanbySectorRemoteQuarterly TLDs-1984-96Hi/Low/Mean vs.1997AnnualMeanbySectorFrequency Distribution for1997Quarterly TLDsFrequency Distribution for1984-96Quarterly TLDs1985-96WeeklyHi/Low/Mean vs.1997WeeklyMeanGrossBetainAir-NearPlantStations1985-96WeeklyHi/Low/Mean vs.1997WeeklyMeanGrossBetainAir-RemoteStations3-14-194-204-214-225-25-25-35-35-35-45-8GrossBetainRiver/Drinking Water-19975-55-9'-105-11GrossBetainPlantDischarge Water-1997TritiuminDischarge WaterandGallonsEffluentDischarged
==3.0 INTRODUCTION==
-1989-97TritiuminDischarge Water-19975-55-65-65-12AverageMonthlyTritiumatStormDrainOutfall-1992-975-8


==1.0 EXECUTIVE==
3.1 Site Description 3.2 Program Background 3.3 Program Objectives 4.0 PROGRAM DESCRIPTION 4.1 Sample Locations 4.2 Land Use Census 4.3 Sampling Methods 4.3.1 Direct Radiation 4.3.2 Airborne Particulate/Iodine 4.3.3 Water 4.3.4 Soil 4.3.5 Sediment 4.3.6 Fish 4.3.7 Milk 4.3.8 Garden Produce 4.3.9 Vegetation
SUMMARYTheWashington PublicPowerSupplySystemRadiological Environmental Monitoring Program(REMP)evaluates theradiological impactofPlant2operations ontheenvironment intheAirborne, DirectRadiation, Waterborne, andIngestion pathwaysasspecified intheOffsiteDoseCalculation Manual(ODCM).TheSupplySystem'sPlant2isa1200MWcommercial nuclearpowerplantthatachievedinitialcriticality onJanuary19,1984.Samplesofair,water,milk,soil,sediment, fishandgardenproducewerecollected throughout theyearandanalyzedforradionuclides specifictoplantoperations.
 
Radiation levelswerealsomonitored continuously during1997withthermoluminescent dosimeters (TLDs).Thesampleswerecollected inestablished areasneartheplantandatotherlocations whichcouldbeaffectedbyPlant2effluents.
===4.4 Analytical===
Thisinformation wascomparedtosamplestakeninareasthatwereunlikelytobeaffectedbyplantoperations.
Procedures 4.4.1 Gross Beta Activity on Particulate Filters 4.4.2 Measurement of Gamma Emitters 4.4.3 Gross Beta Activity in Water 4.4.4 Iodine-131 in Water 4;4.5 Tritium in Water 4.4.6 Strontium-89 and 90 in Water, Milk and Soil 4.4.7 Iodine-131 in Milk 4.5 Data Analysis Methods 2-1 3-1 3-1 3-1 3-2 4-1 4-1 4-1 4-2 4-2 4-3 4-3 4-4 4-5 4-5 4-5 4-6 4-6 4-6 4-6 4-6 4-7 4-7 4-8 4-8 4-8 4-9 TABLE F CONTENTS 5.0 RESULTS AND DISCUSSION 5.1 Direct Radiation 5.2 Airborne Particulate/Iodine 5.3 Water 5.4 Soil 5.5 River Sediment 5.6 Fish 5.7 Milk 5.8 Garden Produce 5-1 5-4 5-5 5-6 5-6 5-7 5-7 5-7 6.0 5.9 Special Interest Sampling Locations 5.9.1 Storm Drain Pond (Station 101)5.9.2 Sanitary Waste Treatment Facility (Station 102)5.9.3 Containerized Storage Area (Station 118)5.9.4 Cooling Tower Sediment Disposal Area (Station 119)5.9.5 Spray Pond Drain Field 5.10 1997 Sample Deviations QUALITY ASSURANCE AND QUALITY CONTROL 6.1 Quality Control For the Supply System Environmental TLD Program 6.2 Quality Control For the Analytical Program 6.2.1 Supply System Quality Control Activities 6.2.2 Teledyne Brown Engineering Quality Control Program 5-7 5-7 5-9 5-9 s~~5-10 5-11 6-1 6.1 6-2 6-2 6-2
The1997REMPdatawasalsocomparedtodatacollected duringpreviousyearsofplantoperation andtothedatacollected priortoinitialplantoperation.
 
Mostoftheresultsofsamplescollected bytheREMPduring1997werebelowdetection levels.Someanalyses, suchasgrossbetainairandwater,wereabovethedetection levelfornearlyallsamples.Thisisduetothelowdetection limitforthegrossbetaanalysisandalsototheabundance ofnaturally occurring beta-emitting radionuclides intheenvironment.
==7.0 REFERENCES==
Otherresultsabovedetection levels,suchascesium-137 insoilandsediment, reflecttheeffectofpastHanfordactivities orfalloutfromChernobyl andpastnuclearweaponstesting.Tritiumconcentration indischarge watercontinued tobelowerthanthemeanlevelsobservedfromthe1992through1996periods.Thisreduction isduetoanongoingreduction inthevolumeoftheradwastedischarges totheColumbiaRiver.TheREMPanalytical resultsandTLDresultsweredemonstrated tobeaccuratethroughintercomparison programswhichareprovidedaspartofthequalityassurance activities conducted during1997.Suchintercomparisons testedtheperformance oftheSupplySystemmonitoring programtoothermonitoring programsusingknownradioactive standards.
 
TheSupplySystemREMPanalytical contractor performed wellintheEnvironmental Measurements Laboratory (EML)QualityAssessment Program,Environmental Protection AgencyIntercomparison Studies,andtheAnalytics, Inc.CrossCheckComparison Programconducted during1997.In1996,theSupplySystemalsoparticipated intheQualityAssurance TaskForce(QATF)intercomparison forsoilsamples.Theresultsforthisintercomparison werereceivedinthespringof1997.TheQATFischairedbytheWashington Department ofHealthandhasasitsmembersthevariousenvironmental programsontheHanfordSite.TheSupplySystemresultsforthisintercomparison werealsofavorable.
8.0 1996 REMP REPORT ERRATA 7-1 8-1 LIST OF TABLES 4-1 4-2 4-3 4-4 5-1 5-2 5-3 5-4 5-5 5-6 6-3 6-4 6-5 6-6 6-7 Radiological Environmental Monitoring Program Plan REMP Sample Locations By Sector 1997 Five Mile Land Use Census Results Comparison of Teledyne Nominal Lower Limits of Detection With Offsite Dose Calculation Manual Requirements Radiological Environmental Monitoring Program Comparative Summary 1997 Sample Deviations Radiological Environmental Monitoring Program Summary Mean Quarterly TLD Data Summary For The Preoperational and Operational Periods Annual TLD Data Summary For the Preoperational and Operational Periods 1997 Mean Quarterly Versus Annual TLD Data 1997 Environmental Spiked Dosimeter Results 1997 Environmental Measurements Laboratory (EML)Quality Assessment Program Results 1997 Teledyne Brown Quality Control Data-Blanks 1997 Teledyne Brown Quality Control Data-Spikes 1997 EPA Intercomparison Program Results 1997 Analytics, Inc.Cross Check Comparison Program 1996 Quality Assurance Task Force Intercomparison Study Hanford 100 Area Soil Sample 4-10 4-14 4-17 4-18 5-12 5-17 5-18 5-28 5-30 5-32 6-5 6-6 6-7 6-8 6-9 6-12 6-14 LIST OF FIGURES 3-1 4-1 4-2 4-3 4-4 5-1 5-2 5-3 5-4 5-5 5-6 5-7 Average Wind Direction During 1997 REMP Sampling Locations Within the 10-Mile Radius REMP Sampling Locations Outside the 10-Mile Radius REMP Sampling Locations Sunnyside/Grandview Area REMP Near Plant Sampling Locations Site Boundary Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Near-Plant Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Remote Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Frequency Distribution for 1997 Quarterly TLDs Frequency Distribution for 1984-96 Quarterly TLDs 1985-96 Weekly Hi/Low/Mean vs.1997 Weekly Mean Gross Beta in Air-Near Plant Stations 1985-96 Weekly Hi/Low/Mean vs.1997 Weekly Mean Gross Beta in Air-Remote Stations 3-1 4-19 4-20 4-21 4-22 5-2 5-2 5-3 5-3 5-3 5-4 5-8 Gross Beta in River/Drinking Water-1997 5-5 5-9'-10 5-11 Gross Beta in Plant Discharge Water-1997 Tritium in Discharge Water and Gallons Effluent Discharged
Theanalytical datacollected bytheREMPin1997remainedconsistent withtheenvironmental datacollected duringthepreoperational periodandprioroperational years.Basedonthedata,nosignificant newtrendsorchangesintheenvironmental radiological levelsaroundtheplantwereobserved.
-1989-97 Tritium in Discharge Water-1997 5-5 5-6 5-6 5-12 Average Monthly Tritium at Storm Drain Outfall-1992-97 5-8 1.0 EXECUTIVE  
l997REMPANNUALREPORT
 
==SUMMARY==
The Washington Public Power Supply System Radiological Environmental Monitoring Program (REMP)evaluates the radiological impact of Plant 2 operations on the environment in the Airborne, Direct Radiation, Waterborne, and Ingestion pathways as specified in the Offsite Dose Calculation Manual (ODCM).The Supply System's Plant 2 is a 1200 MW commercial nuclear power plant that achieved initial criticality on January 19, 1984.Samples of air, water, milk, soil, sediment, fish and garden produce were collected throughout the year and analyzed for radionuclides specific to plant operations.
Radiation levels were also monitored continuously during 1997 with thermoluminescent dosimeters (TLDs).The samples were collected in established areas near the plant and at other locations which could be affected by Plant 2 effluents.
This information was compared to samples taken in areas that were unlikely to be affected by plant operations.
The 1997 REMP data was also compared to data collected during previous years of plant operation and to the data collected prior to initial plant operation.
Most of the results of samples collected by the REMP during 1997 were below detection levels.Some analyses, such as gross beta in air and water, were above the detection level for nearly all samples.This is due to the low detection limit for the gross beta analysis and also to the abundance of naturally occurring beta-emitting radionuclides in the environment.
Other results above detection levels, such as cesium-137 in soil and sediment, reflect the effect of past Hanford activities or fallout from Chernobyl and past nuclear weapons testing.Tritium concentration in discharge water continued to be lower than the mean levels observed from the 1992 through 1996 periods.This reduction is due to an ongoing reduction in the volume of the radwaste discharges to the Columbia River.The REMP analytical results and TLD results were demonstrated to be accurate through intercomparison programs which are provided as part of the quality assurance activities conducted during 1997.Such intercomparisons tested the performance of the Supply System monitoring program to other monitoring programs using known radioactive standards.
The Supply System REMP analytical contractor performed well in the Environmental Measurements Laboratory (EML)Quality Assessment Program, Environmental Protection Agency Intercomparison Studies, and the Analytics, Inc.Cross Check Comparison Program conducted during 1997.In 1996, the Supply System also participated in the Quality Assurance Task Force (QATF)intercomparison for soil samples.The results for this intercomparison were received in the spring of 1997.The QATF is chaired by the Washington Department of Health and has as its members the various environmental programs on the Hanford Site.The Supply System results for this intercomparison were also favorable.
The analytical data collected by the REMP in 1997 remained consistent with the environmental data collected during the preoperational period and prior operational years.Based on the data, no significant new trends or changes in the environmental radiological levels around the plant were observed.l997 REMP ANNUAL REPORT
\I  
\I  


==2.0 DEFINITIONS==
==2.0 DEFINITIONS==
AirborneActivitySampling:
Airborne Activity Sampling: Continuous sampling of air through the collection of particulates and radionuclides on filter media.Periodic soil samples are collected for gamma isotopic analysis to provide information on deposition to the soil from airborne releases.Alpha Particle (a): A charged particle emitted from the nucleus of an atom having a mass and charge equal in magnitude of a helium nucleus.EFSEC: Energy Facility Site Evaluation Council FFTF: U.S Department of Energy's Fast Flux Test Facility near Plant 2.Also known as the 400 Area.Flow Proportional Sampling: Sample collection volume or frequency determined as a function of the flow rate of the water being sampled.Grab Sample: A single discrete sample drawn at.one point in time.Becquerel (Bq): One disintegration per second.One picocurie (pCi)equals 0.037 becquerel.
Continuous samplingofairthroughthecollection ofparticulates andradionuclides onfiltermedia.Periodicsoilsamplesarecollected forgammaisotopicanalysistoprovideinformation ondeposition tothesoilfromairbornereleases.
Beta Particle (P): Charged particle emitted from the nucleus of an atom, with a mass and charge equal in magnitude to that of an electron.Blank Sample: A sample of the same media as the field sample being analyzed but without the radionuclide(s) being measured.It enables correction for the inherent sample background.
AlphaParticle(a):Achargedparticleemittedfromthenucleusofanatomhavingamassandchargeequalinmagnitude ofaheliumnucleus.EFSEC:EnergyFacilitySiteEvaluation CouncilFFTF:U.SDepartment ofEnergy'sFastFluxTestFacilitynearPlant2.Alsoknownasthe400Area.FlowProportional Sampling:
Composite Sample: A series of single collected portions (aliquots) analyzed as one sample.The aliquots making up the sample are collected at time intervals that are very short compared to the composite period.Control Station: A background sampling location, i.e., a location not likely to be affected by plant effluents due to its distance and/or direction from Plant 2.Counting Error: An estimate of the two-sigma uncertainty associated with the sample results based , respective count times.+/-2 f(SumplcCPM/CouuQTmc+BkgCpm/Countlt mc)Curie (Ci): 3.7 x 10'isintegrations per second, or 2.22 x 10'isintegrations per minute.Direct Radiation Monitoring:
Samplecollection volumeorfrequency determined asafunctionoftheflowrateofthewaterbeingsampled.GrabSample:Asinglediscretesampledrawnat.onepointintime.Becquerel (Bq):Onedisintegration persecond.Onepicocurie (pCi)equals0.037becquerel.
The measurement of radiation dose at various distances from the plant is assessed through the use of thermoluminescent dosimeters and pressurized ionization chambers.DOH: Washington State Department of Health.Indicator Station: A sampling location that could be affected by plant effluents due to its proximity and/or direction from Plant 2.Ingestion Pathway Monitoring:
BetaParticle(P):Chargedparticleemittedfromthenucleusofanatom,withamassandchargeequalinmagnitude tothatofanelectron.
The ingestion pathway includes milk, soil, fish, garden produce.Also sampled (under special circumstances) are other media such as vegetation and animal products such as eggs and meat when additional information about particular radionuclides is needed.Lower Limit of Detection (LLD): The smallest concentration of radioactive material in a sample that will yield a net count (above system background) that will be detected with 95%probability with a 5%probability of a false conclusion that a blank observation represents"real" signal.LLD>>4.66$b/(222>>Vol>>Eg>>Yield>>ct
BlankSample:Asampleofthesamemediaasthefieldsamplebeinganalyzedbutwithouttheradionuclide(s) beingmeasured.
"")Where LLD is the"a priori" or'before-the-fact'easurement and not"a posreriori" or'after-the-fact'easurement.
Itenablescorrection fortheinherentsamplebackground.
Mean: The average, i.e., the sum of results divided by the number of results.Microcurie:
Composite Sample:Aseriesofsinglecollected portions(aliquots) analyzedasonesample.Thealiquotsmakingupthesamplearecollected attimeintervals thatareveryshortcomparedtothecomposite period.ControlStation:Abackground samplinglocation, i.e.,alocationnotlikelytobeaffectedbyplanteffluents duetoitsdistanceand/ordirection fromPlant2.CountingError:Anestimateofthetwo-sigma uncertainty associated withthesampleresultsbased,respective counttimes.+/-2f(SumplcCPM/CouuQTmc+BkgCpm/Countlt mc)Curie(Ci):3.7x10'isintegrations persecond,or2.22x10'isintegrations perminute.DirectRadiation Monitoring:
3.7 x 10'isintegrations per second, or 2.22 x10c disintegrations per minute.Milliroentgen (mR): 1/1000 Roentgen;a unit of exposure to X or gamma radiation.
Themeasurement ofradiation doseatvariousdistances fromtheplantisassessedthroughtheuseofthermoluminescent dosimeters andpressurized ionization chambers.
NIST: National Institute of Standards and Technology.
DOH:Washington StateDepartment ofHealth.Indicator Station:Asamplinglocationthatcouldbeaffectedbyplanteffluents duetoitsproximity and/ordirection fromPlant2.Ingestion PathwayMonitoring:
NRC: U.S.Nuclear Regulatory Commission.
Theingestion pathwayincludesmilk,soil,fish,gardenproduce.Alsosampled(underspecialcircumstances) areothermediasuchasvegetation andanimalproductssuchaseggsandmeatwhenadditional information aboutparticular radionuclides isneeded.LowerLimitofDetection (LLD):Thesmallestconcentration ofradioactive materialinasamplethatwillyieldanetcount(abovesystembackground) thatwillbedetectedwith95%probability witha5%probability ofafalseconclusion thatablankobservation represents "real"signal.LLD>>4.66$
2-1 1997 REMP ANNUAL REPORT ODCM: Offsite Dose Calculation Manual, which contains the program requirements formerly contained in the Technical Specifications.
b/(222>>Vol>>Eg>>Yield>>ct
SWTF: Sanitary Waste Treatment Facility;sanitary waste processing facility for Plant 2 and WNP-1 and WNP-4 sites.Picocurie (pCi): 1 x 10" Curie or 2.22 disintegrations per minute;one millionth of a microcurie.
"")WhereLLDisthe"apriori"or'before-the-fact'easurement andnot"aposreriori" or'after-the-fact'easurement.
REMP: Radiological Environmental Monitoring Program.TEDA: triethylene diamine TLD: Thermoluminescent dosimeter.
Mean:Theaverage,i.e.,thesumofresultsdividedbythenumberofresults.Microcurie:
ATLD contains a phosphor which stores energy from exposure to radiation and emits that energy in the form of light when heated.Range: The difference between the smallest and largest results.Restricted Area: Any area to which access is controlled for purposes of protection of individuals from exposure to radiation and radioactive materials.
3.7x10'isintegrations persecond,or2.22x10cdisintegrations perminute.Milliroentgen (mR):1/1000Roentgen; aunitofexposuretoXorgammaradiation.
Results: The results of sample collection are discussed and interpreted by comparing them to similar measurements made during the preoperational and previous operational periods and to the detection capabilities associated with the current methods of analysis.Roentgen: Unit of exposure to X or gamma (v)radiation in air.Site Certification Agreement (SCA): The Plant 2 licensing agreement with the State of Washington.
NIST:NationalInstitute ofStandards andTechnology.
Spike Sample: A sample containing a known concentration of the radionuclide(s) being measured.Standard Deviation:
NRC:U.S.NuclearRegulatory Commission.
A measure of the scatter of a set of observations (or samples)around their mean value.Indicated by (t7).Standard Error of the Mean: An estimate of the uncertainty associated with the mean of observation (or sample)averages.where S~, the variance is S I 1(n-1)+(Xl-X)~1997 REMP ANNUAL REPORT 2-2  
2-11997REMPANNUALREPORT ODCM:OffsiteDoseCalculation Manual,whichcontainstheprogramrequirements formerlycontained intheTechnical Specifications.
SWTF:SanitaryWasteTreatment Facility; sanitarywasteprocessing facilityforPlant2andWNP-1andWNP-4sites.Picocurie (pCi):1x10"Curieor2.22disintegrations perminute;onemillionth ofamicrocurie.
REMP:Radiological Environmental Monitoring Program.TEDA:triethylene diamineTLD:Thermoluminescent dosimeter.
ATLDcontainsaphosphorwhichstoresenergyfromexposuretoradiation andemitsthatenergyintheformoflightwhenheated.Range:Thedifference betweenthesmallestandlargestresults.Restricted Area:Anyareatowhichaccessiscontrolled forpurposesofprotection ofindividuals fromexposuretoradiation andradioactive materials.
Results:Theresultsofsamplecollection arediscussed andinterpreted bycomparing themtosimilarmeasurements madeduringthepreoperational andpreviousoperational periodsandtothedetection capabilities associated withthecurrentmethodsofanalysis.
Roentgen:
UnitofexposuretoXorgamma(v)radiation inair.SiteCertification Agreement (SCA):ThePlant2licensing agreement withtheStateofWashington.
SpikeSample:Asamplecontaining aknownconcentration oftheradionuclide(s) beingmeasured.
StandardDeviation:
Ameasureofthescatterofasetofobservations (orsamples)aroundtheirmeanvalue.Indicated by(t7).StandardErroroftheMean:Anestimateoftheuncertainty associated withthemeanofobservation (orsample)averages.
whereS~,thevarianceisSI1(n-1)+(Xl-X)~1997REMPANNUALREPORT2-2  
 
==3.0INTRODUCTION==


3.1SiteDescription TheWashington PublicPowerSupplySystem'sNuclearPlant2islocatedinasparselypopulated shrub-steppe regionwithintheDepartment ofEnergy'sHanfordSiteinsoutheastern Washington.
==3.0 INTRODUCTION==
Theplantisapproximately threemileswestoftheColumbiaRiverandissurrounded onallsidesbyuninhabited desertland.Thenearestpopulation centersareRichland, PascoandKennewick, whichare12milessouth,18milessoutheast, and21milessoutheast, respectively.
Thenearestprivately-owned landsarelocatedapproximately fourmilesENEoftheplant,acrosstheColumbiaRiver.Giventheprevailing winddirections, showninthe1997'indfrequency distribution inFigure3-1,thefocusofREMPsamplingisthefarmingregioneastoftheplantsite.BecausePlant2islocatedontheHanfordSite,otherpotential sourcesofradioactive materials areincloseproximity toPlant2.Forthisreason,samplinglocations neartheplantprovideusefulinformation forseparating thepotential effectsofPlant2fromthoseoftheothersourcesontheHanfordSite.3.2ProgramBackground TheREMPisdesignedtoconformtotheregulatory guidanceoftheNuclearRegulatory Commission (NRC)asprovidedbyRegulatory Guides4.1tuand4.8"',including theRadiological Assessment BranchTechnical Position"'.
lilac':1!iNWle%WNW4,7%~SO>i~"'''':-
,.;.C,.C~'8%NI.D%$.7%I.t<xNEl.7%2~7%Q3.;.CM%Thequalityassurance aspectsoftheprogramandtS%'.:C;:;.:.'l%
thethermoluminescent dosimetry areconducted Figure3-1AverageWindDirection During1997inaccordance withRegulatory Guides4.15"'nd4.13"'.TheREMPalsomustadheretotherequirements oftheWashington EnergyFacilitySiteEvaluation Council(EFSEC)'",
thePlant2Technical Specifications"'nd theOffsiteDoseCalculation Manual(ODCM)'".
Theserequirements covernotonlytheenvironmental samplingandsampleanalysisaspectsoftheprogram,butalsothereporting andqualityassurance requirements oftheprogram.Thepreoperational phaseoftheprogram,whichlastedfromMarch1978untilinitialcriticality inJanuary1984,providedabaselineofbackground environmental data.Thevariability inthebackground levelsofradioactivity isduetodifferences ingeologiccomposition, Chernobyl andnuclearweaponstestfallout,meteorological conditions andseasonalchanges.3-1t997REMPANNUALREPORT REMPenvironmental samplesareanalyzedbyacontractanalytical laboratory.
TeledyneBrownEngineering Environmental ServicesinWestwood, NewJerseyhasperformed theanalysisofREMPsamplessinceJune1986.Thethermoluminescent dosimeters usedintheREMPtoassessthedirectradiation wereprocessed inthepastbytheSupplySystem.In1996,theSupplySystemcontracted withThermoNUtech, toprocesstheTLDsintheirWestRichlandlaboratory.
In1997,ThermoNUtech movedtheirlaboratory toAlbequerque, NewMexico.Anyradiological effectofPlant2ontheenvironment mustbedistinguished fromthenormalvariation inbackground radiation levelsandfromtheeffectsofothersourcesofradioactive effluents inthearea.Themonitoring resultsobtainedduringeachyearoftheplant'soperation arecomparedtothepreoperational dataandtodatafrompreviousoperating yearstodetermine whetherasignificant accumulation ofplant-produced radionuclides hasoccurredintheenvironment.
Quarterly averagesoftheresultsarealsocomparedtotheNRCnon-routine reporting levelslistedintheODCM.Inadditiontoevaluating theenvironmental concentrations againstfederalstandards orlimits,theREMPalsocomparestheresultstostatestandards.""""""
Theresultsarediscussed andinterpreted bycomparing themtosimilarmeasurements madeduringthepreoperational andpreviousoperational periodsandtothedetection capabilities associated withthecurrentmethodsofanalysis.
Thequalityassurance andqualitycontrolaspectsoftheprogramarealsodiscussed inthisreport.t3.3ProgramObjectives TheREMPprovidesamechanism fordetermining whetherthelevelsofradioactivity intheplantenvironsarewithinestablished limitsandtoensurethattheaccumulation ofradionuclides intheenvironment willnotbecomesignificant asaresultofplantoperations.
Whilein-plantmonitoring programsareusedtoensurethat10CFR20"'nd 10CFR50""
criteriaforreleasesofradioactive effluents aremet,theREMPprovidessupplemental verification thattheconcentrations ofradionuclides intheenvironment arenotgreaterthananticipated.
1997REMPANNUALREPORT3-2


==4.0 PROGRAMDESCRIPTION==
3.1 Site Description The Washington Public Power Supply System's Nuclear Plant 2 is located in a sparsely populated shrub-steppe region within the Department of Energy's Hanford Site in southeastern Washington.
Therequirement fortheRadiological Environmental Monitoring Program(REMP)isdefinedbytheWNP-2OffsiteDoseCalculation Manual(ODCM).Thesamplingplanpresented inTable4-1inthisreportshowswhichsamplesarerequiredbytheODCMandprovidesasummaryofthesamplelocations, collection frequency, andtypesofanalysesperformed.
The plant is approximately three miles west of the Columbia River and is surrounded on all sides by uninhabited desert land.The nearest population centers are Richland, Pasco and Kennewick, which are 12 miles south, 18 miles southeast, and 21 miles southeast, respectively.
Themethodsofsamplingandsamplingfrequencies utilizedintheprogramhavebeendetermined bysuchfactorsasthehalf-lives andmajorexposurepathwaysfortheradionuclides potentially releasedfromtheplanttothesurrounding environment.
The nearest privately-owned lands are located approximately four miles ENE of the plant, across the Columbia River.Given the prevailing wind directions, shown in the 1997'ind frequency distribution in Figure 3-1, the focus of REMP sampling is the farming region east of the plant site.Because Plant 2 is located on the Hanford Site, other potential sources of radioactive materials are in close proximity to Plant 2.For this reason, sampling locations near the plant provide useful information for separating the potential effects of Plant 2 from those of the other sources on the Hanford Site.3.2 Program Background The REMP is designed to conform to the regulatory guidance of the Nuclear Regulatory Commission (NRC)as provided by Regulatory Guides 4.1tu and 4.8"', including the Radiological Assessment Branch Technical Position"'.
4.1SampleLocations Eighty-three samplelocations wereincludedinthe1997monitoring program.Seventy-five indicator andthreecontrol(i.e.background) stationswerelocatedwithin10miles(16kilometers) ofPlant2.Threeadditional controlstationsandtwoindicator stationswereoutsidethe10-mileradiusfromtheplant.SamplestationsarelistedinTable4-2bymeteorological sector,samplemediaandapproximate distancefromtheplant.Thenumbersandlocations ofsamplestationsarebasedprimarily onfactorssuchaspopulation distribution andmeteorological conditions andalso'onstationaccessibility, securitythroughout theyearandtherequirements ofapplicable regulations.
lilac': 1!i NW le%WNW 4,7%~SO>i~"'''':-
Otherfactors,suchastheneedtomonitorlocations whichpotentially couldbeimpactedbyPlant2operations, influence thelocationofREMPsamplingsites.TheREMPsamplinglocations listedinTables4-1and4-2areshowninFigures4-1and4-2.Figure4-3providesamoredetailedmapofsamplinglocations intheSunnyside/Grandview area.Figure4-4showsthelocations ofthestormdrain(Station101)andtheSanitaryWasteTreatment Facility(Station102),whichareNPDESsites.Alsoshownarethecontainerized storagearea(Station118),thecoolingtowerlandfill(Station119)andthesprayponddrainfield (Station120)whicharespecialintereststations.
,.;.C ,.C~'8%N I.D%$.7%I.t<x NE l.7%2~7%Q3.;.C M%The quality assurance aspects of the program and tS%'.:C;:;.:.'l%
4.2LandUseCensusThelandusecensusforareaswithin5milesofPlant2wasperformed inAugust.Theobjectives ofthelandusecensusaretoidentifythelocations ofthenearestmilkanimal,residence, andgardengreaterthan50m~(500ft')producing broadleaf vegetation andtodetermine whetheranysitelocatedduringthecensushasacalculated doseordosecommitment
the thermoluminescent dosimetry are conducted Figure 3-1 Average Wind Direction During 1997 in accordance with Regulatory Guides 4.15"'nd 4.13"'.The REMP also must adhere to the requirements of the Washington Energy Facility Site Evaluation Council (EFSEC)'", the Plant 2 Technical Specifications"'nd the Offsite Dose Calculation Manual (ODCM)'".These requirements cover not only the environmental sampling and sample analysis aspects of the program, but also the reporting and quality assurance requirements of the program.The preoperational phase of the program, which lasted from March 1978 until initial criticality in January 1984, provided a baseline of background environmental data.The variability in the background levels of radioactivity is due to differences in geologic composition, Chernobyl and nuclear weapons test fallout, meteorological conditions and seasonal changes.3-1 t 997 REMP ANNUAL REPORT REMP environmental samples are analyzed by a contract analytical laboratory.
/greaterthanthesitescurrently monitored forthesameexposurepathway.Ifanewlocationwithahigherdosecommitment isfound,routinesamplingofthatdosepathwaywouldbeinitiated atthatnewsite.Theresultsofthe1997landusecensuswithin5milesofPlant2aregiveninTable4-3.Nochangesfromthe1996landusecensuswereobserved.
Teledyne Brown Engineering Environmental Services in Westwood, New Jersey has performed the analysis of REMP samples since June 1986.The thermoluminescent dosimeters used in the REMP to assess the direct radiation were processed in the past by the Supply System.In 1996, the Supply System contracted with ThermoNUtech, to process the TLDs in their West Richland laboratory.
Nomilkanimalsarelocatedwithinthe5-mileradius.Thenearestmilklocationislocated7.2mileseast-southeast ofPlant2.4-11997REMPANNUALREPORT 4.3SamplingMethodsEnvironmental sampleswerecollected according totheprogramplaninTable4-1.Allsampleswerecollected bySupplySystempersonnel.
In 1997, ThermoNUtech moved their laboratory to Albequerque, New Mexico.Any radiological effect of Plant 2 on the environment must be distinguished from the normal variation in background radiation levels and from the effects of other sources of radioactive effluents in the area.The monitoring results obtained during each year of the plant's operation are compared to the preoperational data and to data from previous operating years to determine whether a significant accumulation of plant-produced radionuclides has occurred in the environment.
Documented procedures forsamplecollection andTLDanalysesarecontained intheSupplySystem'sEnvironmental andAnalytical Laboratory Instruction (EALI)manual.Thesampleanalysesprocedures arepreparedandmaintained bytheanalytical contractor andreviewedbytheSupplySystempriortoimplementation.
Quarterly averages of the results are also compared to the NRC non-routine reporting levels listed in the ODCM.In addition to evaluating the environmental concentrations against federal standards or limits, the REMP also compares the results to state standards."""""" The results are discussed and interpreted by comparing them to similar measurements made during the preoperational and previous operational periods and to the detection capabilities associated with the current methods of analysis.The quality assurance and quality control aspects of the program are also discussed in this report.t 3.3 Program Objectives The REMP provides a mechanism for determining whether the levels of radioactivity in the plant environs are within established limits and to ensure that the accumulation of radionuclides in the environment will not become significant as a result of plant operations.
Thefollowing sectionsdescribethesamplingandpreparation methods..
While in-plant monitoring programs are used to ensure that 10CFR20"'nd 10CFR50"" criteria for releases of radioactive effluents are met, the REMP provides supplemental verification that the concentrations of radionuclides in the environment are not greater than anticipated.
4.3.1DirectRadiation During1997,thermoluminescent dosimeters (TLDs)wereusedtodetermine thedirectradiation levelsatsixty(60)monitoring locations listedinTable4-1.InJanuary1997,TLDStation65wasadded.Thisstationis7.3milessouthofPlant2andislocatednearanewhousingdevelopment.
1997 REMP ANNUAL REPORT 3-2 4.0 PROGRAM DESCRIPTION The requirement for the Radiological Environmental Monitoring Program (REMP)is defined by the WNP-2 Offsite Dose Calculation Manual (ODCM).The sampling plan presented in Table 4-1 in this report shows which samples are required by the ODCM and provides a summary of the sample locations, collection frequency, and types of analyses performed.
Also,TLDstationsST120-West andST120-Control wereremoved.Theremaining station,ST120-East, islocatedmidwaydownthebankofthesprayponddrainfield trenchneartheareaofgreatestsedimentdeposition.
The methods of sampling and sampling frequencies utilized in the program have been determined by such factors as the half-lives and major exposure pathways for the radionuclides potentially released from the plant to the surrounding environment.
TheVLDsatST119-Control willserveatthecontrolstationforST120.ThecontrolstationTLD(background) islocatedatStation9AinSunnyside.
4.1 Sample Locations Eighty-three sample locations were included in the 1997 monitoring program.Seventy-five indicator and three control (i.e.background) stations were located within 10 miles (16 kilometers) of Plant 2.Three additional control stations and two indicator stations were outside the 10-mile radius from the plant.Sample stations are listed in Table 4-2 by meteorological sector, sample media and approximate distance from the plant.The numbers and locations of sample stations are based primarily on factors such as population distribution and meteorological conditions and also'on station accessibility, security throughout the year and the requirements of applicable regulations.
Theremaining TLDsservedasindicator TLDsthroughout theyear.TwosetsofTLDsplacedthreefeetabovegroundwereemployedateachlocation.
Other factors, such as the need to monitor locations which potentially could be impacted by Plant 2 operations, influence the location of REMP sampling sites.The REMP sampling locations listed in Tables 4-1 and 4-2 are shown in Figures 4-1 and 4-2.Figure 4-3 provides a more detailed map of sampling locations in the Sunnyside/Grandview area.Figure 4-4 shows the locations of the storm drain (Station 101)and the Sanitary Waste Treatment Facility (Station 102), which are NPDES sites.Also shown are the containerized storage area (Station 118), the cooling tower landfill (Station 119)and the spray pond drainfield (Station 120)which are special interest stations.4.2 Land Use Census The land use census for areas within 5 miles of Plant 2 was performed in August.The objectives of the land use census are to identify the locations of the nearest milk animal, residence, and garden greater than 50 m~(500 ft')producing broadleaf vegetation and to determine whether any site located during the census has a calculated dose or dose commitment
OnesetofTLDswereexchanged onaquarterly basis(Quarterly TLDs)andtheotherexchanged onanannualbasis'(Annual TLDs).ExposurereceivedbythefieldTLDsduringtransport totheTLDsiteswasmonitored byasetoftripcontroldosimeters thataccompanied thefielddosimeters toandfromthefieldlocations.
/greater than the sites currently monitored for the same exposure pathway.If a new location with a higher dose commitment is found, routine sampling of that dose pathway would be initiated at that new site.The results of the 1997 land use census within 5 miles of Plant 2 are given in Table 4-3.No changes from the 1996 land use census were observed.No milk animals are located within the 5-mile radius.The nearest milk location is located 7.2 miles east-southeast of Plant 2.4-1 1997 REMP ANNUAL REPORT 4.3 Sampling Methods Environmental samples were collected according to the program plan in Table 4-1.All samples were collected by Supply System personnel.
AnothersetofTLDswereusedasbuildingcontrolswhichwereusedtodetermine theexposureoftheTLDsatthecontrolled storagelocation.
Documented procedures for sample collection and TLD analyses are contained in the Supply System's Environmental and Analytical Laboratory Instruction (EALI)manual.The sample analyses procedures are prepared and maintained by the analytical contractor and reviewed by the Supply System prior to implementation.
TheTLDexposureduringtransport toandfromthefieldwasdetermined bysubtracting thedifference betweenthebuildingcontrolresultsandthetripcontrolresults.Since1995,theREMPhasusedHarshawTLDsandsince1996,theenvironmental dosimeters havebeenprocessed byavendor,ThermoNUtech.
The following sections describe the sampling and preparation methods..4.3.1 Direct Radiation During 1997, thermoluminescent dosimeters (TLDs)were used to determine the direct radiation levels at sixty (60)monitoring locations listed in Table 4-1.In January 1997, TLD Station 65 was added.This station is 7.3 miles south of Plant 2 and is located near a new housing development.
Theenvironmental dosimeters wereprocessed oneitheraHarshawModel8800oraHarshawModel6600TLDReader.Thefilegenerated whentheHarshawTLDreaderprocesses theenvironmental TLDswasstoredinthehostcomputerandusedasinputfortheHarshawalgorithm thatcalculates environmental doses.TheTLDreaderwastypically calibrated within7dayspriortoprocessing fieldTLDs.TheTLDreaderwascalibrated ingenericunitsusingcalibration cardsirradiated onaThermoNUtech Sr-90source."Relative response" factors(gU/R)wereusedbythedosealgorithm toconvertanelementreadingingUfromthereadertotheRoentgenequivalent reading.Theexposurevaluesdetermined forcalibration exposures, aswellastheexposures ofsomeQAdosimeters (processing controldosimeters),
Also, TLD stations ST120-West and ST120-Control were removed.The remaining station, ST120-East, is located midway down the bank of the spray pond drainfield trench near the area of greatest sediment deposition.
werebasedonaNationalInstitute ofStandards andTechnology (NIST)traceable Sr-90source.Theexposurevaluesfortheauditdosimeters (spikeddosimeters) werebasedonthecalculated fieldstrengthofaSupplySystemCs-137source.Ionization chambermeasurements
The VLDs at ST119-Control will serve at the control station for ST120.The control station TLD (background) is located at Station 9A in Sunnyside.
-madeduringTLDexposurewereusedtoconfirmthecalculated exposure.
The remaining TLDs served as indicator TLDs throughout the year.Two sets of TLDs placed three feet above ground were employed at each location.One set of TLDs were exchanged on a quarterly basis (Quarterly TLDs)and the other exchanged on an annual basis'(Annual TLDs).Exposure received by the field TLDs during transport to the TLD sites was monitored by a set of trip control dosimeters that accompanied the field dosimeters to and from the field locations.
Ifthecalculated exposureandtheionization chamberreadingdifferedby5%ormore,aninvestigation wasperformed toresolvethedifference.
Another set of TLDs were used as building controls which were used to determine the exposure of the TLDs at the controlled storage location.The TLD exposure during transport to and from the field was determined by subtracting the difference between the building control results and the trip control results.Since 1995, the REMP has used Harshaw TLDs and since 1996, the environmental dosimeters have been processed by a vendor, ThermoNUtech.
1997REMPANNUALREPORT4-2 TwoReuterStokespressurized ionization chambers(PICs)providedadditional capability formeasuring directradiation exposure.
The environmental dosimeters were processed on either a Harshaw Model 8800 or a Harshaw Model 6600 TLD Reader.The file generated when the Harshaw TLD reader processes the environmental TLDs was stored in the host computer and used as input for the Harshaw algorithm that calculates environmental doses.The TLD reader was typically calibrated within 7 days prior to processing field TLDs.The TLD reader was calibrated in generic units using calibration cards irradiated on a ThermoNUtech Sr-90 source."Relative response" factors (gU/R)were used by the dose algorithm to convert an element reading in gU from the reader to the Roentgen equivalent reading.The exposure values determined for calibration exposures, as well as the exposures of some QA dosimeters (processing control dosimeters), were based on a National Institute of Standards and Technology (NIST)traceable Sr-90 source.The exposure values for the audit dosimeters (spiked dosimeters) were based on the calculated field strength of a Supply System Cs-137 source.Ionization chamber measurements-made during TLD exposure were used to confirm the calculated exposure.If the calculated exposure and the ionization chamber reading differed by 5%or more, an investigation was performed to resolve the difference.
Theseunitsarenolongerpartoftheroutinemonitoring program,buttheyareusedinspecialmonitoring situations andmaintained asback-upmonitoring systems.4.3.2AirborneParticulate/Iodine Airparticulate andairiodine(1-131)sampleswereobtainedthroughtheuseofportable, lowvolume(1.5cfm)constantflow-rate samplingunitsateachoftwelvelocations.
1997 REMP ANNUAL REPORT 4-2 Two Reuter Stokes pressurized ionization chambers (PICs)provided additional capability for measuring direct radiation exposure.These units are no longer part of the routine monitoring program, but they are used in special monitoring situations and maintained as back-up monitoring systems.4.3.2 Airborne Particulate/Iodine Air particulate and air iodine (1-131)samples were obtained through the use of portable, low volume (1.5 cfm)constant flow-rate sampling units at each of twelve locations.
ThesamplesdrawnatStation9A(Figure4-3)wereconsidered controlsamples;theonesdrawnattheotherlocations (Figure43)wereindicator samples..
The samples drawn at Station 9A (Figure 4-3)were considered control samples;the ones drawn at the other locations (Figure 43)were indicator samples..Air particulates were collected by drawing.air through a 47mm diameter glass fiber filter.Air iodine was collected by drawing air through a 57mm diameter TEDA impregnated charcoal cartridge.
Airparticulates werecollected bydrawing.air througha47mmdiameterglassfiberfilter.Airiodinewascollected bydrawingairthrougha57mmdiameterTEDAimpregnated charcoalcartridge.
The particulate air filter and charcoal cartridge were placed in tandem, particulate filter first, in a holder that attached to the air inlet of the sampler unit.The sampler units were placed in ventilated metal weatherproof housings mounted on elevated platforms at each air sample location.The filter media are'changed weekly and shipped to the analytical contractor for analysis within, one or two days of collection.
Theparticulate airfilterandcharcoalcartridge wereplacedintandem,particulate filterfirst,inaholderthatattachedtotheairinletofthesamplerunit.Thesamplerunitswereplacedinventilated metalweatherproof housingsmountedonelevatedplatforms ateachairsamplelocation.
New air sampler units were purchased in 1997, and were placed in service beginning in May.By the first week in October, all of the sampler units had been replaced.4.3.3 Water There were nine locations for water sampling in 1997: three for the evaluation of river/drinking water, one for plant discharge water, three for groundwater, one for the storm drain water, and one for sanitary waste water.One river/drinking water location, Station 26, was used for evaluation of the plant intake water, i.e., the river water taken upstream of the plant discharge point.This sample location is also used for a drinking water sample since Plant 2 draws its drinking water from the intake water.It is considered the river/drinking water control sample because of its upstream location.Two additional locations, Stations 28 and 29, were used to evaluate the water at the two nearest drinking water locations, the Department of Energy 300 Area and the Richland Water Treatment Plant.These two stations were considered indicator stations.The ODCM requirement for a downstream water sample"near but beyond the mixing zone" was met by sampling water from Station 27, the plant discharge line to the Columbia River.This sample reflects the radioactivity present in the plant discharge prior to any river dilution, rather than the concentrations that.would be found after dilution in the mixing zone.Water is drawn at this location because it was not feasible to perform flow-proportional composite sampling in the mixing zone area of the river downstream from the plant discharge point.The Station 27 sample is also considered an indicator sample.Composite samplers are installed at the Columbia River pumphouse to monitor the plant intake water (Control Station 26), and the cooling tower discharge line (Station 27).There are composite samplers at the two drinking water locations (Stations 28 and 29).The samplers collect 25-ml aliquots of water at regular intervals of time or flow.Non-routine analyses on the drinking water samples include strontium-90 and iodine-131 analysis.Strontium-90 analysis is required when the gross beta activity exceeds either 8 pCi/liter or ten times the mean of the 4-3 1997 REMP ANNUAL REPORT previous three months'ctivity for a specific location.Iodine-131 analysis is required when the dose calculated for the consumption of water exceeds one millirem per year.Neither of these analyses were required during 1997.There are three wells within the vicinity of Plant 2 that are used as groundwater sampling locations.
Thefiltermediaare'changed weeklyandshippedtotheanalytical contractor foranalysiswithin,oneortwodaysofcollection.
These are a deep well on the Plant 2 site (0.1 mile north of the Reactor Building)and two wells on the WNP-1 site (1.2 miles downgradient from Plant 2).Water from the Plant 2 well can be used as a backup source for drinking and fire protection'.
Newairsamplerunitswerepurchased in1997,andwereplacedinservicebeginning inMay.BythefirstweekinOctober,allofthesamplerunitshadbeenreplaced.
Water from the WNP-1 wells supplies the drinking and fire protection water for the WNP-1 site.Although none of these wells draw from the unconfined aquifer, they are considered indicator samples.Quarterly grab samples were, taken from each.of these.wells.One.gallon (3.8 liters)was collected from each well for gamma analysis and one liter was drawn for tritium analysis.Water samples were collected from the storm drain outfall (Station 101)using a flow proportional composite sampler.These samples were analyzed for gross beta, gamma and tritium.EFSEC Resolution No.259 for the Sanitary Waste Treatment Facility (SWTF;Station 102)requires a monthly sample to be taken at the headworks (102B)which was analyzed for gamma and tritium and two samples prior to discharge (102C)which were taken at the discharge weir of the south pond.Those samples were analyzed for gross alpha, gross beta, gamma and tritium.In addition, one sample was taken from the west end of each pond and analyzed for gross beta, gamma and tritium.Beginning in April of 1997, the SWTF began reiving sanitary waste from the U.S.Department of Energy's 400 Area.The Supply System installed a flow meter an'd composite sampler on the 400 Area sewer line just above where the 400 Area/Plant Support Facility (PSF)intertie is-located.This sampler takes a flow-proportional composite sample which was collected at least monthly.Gross alpha and beta analyses, tritium analysis, and gamma analysis were performed on each sample.4.3.4 Soil As required by the Site Certification Agreement (EFSEC Resolution No.260"'), annual soil samples were taken at the indicator stations, Stations 1, 7, 21 and 23.One sample was taken at the control.location, Station 9A (Figure 4-3).Quarterly soil samples were collected at two special interest locations, Station 101 and Station 118, as shown in Figures 4-4.Each sample was collected from an area of approximately one square foot to a depth of approximately one inch.Approximately two kilograms of soil were collected in each sample.Soil samples were shipped to the analytical contractor after collection and analyzed for gamma activity.If the gamma isotopic analysis indicates that cesium levels in any of the indicator samples exceeds ten (10)times the level in the control sample, a strontium analysis is performed on the sample(s).
4.3.3WaterTherewereninelocations forwatersamplingin1997:threefortheevaluation ofriver/drinking water,oneforplantdischarge water,threeforgroundwater, oneforthestormdrainwater,andoneforsanitarywastewater.Oneriver/drinking waterlocation, Station26,wasusedforevaluation oftheplantintakewater,i.e.,theriverwatertakenupstreamoftheplantdischarge point.ThissamplelocationisalsousedforadrinkingwatersamplesincePlant2drawsitsdrinkingwaterfromtheintakewater.Itisconsidered theriver/drinking watercontrolsamplebecauseofitsupstreamlocation.
'o strontium analysis was required during 1997.1997 REMP ANN VAL REPORT 4-4 4.3.5 Sediment For the second year, only the fall collection of the semiannual sediment could be taken.High water levels in the Columbia River covered the two sample sites well into the early summer.The fall sample was collected at the end of October.The upstream sediment sample (Station 33)was collected from a location approximately two miles upriver from the plant discharge.
Twoadditional locations, Stations28and29,wereusedtoevaluatethewateratthetwonearestdrinkingwaterlocations, theDepartment ofEnergy300AreaandtheRichlandWaterTreatment Plant.Thesetwostationswereconsidered indicator stations.
The downstream sample (Station 34)was collected approximately'one mile downstream of the plant discharge.
TheODCMrequirement foradownstream watersample"nearbutbeyondthemixingzone"wasmetbysamplingwaterfromStation27,theplantdischarge linetotheColumbiaRiver.Thissamplereflectstheradioactivity presentintheplantdischarge priortoanyriverdilution, ratherthantheconcentrations that.wouldbefoundafterdilutioninthemixingzone.Waterisdrawnatthislocationbecauseitwasnotfeasibletoperformflow-proportional composite samplinginthemixingzoneareaoftheriverdownstream fromtheplantdischarge point.TheStation27sampleisalsoconsidered anindicator sample.Composite samplersareinstalled attheColumbiaRiverpumphouse tomonitortheplantintakewater(ControlStation26),andthecoolingtowerdischarge line(Station27).Therearecomposite samplersatthetwodrinkingwaterlocations (Stations 28and29).Thesamplerscollect25-mlaliquotsofwateratregularintervals oftimeorflow.Non-routine analysesonthedrinkingwatersamplesincludestrontium-90 andiodine-131 analysis.
Each sample consisted of approximately two kilograms of the shallow surface sediment scooped from below the waterline.
Strontium-90 analysisisrequiredwhenthegrossbetaactivityexceedseither8pCi/liter ortentimesthemeanofthe4-31997REMPANNUALREPORT previousthreemonths'ctivity foraspecificlocation.
The samples were shipped to the analytical contractor.
Iodine-131 analysisisrequiredwhenthedosecalculated fortheconsumption ofwaterexceedsonemilliremperyear.Neitheroftheseanalyseswererequiredduring1997.TherearethreewellswithinthevicinityofPlant2thatareusedasgroundwater samplinglocations.
Sediment samples were also taken from the storm drain (Station 101)outfall and pond and the SWTF.(Station 102)north stabilization pond.Sediment sampling in these locations was performed in a manner similar to river sediment sampling.Special care was taken to prevent loss of the fine particulates in the sediment.In addition, formalin was added to the sanitary pond sediment prior to shipping, to inhibit gas formation within the sample container.
TheseareadeepwellonthePlant2site(0.1milenorthoftheReactorBuilding) andtwowellsontheWNP-1site(1.2milesdowngradient fromPlant2).WaterfromthePlant2wellcanbeusedasabackupsourcefordrinkingandfireprotection'.
A 2-kilogram sample of dried cooling tower sediment was collected from the sediment disposal ell (Station 119)within thirty days of the completion of cleaning the cooling towers.In 1997 the cooling towers were cleaned once, hence, only one sample was collected for gamma spectrometry analysis.4.3.6 Hsh The annual fish sampling was performed in late September and early October.Fish samples collected from the Columbia River (Station 30 in Figure 4-1)were indicator samples, whereas the fish collected on the Snake River (Stations 38 and 38A in Figure 4-2), were control samples.Three separate fish samples, consisting of an anadromous species and two other species generally considered edible or potentially edible (such as carp, catfish and whitefish) were collected at each location.All the fish were collected using electro-shocking except the samples of the anadromous species which were collected from the Ringold hatchery on the Columbia River and at the Lyons Ferry Fish Hatchery on the Snake River.The fish were filleted to obtain approximately one kilogram of edible flesh per sample.The fillets were placed in clean plastic bags and frozen until shipment to the analytical contractor.
WaterfromtheWNP-1wellssuppliesthedrinkingandfireprotection waterfortheWNP-1site.Althoughnoneofthesewellsdrawfromtheunconfined aquifer,theyareconsidered indicator samples.Quarterly grabsampleswere,takenfromeach.ofthese.wells.One.gallon(3.8liters)wascollected fromeachwellforgammaanalysisandoneliterwasdrawnfortritiumanalysis.
Fish are sampled annually unless elevated radiation levels related to plant operations are observed, in which case sampling is conducted semiannually.
Watersampleswerecollected fromthestormdrainoutfall(Station101)usingaflowproportional composite sampler.Thesesampleswereanalyzedforgrossbeta,gammaandtritium.EFSECResolution No.259fortheSanitaryWasteTreatment Facility(SWTF;Station102)requiresamonthlysampletobetakenattheheadworks (102B)whichwasanalyzedforgammaandtritiumandtwosamplespriortodischarge (102C)whichweretakenatthedischarge weirofthesouthpond.Thosesampleswereanalyzedforgrossalpha,grossbeta,gammaandtritium.Inaddition, onesamplewastakenfromthewestendofeachpondandanalyzedforgrossbeta,gammaandtritium.Beginning inAprilof1997,theSWTFbeganreivingsanitarywastefromtheU.S.Department ofEnergy's400Area.TheSupplySysteminstalled aflowmeteran'dcomposite sampleronthe400Areasewerlinejustabovewherethe400Area/Plant SupportFacility(PSF)intertieis-located.Thissamplertakesaflow-proportional composite samplewhichwascollected atleastmonthly.Grossalphaandbetaanalyses, tritiumanalysis, andgammaanalysiswereperformed oneachsample.4.3.4SoilAsrequiredbytheSiteCertification Agreement (EFSECResolution No.260"'),annualsoilsamplesweretakenattheindicator
4.3.7 Milk Milk samples were collected monthly January through March and October through December and semimonthly during the spring and summer months when the cows were likely to be grazing or on fresh feed.Enough raw milk was collected from each sampling location to obtain a one gallon sample after the cream had been skimmed off.The samples were refrigerated overnight and the cream skimmed off the next morning., The milk samples were chilled.and shipped to the analytical contractor within a day of collection.
: stations, Stations1,7,21and23.Onesamplewastakenatthecontrol.location, Station9A(Figure4-3).Quarterly soilsampleswerecollected attwospecialinterestlocations, Station101andStation118,asshowninFigures4-4.Eachsamplewascollected fromanareaofapproximately onesquarefoottoadepthofapproximately oneinch.Approximately twokilograms ofsoilwerecollected ineachsample.Soilsampleswereshippedtotheanalytical contractor aftercollection andanalyzedforgammaactivity.
4-5 1997 REMP ANNUAL REPORT the tion Routine samples were collected from two indicator locations (Stations 36 and 64)across Columbia River in Franklin County.Milk samples were also collected at one indicator sta (Station 9B)and one control location (Station 96)in the Sunnyside/Grandview area (in Figure 4-3).Station 9B in Sunnyside serves as an'indicator station because a portion of the feed for the cows at that location is hay from Fraiiklin County north of Pasco.That factor makes it unsuitable for use as a control location.4.3.8 Garden Produce Samples of local garden produce were collected monthly from April to September when the produce was.readily, available.
Ifthegammaisotopicanalysisindicates thatcesiumlevelsinanyoftheindicator samplesexceedsten(10)timesthelevelinthecontrolsample,astrontium analysisisperformed onthesample(s).
When possible,.three.
'ostrontium analysiswasrequiredduring1997.1997REMPANNVALREPORT4-4 4.3.5SedimentForthesecondyear,onlythefallcollection ofthesemiannual sedimentcouldbetaken.HighwaterlevelsintheColumbiaRivercoveredthetwosamplesiteswellintotheearlysummer.Thefallsamplewascollected attheendofOctober.Theupstreamsedimentsample(Station33)wascollected fromalocationapproximately twomilesupriverfromtheplantdischarge.
types of.produce samples (a root crop, fruit, and a leafy vegetable) were collected at each location.The indicator samples were collected from a region in a predominant downwind direction (Station 37 in Figure 4-2)where crops are irrigated with Columbia River water.The control samples were obtained from produce stands in the Sunnyside area (Station 9C in Figure 4-3), the direction least likely to be affected by plant effluents.
Thedownstream sample(Station34)wascollected approximately'one miledownstream oftheplantdischarge.
Apples were collected in September from Station 91, the Rio Vista Farms orchard, which is irrigated with Columbia River water.t 4.3.9 Vegetation The annual sample of vegetation growing in the storm drain pond was collected in June.Cattails and grasses were the principal types of vegetation collected.
Eachsampleconsisted ofapproximately twokilograms oftheshallowsurfacesedimentscoopedfrombelowthewaterline.
Approximately two kilograms of sample were collected each time.Care was taken to avoid including the roots or soil from around the roots in the samples.4.4 Analytical Procedures The analytical procedures used for the 1997 REIVIP samples are described below.Teledyne Brown Engineering Environmental Services performed all routine analyses of REMP samples during 1997.4.4.1 Gross Beta Activity.on Particulate Filters The particulate filters were counted in a gas flow-proportional counter after a delay of five or more days to allow for the radon-222 and radon-220 (thoron)daughter products to decay.An unused air particulate filter was counted as the blank with each weekly set of filters.4.4.2 Measurement of Gamma Emitters A shielded Ge(Li)detector system was coupled to a computer-based data acquisition system which performed pulse height and gamma energy analysis.The information collected about each peak was compared to a library of known peaks.Isotopic identification was performed as was the radioactivity calculation which used the appropriate fractional gamma ray abundance, half-life, detector efficiency, and net counts in the peak region.1997 REMP ANNVAL REPORT 4-6 Milk and Water A 1-liter Marinelli beaker was filled with a representative aliquot of the sample.The sample was then counted for at least 1000 minutes (16.7 hours).Foodstuff As much of the edible portion of the sample as possible was loaded into a tared Marinelli beaker and weighed.The sample was then counted for at least 1000 minutes (16.7 hours).~Ve etat ion As much sample..as.possible is placed in a 1-liter Marinelli beaker and counted for approximately 1000 minutes (16.7 hours).The sample is not dried prior to counting, so the results are given in terms of wet weight.Soils and Sediments A large quantity of the sample was dried at a temperature below 100'C.As much sample as possible was loaded into a tared 1-liter Marinelli beaker and weighed.The sample was then counted for at least 360 minutes (6 hours).Charcoal Cartrid es Air Iodine Charcoal filters were counted up to five at a time, with one positioned on the face and up to four on the side of the calibrated Ge(Li)detector.The detection limit for a charcoal cartridge was uniquely determined for each filter and by using its position.In the event that iodine-131 would have been observed in the initial counting of a set, each charcoal cartridge in the set was then positioned separately on the face of the detector and counted.Air Particulate Filters Four air particulate filters for a quarterly composite from each field station were aligned one in front of another and counted for at least 360 minutes (6 hours).4.4.3 Gross Beta Activity in Water A o'e-liter aliquot of each sample was evaporated to a small volume and transferred to a stainless steel planchet.The sample was dried under heat lamps, cooled, then counted on an automatic beta proportional counter.The results were calculated using empirical self-absorption curves which enabled the correction of effective counting efficiency based on the sample residue mass.4.4.4 Iodine-131 in Water Two liters of sample were first equilibrated with a stable iodide carrier.A batch treatment with anion exchange resin was used to remove iodine from the sample.The iodine was then stripped from the resin with sodium hypochlorite solution, reduced with hydroxylamine hydrochloride, and extracted into carbon tetrachloride as free iodine.It was then back-extracted as iodide into a sodium bisulfite solution and precipitated as palladium iodide.The precipitate was weighed for chemical yield and mounted on a nylon planchet for low-level beta counting.The chemical 4-7 1997 REMP ANNUAL REPORT yield was corrected by measuring the stable iodide content of the water with a specific ion electrode.
Thesampleswereshippedtotheanalytical contractor.
During 1997, this procedure was used only on intercomparison samples, since the doses calculated via ODCM methodology for the consumption of drinking water did not exceed one millirem per year.4.4.5 Tritium in Water The analysis of tritium in water was performed utilizing liquid scintillation.
Sedimentsampleswerealsotakenfromthestormdrain(Station101)outfallandpondandtheSWTF.(Station 102)northstabilization pond.Sedimentsamplingintheselocations wasperformed inamannersimilartoriversedimentsampling.
Liquid scintillation requires 10 milliliters of.water mixed with 10 milliliters of liquid scintillation"cocktail." The mixture is then counted in an automatic liquid scintillation detector.4.4.6 Strontium-89 and 90 in Water, Milk and Soil During 1997, strontium analyses were not required for any routine REMP water, milk or soil samples.It was used for intercomparison water and sediment analyses.The techniques used to analyze for strontium in the various media are described below.Water Stable strontium carrier was added to one liter of sample and the volume is reduced by evaporation.
Specialcarewastakentopreventlossofthefineparticulates inthesediment.
Strontium was precipitated as Sr(NO,), using fuming (90%)nitric acid.Milk Stable strontium carrier was added to one liter of sample.The sample is then evaporated and ashed in a muffle furnace.The ash is dissolved and strontium precipitated as a phosphate.
Inaddition, formalinwasaddedtothesanitarypondsedimentpriortoshipping, toinhibitgasformation withinthesamplecontainer.
The sample is then redissolved and strontium precipitated as Sr(NO,), using fuming (90%)nitric acid.Soil and Sediment The sample is first dried under heat lamps and a 10-gram aliquot is taken.Stable strontium carrier is added and the sample is leached in hydrochloric acid.After the mixture is filtered, phosphates are then precipitated, collected by filtration, and dissolved.in nitric acid.Strontium is precipitated as Sr(NO,), using fuming (90%)nitric acid.A barium chromate scavenge and an iron (ferric hydroxide) scavenge are then performed.
A2-kilogram sampleofdriedcoolingtowersedimentwascollected fromthesedimentdisposalell(Station119)withinthirtydaysofthecompletion ofcleaningthecoolingtowers.In1997thecoolingtowerswerecleanedonce,hence,onlyonesamplewascollected forgammaspectrometry analysis.
Stable yttrium carrier is added and the sample is allowed to stand for five days or more for yttrium ingrowth.Yttrium is then precipitated as hydroxide, dissolved and reprecipitated as oxalate.The yttrium oxalate is mounted on a nylon planchet and counted in a low-level beta counter to infer strontium-90 activity.Strontium-89 activity is determined by precipitating SrCO, from the sample after yttrium separation.
4.3.6HshTheannualfishsamplingwasperformed inlateSeptember andearlyOctober.Fishsamplescollected fromtheColumbiaRiver(Station30inFigure4-1)wereindicator samples,whereasthefishcollected ontheSnakeRiver(Stations 38and38AinFigure4-2),werecontrolsamples.Threeseparatefishsamples,consisting ofananadromous speciesandtwootherspeciesgenerally considered edibleorpotentially edible(suchascarp,catfishandwhitefish) werecollected ateachlocation.
This precipitate is mounted on a nylon planchet and covered with an 80 mg/cm'luminum
Allthefishwerecollected usingelectro-shocking exceptthesamplesoftheanadromous specieswhichwerecollected fromtheRingoldhatcheryontheColumbiaRiverandattheLyonsFerryFishHatcheryontheSnakeRiver.Thefishwerefilletedtoobtainapproximately onekilogramofediblefleshpersample.Thefilletswereplacedincleanplasticbagsandfrozenuntilshipmenttotheanalytical contractor.
.absorber for low-level beta counting.4.4.7 Iodine-131 in Milk Two liters of sample are first equilibrated with stable iodide carrier.A batch treatment with anion exchange resin is used to remove iodine from the sample.The iodine is then stripped from the resin with sodium hypochlorite solution, reduced with hydroxylamine hydrochloride, and extracted into carbon tetrachloride as free iodine.It was then back-extracted as iodide into sodium bisulfite solution and precipitated as palladium iodide.The precipitate was weighed for l997 REMP ANN VAL REPORT 4-8 chemical yield and mounted on a nylon planchet for low-level beta counting.The chemical yield is corrected by measuring the stable iodide content of the milk with a specific ion electrode.
Fisharesampledannuallyunlesselevatedradiation levelsrelatedtoplantoperations areobserved, inwhichcasesamplingisconducted semiannually.
4.5 Data Analysis Methods Since mid-1984, the results of the REMP analyses have been presented as net results calculated from the gross or total counts determined for each radionuclide minus the background counts of the counting or detection instrument.
4.3.7MilkMilksampleswerecollected monthlyJanuarythroughMarchandOctoberthroughDecemberandsemimonthly duringthespringandsummermonthswhenthecowswerelikelytobegrazingoronfreshfeed.Enoughrawmilkwascollected fromeachsamplinglocationtoobtainaonegallonsampleafterthecreamhadbeenskimmedoff.Thesampleswererefrigerated overnight andthecreamskimmedoffthenextmorning.,
Consequently, for several sample types, the results range from negative to positive numbers.This manner of presenting environmental data prevents the bias and loss of individual results inherent in the use of"less than" (()values, where the"less than"'numbers can have a variety of meanings, such as."ass than the lower limit of detection (LLD)." A listing of the LLDs determined for each analysis is provided in Table 4-4 as a reference when reviewing the sample results.Plots of the sample results versus time are used to represent the results for analyses such as gross beta on air particulate filters, where the results are normally above the lower.limits of detection.
Themilksampleswerechilled.and shippedtotheanalytical contractor withinadayofcollection.
In such cases, the indicator station results are plotted with the control station results for easy comparison.
4-51997REMPANNUALREPORT thetionRoutinesampleswerecollected fromtwoindicator locations (Stations 36and64)acrossColumbiaRiverinFranklinCounty.Milksampleswerealsocollected atoneindicator sta(Station9B)andonecontrollocation(Station96)intheSunnyside/Grandview area(inFigure4-3).Station9BinSunnyside servesasan'indicator stationbecauseaportionofthefeedforthecowsatthatlocationishayfromFraiiklin CountynorthofPasco.Thatfactormakesitunsuitable foruseasacontrollocation.
Other data analysis techniques, such as frequency dist'ributions, are also used to represent the data and to determine whether trends that could be attributed to Plant 2 operations are evident.Thermoluminescent dosimeter (TLD)data is presented in terms of the net mR/day exposure rate.These results are determined from the total exposure (in mR)calculated for each TLD from its total thermoluminescent output minus the TLD background, minus any transit (or trip)exposure received during distribution and retrieval, and divided by the number of days the TLD was in the field.Frequency distributions and graphs of TLD data by meteorological sector and distance from the plant are used to interpret trends in the results.TLD data summaries include the term"standard error." The standard error, which is the estimate of the precision of the mean, is used for the means of quarterly and annual data and is an indicator of the uncertainty associated with the results.The mean results of the quarterly TLDs are compared with the results of annual TLDs and expressed as a ratio by dividing the quarterly results by the annual result.4-9 1997 REMP ANNUAL REPORT TABLE 4-1 P RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM PLAN SAMPLE TYPE" 1.'IRBORNE SAMPLE STATION+'UMBER SAMPLING AND COLLECTION FREQUENCY"'YPE AND FREQUENCY OF ANALYSIS Particulates and radioiodine 1, 4-8, 9A, 21, 23, 40, 48, and 57 Continuous sampling;weekly collection (6/12)'+Paiticulate:
4.3.8GardenProduceSamplesoflocalgardenproducewerecollected monthlyfromApriltoSeptember whentheproducewas.readily, available.
Weekly gross beta'>;gamma isotopic@of quarterly composite (by location)Iodine: Weekly gamma analysis.Soil+'(0/7) 2.DIRECT RADIATION 9A, 1,7, 21 and 23, 101, 11.8 Annually Quarterly or more often as needed.Gamma isotopicto; strontium-90"'amma isotopic TLD@(34/6 1)PIC 3.WATERBORNE 1-8, 9A, 10-25, 4047, 49-51, 53-.56, 71-86 (1S-16S)9, 119B, 119-Control, 120-East Various locations, as needed"'uarterly, annually Continuous recording, as needed Thermoluminescent output;quarterly and annual processing.
Whenpossible,.three.
Exposure rate accumulated on mag card and in internal memory River/Drinking Water+(3/4)26, 27, 28 and 29 Composite aliquots';
typesof.producesamples(arootcrop,fruit,andaleafyvegetable) werecollected ateachlocation.
monthly collection Gamma isotopic<a, gross beta, quarterly; tritium composite; strontium-90", 1-131'~Storm Drain Water (1/1)Sanitary Waste Treatment Facility Water (1/1)Ground Water (2/3)'~'iver Sediment (I/2)'<'anitary Waste Treatment Facility Sediment (1/I)101 102 31, 32,.and 52 33 and 34 102 Composite aliquots', weekly collection; grab samples Monthly, annually, pre-discharge and as needed.Quarterly Semiannually Monthly or more often as needed Gamma isotopic+, tritium, gross beta Gamma isotopic+, gross beta, gross alpha, tritium Gamma isotopic+;
Theindicator sampleswerecollected fromaregioninapredominant downwinddirection (Station37inFigure4-2)wherecropsareirrigated withColumbiaRiverwater.ThecontrolsampleswereobtainedfromproducestandsintheSunnyside area(Station9CinFigure4-3),thedirection leastlikelytobeaffectedbyplanteffluents.
tritium Gamma isotopic+Gamma Isotopic+
Appleswerecollected inSeptember fromStation91,theRioVistaFarmsorchard,whichisirrigated withColumbiaRiverwater.t4.3.9Vegetation Theannualsampleofvegetation growinginthestormdrainpondwascollected inJune.Cattailsandgrassesweretheprincipal typesofvegetation collected.
TABLE 4-1 (Cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM PLAN SAMPLE TYPE" Cooling Tower Sediment Disposal Area (0/1)4.INGESTION 119 SAMPLE STATION+NUMBER SAMPLING AND COLLECTION FREQUENCY'i Within 30 days following Cooling Tower cleaning event TYPE AND FREQUENCY OF ANALYSIS Gamma Isotopic'" Milk'4/4)9B, 36, 64 and 96" Semi-monthly during grazing season, monthly at other times Gamma isotopic+;
Approximately twokilograms ofsamplewerecollected eachtime.Carewastakentoavoidincluding therootsorsoilfromaroundtherootsinthesamples.4.4Analytical Procedures Theanalytical procedures usedforthe1997REIVIPsamplesaredescribed below.TeledyneBrownEngineering Environmental Servicesperformed allroutineanalysesofREMPsamplesduring1997.4.4.1GrossBetaActivity.
iodine-131; strontium-90"'ish'i (2/2)30, 38 AnnuaHy'" Gamma isotopicto Garden Produce'(1/3)
onParticulate FiltersTheparticulate filterswerecountedinagasflow-proportional counterafteradelayoffiveormoredaystoallowfortheradon-222 andradon-220 (thoron)daughterproductstodecay.Anunusedairparticulate filterwascountedastheblankwitheachweeklysetoffilters.4.4.2Measurement ofGammaEmittersAshieldedGe(Li)detectorsystemwascoupledtoacomputer-based dataacquisition systemwhichperformed pulseheightandgammaenergyanalysis.
~9C, 91co and 37 Monthly during growing season in the Riverview area of Pasco and a control near Grandview; annual collection at Station 91.Gamma isotopic@Vegetation (1/1)101 annually Gamma isotopic@(a)The fraction in parentheses for each sample type indicates the ratio of ODCM-required sample locations to the total number of sample locations currently being monitored in the surveillance program.The SCA also requires certain numbers of sampling stations for each type of media.(b)The underlined sample location designates a control station.(c)Deviations are permitted if samples are unobtainable due fo hazardous conditions, seasonal availability, malfunction of automatic sampling equipment, or other legitimate reasons.Such deviations are documented in Section 5 (d)(e)The SCA requires nine or more air sampling stations.Particulate sample filters will be analyzed for gross beta aAer at least 24 to 48 hours to allow for the decay of radon daughter products.If gross beta activity is greater than 10 times the mean of the result for the control, Station 9A, gamma isotopic analysis shall be performed on the individual sample.(f)Gamma isotopic means identification and quantification of gamma-emitting radionuclides that may be attributable to the eNuents of Plant 2.
Theinformation collected abouteachpeakwascomparedtoalibraryofknownpeaks.Isotopicidentification wasperformed aswastheradioactivity calculation whichusedtheappropriate fractional gammarayabundance, half-life, detectorefficiency, andnetcountsinthepeakregion.1997REMPANNVALREPORT4-6 MilkandWaterA1-literMarinelli beakerwasfilledwitharepresentative aliquotofthesample.Thesamplewasthencountedforatleast1000minutes(16.7hours).Foodstuff AsmuchoftheedibleportionofthesampleaspossiblewasloadedintoataredMarinelli beakerandweighed.Thesamplewasthencountedforatleast1000minutes(16.7hours).~VeetationAsmuchsample..as
TABLE 4-1 (Cont.)Soil samples are collected to satisfy the requirements of the Site Certification Agreement (SCA)"'or Plant 2.The SCA requires that soil samples be collected at five air sampling locations.
.possible isplacedina1-literMarinelli beakerandcountedforapproximately 1000minutes(16.7hours).Thesampleisnotdriedpriortocounting, sotheresultsaregivenintermsofwetweight.SoilsandSediments Alargequantityofthesamplewasdriedatatemperature below100'C.Asmuchsampleaspossiblewasloadedintoatared1-literMarinelli beakerandweighed.Thesamplewasthencountedforatleast360minutes(6hours).CharcoalCartridesAirIodineCharcoalfilterswerecounteduptofiveatatime,withonepositioned onthefaceanduptofouronthesideofthecalibrated Ge(Li)detector.
Strontium-90 analysis shall be performed on any indicator soil sample having cesium results greater than ten times the results for the control location.TLD refers to thermoluminescent dosimeter.
Thedetection limitforacharcoalcartridge wasuniquelydetermined foreachfilterandbyusingitsposition.
For purposes of the REMP, a TLD is a phosphor card (31.75mm x 44.75mm x 0.4mm)with eight individual read-out areas (four main dosimeter.
Intheeventthatiodine-131 wouldhavebeenobservedintheinitialcountingofaset,eachcharcoalcartridge inthesetwasthenpositioned separately onthefaceofthedetectorandcounted.AirParticulate FiltersFourairparticulate filtersforaquarterly composite fromeachfieldstationwerealignedoneinfrontofanotherandcountedforatleast360minutes(6hours).4.4.3GrossBetaActivityinWaterAo'e-liter aliquotofeachsamplewasevaporated toasmallvolumeandtransferred toastainless steelplanchet.
areas and four back-up dosimeter areas)in each badge case.TLDs used in the REMP meet the requirements of Reg Guide 4.13+and ANSI N545-1975, except for specified energy-dependence response.Correlation factors are available for energy ranges with response outside of specified tolerances.
Thesamplewasdriedunderheatlamps,cooled,thencountedonanautomatic betaproportional counter.Theresultswerecalculated usingempirical self-absorption curveswhichenabledthecorrection ofeffective countingefficiency basedonthesampleresiduemass.4.4.4Iodine-131 inWaterTwolitersofsamplewerefirstequilibrated withastableiodidecarrier.Abatchtreatment withanionexchangeresinwasusedtoremoveiodinefromthesample.Theiodinewasthenstrippedfromtheresinwithsodiumhypochlorite
TLD Stations 71-86 are special interest stations and are not included among the 34 routine TLD stations required by the ODCM Table 6.3.1.1-1 (3.12-1).Their alternate designations are 1S-16S.The SCA requires that 25 or more TLD stations are located within a 10-mile radius of the plant.Pressurized ion chambers (PICs)are not required as part of the routine monitoring program, but they are required by the SCA to be maintained as a supplemental or backup system.PICs were used routinely at various locations during 1997 to provide supplemental information.
: solution, reducedwithhydroxylamine hydrochloride, andextracted intocarbontetrachloride asfreeiodine.Itwasthenback-extracted asiodideintoasodiumbisulfite solutionandprecipitated aspalladium iodide.Theprecipitate wasweighedforchemicalyieldandmountedonanylonplanchetforlow-level betacounting.
The term"river/drinking water," instead of"surface/drinking water," is'used throughout this report because the surface water is taken from the Columbia River.Station 26, Plant 2 makeup water intake from the Columbia River is both an upstream surface, or river, water sample and the drinking water control sample location.Station 28 (300 Area)and Station 29 samples are drinking water samples.The Station 27 sample, which is drawn from the plant discharge line, is taken in place of a"downstream" water sample near but beyond the mixing zone.It reflects the radioactivity present in the plant discharge prior to any river dilution.The SCA requires'two drinking water locations downstream from the plant discharge and requires sampling from the plant intake and discharge water.Station 101, the storm drain pond, and Station 102, the Sanitary Waste Treatment Facility, are represented individually because they are unique sampling locations requiring special attention.(m)(n)Composite (integrated grab)samples are collected with equipment which collects an aliquot at time intervals that are short relative to the compositing period.A When the gross beta activity in drinking water exceeds 8 pCi/liter, a strontium-90 analysis is performed.(o)When the dose calculated via ODCM methodology for consumption of water exceeds 1 mrem per year, iodine-131 analyses are performed on the drinking water samples.The SCA requires sampling from wells used for fire protection and as backup drinking water sources.The SCA requires sediment sample collection upstream and downstream of the plant discharge.
Thechemical4-71997REMPANNUALREPORT yieldwascorrected bymeasuring thestableiodidecontentofthewaterwithaspecificionelectrode.
Milk samples will be obtained from farms or individual milk animals which are located in the most prevalent wind directions from Plant 2.Routine milk samples are collected in areas of high dose potential instead of within 5 kilometers, due to the locations of milk animals.The SCA requires at least three milk locations within the 10-mile radius of the plant and one in a control location.(s)Station 96 is the control station for milk samples because it was determined that the cows at Station 9B in Sunnyside were given feed grown in the Franklin County area across the Columbia River from Plant 2.
During1997,thisprocedure wasusedonlyonintercomparison samples,sincethedosescalculated viaODCMmethodology fortheconsumption ofdrinkingwaterdidnotexceedonemilliremperyear.4.4.5TritiuminWaterTheanalysisoftritiuminwaterwasperformed utilizing liquidscintillation.
TABLE 4-1 (Cont.)(t)If cesium-134 or cesium-137 is measured in an individual milk sample in excess of 30 pCi/1, then the strontium-90 analysis will be performed.(u)There are no commercially important species in the Hanford Reach of the Columbia River.Most recreationally important species in the area are anadromous (primarily salmonids), which ascend rivers from the sea for breeding.Four fish species will normally be collected by the electroshock technique in the vicinity of the plant discharge (Station 30)and from the Snake River (Station 38).If electro-shocking produces insufficient anadromous fish samples from the Snake River, samples may be obtained from the fish trap at Ice Harbor Dam, Lyons Ferry Fish Hatchery, or other similar facility.If insufficient anadromous fish samples are produced through electro-shocking on the Columbia River, samples may be obtained at the Ringold Fish Hatchery.(v)If an impact is indicated, sampling will be conducted semiannually.(w)Garden produce will routinely be obtained from farms or gardens.using Columbia River water for irrigation.
Liquidscintillation requires10milliliters of.watermixedwith10milliliters ofliquidscintillation "cocktail."
One sample of a root crop, leafy vegetable, and a fruit is collected each sample period, if available.
Themixtureisthencountedinanautomatic liquidscintillation detector.
The variety of the produce obtained will be dependent on seasonal availability.(x)Station 91 is an apple orchard irrigated with Columbia River water.The apple crop from Station 91 is sampled annually.
4.4.6Strontium-89 and90inWater,MilkandSoilDuring1997,strontium analyseswerenotrequiredforanyroutineREMPwater,milkorsoilsamples.Itwasusedforintercomparison waterandsedimentanalyses.
TABLE 4-2 REMP SAMPLE LOCATIONS BY SECTOR SECTOR" N (1)STATION+~NUMBER 52 71(1S)47 57 18 53 0.1 0.3 0.5 0.8 1.1 7.5 161 483 805 1201 1770 12068 GW TLD TLD AP/AI TLD TLD ESTIMATED DISTANCE('i MILES METERS SAMPLE TYPE(+NNE (2)NE (3)ENE (4)E (5)ESE (6)72(2S)2 54 73(3S)19 48 39 46 101 74(4S)21 20 11 33 45 44 75(SS)22 10 26 27(')30 43 76(6S)31 32 51 23 34 91 8 42 36(e)5 64 38 0.4 1.8 6.5 0.5 1.8 4.5 4.4 5.0 0.3 0.4 1.5 1.9 3.1 3.6 4.3 5.8 0.4 2.1 3.1 3.2 3.2 3.3 5.8 0.4 1.1 1.2 2.1 3.0 3.5 4,4 4.5 5.6 7.2 7.7 9.7'6.5 644 2896 10459 805 2896 7241 7084 8045 483 644 2414 3057 4988 5792 6919 9332 3379 4988 5149 5149 5311 9332 644 1770 1931 3379 4827 5632 7079 7241 9010 11585 12389 15610 42639 TLD TLD TLD TLD TLD AP/AI FI TLD SDW/SE/SO/VE TLD AP/AI/SO/TLD TLD TLD SE TLD TLD TLD TLD TLD PW DW FI TLD TLD GW GW TLD AP/AI/SO/TLD SE FR AP/AI/TLD TLD MI AP/AI/TLD MI FI 1997 REMP ANNUAL REPORT 4-14 TABLE 4-2 (Cont.)REMP SAMPLE LOCATIONS BY SECTOR SECTOR(')SE (7)STATION+)NUMBER 118 77(7S)24 3 41 40 0.3 0.5 1.9 2.0 5.8 6.4 483'05 3057 3218 9332 10298 ESTIMATED DISTANCE" MILES METERS SAMPLE TYPE(4'O TLD.TLD TLD AP/AI/TLD S (9)SSW (10)SW (11)WSW (12)W (13)WNW (14)NW (15)NIAV (16)102 119-Control 120 78(8S)25 55 28 4 29 37 119 119B 79(9S)1 65 6 80(10S)50 56 81(11S)13 96 82(12S)14 9A, 9B, 9C 83(13S)15 84(14S)16 7 85(15S)49 86(16S)17.12 0.4 0.2 0.3 0.7 1.6 6.2 7.4 9.3 11.0 16.0 0.2 0.2 0.7 1.3 7.3 7.7 0.8 1.2 7.0 0.7 1.4 36.0 0.5 1.4 30.0 0.5 1.4 0.5 1.4 2.7 0.5 1.2 0.4 1.2 3.1 644 335 483 1126 2574 9976 11907 14964 17699 25744 366 381 1126 2092 11748 12389 1287 1931 11263 1126 2253 49250 805 2253 48270 805 2253 805 2253 4344 805 1931 644 1931 4988 SWW/SE TLD SO/TLD TLD'LD TLD PW AI/AP/TLD PW GP SO TLD TLD AP/AI/SO/TLD TLD AP/AI/TLD TLD TLD TLD TLD TLD MI TLD TLD AP/AI/MI/GP/TLD/SO TLD TLD TLD TLD AP/AI/SO/TLD TLD TLD TLD TLD'LD 4-15 1997 REMP ANNUAL REPORT (a)TABLE 4-2 (Cont.)The area in the v'icinity of Plant 2 is separated into 16 separate sectors for reporting purposes.The 16 sectors cover 360 degrees in equal 22.5 degree sections, beginning with Sector 1 (N)at 348.75 to 11.25 degrees and continuing clockwise through Sector 16 (NNW).(b)The alternate designations for TLD Stations 71-86 are given in parentheses, i.e., 1S-16S.(c)Distances are estimated from map positions for each location as a radial distance from Plant 2 containment.(d)Sample Type Key:.AI-'Air Iodine DW-Discharge Water FR-Fruit GW-Ground Water PW-Surface (River)/Drinking SE-Sediment SWW-Sanitary Waste Water VE-Vegetation AP-Air Particulate
Thetechniques usedtoanalyzeforstrontium inthevariousmediaaredescribed below.WaterStablestrontium carrierwasaddedtooneliterofsampleandthevolumeisreducedbyevaporation.
.Fl-Fish GP-Garden Produce MI-Milk Water SDW-Storm Drain Water SO-Soil TLD-'11iermoluminescent Dosimeter Station 9 designates the Sunnyside-Grandview control area.It is actually three separate stations (Stations 9A for TLD, Al/AP and SO, 9B for milk, and 9C for GP)within a few miles of each other and all within 30-35 miles of Plant 2.Station 96, which is the control station for milk, is also located within the control area.It is 36 miles from Plant 2.Station 9B, which was the control location for milk until 1986, is now an indicator milk location.(e)Duplicate samples, i.e., samples drawn at the same time as the routine samples and submitted for analysis as a quality assurance check, are collected at this location.The station designation for the duplicate of Station 27 is Station 72 for second and fourth quarters and 92 for the first quarter.The station designation for the duplicate of Station 36 is Station 37.1997 REMP ANNUAL REPORT 4-16 TABLE 4-3 19 7 FIVE MlLE LAND USE CENSUS RESULTS SECTOR('i NEAREST RESIDENTS'>
Strontium wasprecipitated asSr(NO,),usingfuming(90%)nitricacid.MilkStablestrontium carrierwasaddedtooneliterofsample.Thesampleisthenevaporated andashedinamufflefurnace.Theashisdissolved andstrontium precipitated asaphosphate.
GARDEN ()50M')DAIRY<'>ANIMALS LIVESTOCK 4.3 4.1 4.5 4.2 none 4.1<<none 4 3(4 none none none none 4.8 none none 4.6 SE none none none none (a)Eleven of the sixteen meteorological sectors within the five-mile radius of Plant 2 are on the federally-owned Hanford Site;the remaining land is comprised of 4.5 sq.miles of privately-owned farm land.Only those sectors containing points of interest are presented here.(b)Estimated distances in miles.(c)The closest dairy animal locations are at 8.3 miles SE and 7.2 and 9.7 miles ESE.The dairy at 8.3 miles SE is not used for milk sample collection due to the owner's reluctance to participate in the sampling program.(d)Small garden with broadleaf; samples were not available due to the small amounts grown.4-17 1997 REMP ANNUAL REPORT TABLE 4-4 C MPARISON OF TELEDYNE NOMINAL LOWER LIMITS OF DETECTION WITH OFFSITE DOSE CALCULATION MANUAL RE UIREMENTS N MEDIA (UNITS)Air (pCi/mi)IVateri (pCi/I)Soil/Sediment: (pCi/kg dry)Fish: (pCi/kg wet)ltiilk: (pCin)ANALYSIS Gross Beta Ganuna Spectrometry Cs-134 Cs-137 1-131 Gross Beta Tritium 1-131 Sr 90 Gamma Spectrometry Mn-54 Fe-59 Co-58 Co-60 Zn-65 Zr-95 Nh-95 Cs-134 Cs-137 Ba-140 La-140 Gamins Spectroinetry Co-57 Co-60 Zn-65 Cs-134 Cs-137 Sr-90 Gamma Spectrometry Mn-54 Fe-59 Co-58 Co-60 Zn-65 Cs-134 Cs-137 1-131 Gamma Spectrometry Cs-134 Cs-137 Ba-140 La-140 Sr-90 TELEDYNE LLDs 0.003 0.001.0.001 0.01 4 300 I I 10 20 10 10 20 20 10 10 10 20 10 120 30 100 30 40 10 20 30 20 20 30 20 20 0.5 10 10 20 10 I BTP REQUIRED LLDs 0.01 0.05 0.06 0.07 4 2000 15 30 15 IS 30 30 15~IS 18 60 15 150 180 130 260 130 130 260 130 150 IS 18 60 15 Garden Produce: (pCi/kg wet)Gamma Spectroinetry Cs-134 Cs-137 1-131 20 20 30 60 80 60'hese are the contract LLDs.Actual LLDs may be lower.for specific samples.+If no drinking water pathway exists, a value of 3,000 pCi/l may be used.1997 REMP ANNUAL REPORT 4-18}}
Thesampleisthenredissolved andstrontium precipitated asSr(NO,),usingfuming(90%)nitricacid.SoilandSedimentThesampleisfirstdriedunderheatlampsanda10-gramaliquotistaken.Stablestrontium carrierisaddedandthesampleisleachedinhydrochloric acid.Afterthemixtureisfiltered, phosphates arethenprecipitated, collected byfiltration, anddissolved
.innitricacid.Strontium isprecipitated asSr(NO,),usingfuming(90%)nitricacid.Abariumchromatescavengeandaniron(ferrichydroxide) scavengearethenperformed.
Stableyttriumcarrierisaddedandthesampleisallowedtostandforfivedaysormoreforyttriumingrowth.
Yttriumisthenprecipitated ashydroxide, dissolved andreprecipitated asoxalate.Theyttriumoxalateismountedonanylonplanchetandcountedinalow-level betacountertoinferstrontium-90 activity.
Strontium-89 activityisdetermined byprecipitating SrCO,fromthesampleafteryttriumseparation.
Thisprecipitate ismountedonanylonplanchetandcoveredwithan80mg/cm'luminum
.absorberforlow-level betacounting.
4.4.7Iodine-131 inMilkTwolitersofsamplearefirstequilibrated withstableiodidecarrier.Abatchtreatment withanionexchangeresinisusedtoremoveiodinefromthesample.Theiodineisthenstrippedfromtheresinwithsodiumhypochlorite
: solution, reducedwithhydroxylamine hydrochloride, andextracted intocarbontetrachloride asfreeiodine.Itwasthenback-extracted asiodideintosodiumbisulfite solutionandprecipitated aspalladium iodide.Theprecipitate wasweighedforl997REMPANNVALREPORT4-8 chemicalyieldandmountedonanylonplanchetforlow-level betacounting.
Thechemicalyieldiscorrected bymeasuring thestableiodidecontentofthemilkwithaspecificionelectrode.
4.5DataAnalysisMethodsSincemid-1984, theresultsoftheREMPanalyseshavebeenpresented asnetresultscalculated fromthegrossortotalcountsdetermined foreachradionuclide minusthebackground countsofthecountingordetection instrument.
Consequently, forseveralsampletypes,theresultsrangefromnegativetopositivenumbers.Thismannerofpresenting environmental datapreventsthebiasandlossofindividual resultsinherentintheuseof"lessthan"(()values,wherethe"lessthan"'numbers canhaveavarietyofmeanings, suchas."assthanthelowerlimitofdetection (LLD)."AlistingoftheLLDsdetermined foreachanalysisisprovidedinTable4-4asareference whenreviewing thesampleresults.Plotsofthesampleresultsversustimeareusedtorepresent theresultsforanalysessuchasgrossbetaonairparticulate filters,wheretheresultsarenormallyabovethelower.limitsofdetection.
Insuchcases,theindicator stationresultsareplottedwiththecontrolstationresultsforeasycomparison.
Otherdataanalysistechniques, suchasfrequency dist'ributions, arealsousedtorepresent thedataandtodetermine whethertrendsthatcouldbeattributed toPlant2operations areevident.Thermoluminescent dosimeter (TLD)dataispresented intermsofthenetmR/dayexposurerate.Theseresultsaredetermined fromthetotalexposure(inmR)calculated foreachTLDfromitstotalthermoluminescent outputminustheTLDbackground, minusanytransit(ortrip)exposurereceivedduringdistribution andretrieval, anddividedbythenumberofdaystheTLDwasinthefield.Frequency distributions andgraphsofTLDdatabymeteorological sectoranddistancefromtheplantareusedtointerpret trendsintheresults.TLDdatasummaries includetheterm"standard error."Thestandarderror,whichistheestimateoftheprecision ofthemean,isusedforthemeansofquarterly andannualdataandisanindicator oftheuncertainty associated withtheresults.Themeanresultsofthequarterly TLDsarecomparedwiththeresultsofannualTLDsandexpressed asaratiobydividingthequarterly resultsbytheannualresult.4-91997REMPANNUALREPORT TABLE4-1PRADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMPLANSAMPLETYPE"1.'IRBORNE SAMPLESTATION+'UMBERSAMPLINGANDCOLLECTION FREQUENCY"'YPE ANDFREQUENCY OFANALYSISParticulates andradioiodine 1,4-8,9A,21,23,40,48,and57Continuous sampling; weeklycollection (6/12)'+Paiticulate:
Weeklygrossbeta'>;gammaisotopic@
ofquarterly composite (bylocation)
Iodine:Weeklygammaanalysis.
Soil+'(0/7) 2.DIRECTRADIATION 9A,1,7,21and23,101,11.8AnnuallyQuarterly ormoreoftenasneeded.Gammaisotopicto; strontium-90"'amma isotopicTLD@(34/6 1)PIC3.WATERBORNE 1-8,9A,10-25,4047,49-51,53-.56,71-86(1S-16S)9, 119B,119-Control, 120-EastVariouslocations, asneeded"'uarterly, annuallyContinuous recording, asneededThermoluminescent output;quarterly andannualprocessing.
Exposurerateaccumulated onmagcardandininternalmemoryRiver/Drinking Water+(3/4)26,27,28and29Composite aliquots';
monthlycollection Gammaisotopic<a, grossbeta,quarterly; tritiumcomposite; strontium-90",
1-131'~StormDrainWater(1/1)SanitaryWasteTreatment FacilityWater(1/1)GroundWater(2/3)'~'iver Sediment(I/2)'<'anitary WasteTreatment FacilitySediment(1/I)10110231,32,.and5233and34102Composite aliquots',
weeklycollection; grabsamplesMonthly,annually, pre-discharge andasneeded.Quarterly Semiannually MonthlyormoreoftenasneededGammaisotopic+,
tritium,grossbetaGammaisotopic+,
grossbeta,grossalpha,tritiumGammaisotopic+;
tritiumGammaisotopic+
GammaIsotopic+
TABLE4-1(Cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAMPLANSAMPLETYPE"CoolingTowerSedimentDisposalArea(0/1)4.INGESTION 119SAMPLESTATION+NUMBERSAMPLINGANDCOLLECTION FREQUENCY'i Within30daysfollowing CoolingTowercleaningeventTYPEANDFREQUENCY OFANALYSISGammaIsotopic'"
Milk'4/4)9B,36,64and96"Semi-monthly duringgrazingseason,monthlyatothertimesGammaisotopic+;
iodine-131; strontium-90"'ish'i (2/2)30,38AnnuaHy'"Gammaisotopicto GardenProduce'(1/3)
~9C,91coand37MonthlyduringgrowingseasonintheRiverview areaofPascoandacontrolnearGrandview; annualcollection atStation91.Gammaisotopic@
Vegetation (1/1)101annuallyGammaisotopic@
(a)Thefractioninparentheses foreachsampletypeindicates theratioofODCM-required samplelocations tothetotalnumberofsamplelocations currently beingmonitored inthesurveillance program.TheSCAalsorequirescertainnumbersofsamplingstationsforeachtypeofmedia.(b)Theunderlined samplelocationdesignates acontrolstation.(c)Deviations arepermitted ifsamplesareunobtainable duefohazardous conditions, seasonalavailability, malfunction ofautomatic samplingequipment, orotherlegitimate reasons.Suchdeviations aredocumented inSection5(d)(e)TheSCArequiresnineormoreairsamplingstations.
Particulate samplefilterswillbeanalyzedforgrossbetaaAeratleast24to48hourstoallowforthedecayofradondaughterproducts.
Ifgrossbetaactivityisgreaterthan10timesthemeanoftheresultforthecontrol,Station9A,gammaisotopicanalysisshallbeperformed ontheindividual sample.(f)Gammaisotopicmeansidentification andquantification ofgamma-emitting radionuclides thatmaybeattributable totheeNuentsofPlant2.
TABLE4-1(Cont.)Soilsamplesarecollected tosatisfytherequirements oftheSiteCertification Agreement (SCA)"'or Plant2.TheSCArequiresthatsoilsamplesbecollected atfiveairsamplinglocations.
Strontium-90 analysisshallbeperformed onanyindicator soilsamplehavingcesiumresultsgreaterthantentimestheresultsforthecontrollocation.
TLDreferstothermoluminescent dosimeter.
ForpurposesoftheREMP,aTLDisaphosphorcard(31.75mmx44.75mmx0.4mm)witheightindividual read-outareas(fourmaindosimeter.
areasandfourback-updosimeter areas)ineachbadgecase.TLDsusedintheREMPmeettherequirements ofRegGuide4.13+andANSIN545-1975, exceptforspecified energy-dependence response.
Correlation factorsareavailable forenergyrangeswithresponseoutsideofspecified tolerances.
TLDStations71-86arespecialintereststationsandarenotincludedamongthe34routineTLDstationsrequiredbytheODCMTable6.3.1.1-1 (3.12-1).
Theiralternate designations are1S-16S.TheSCArequiresthat25ormoreTLDstationsarelocatedwithina10-mileradiusoftheplant.Pressurized ionchambers(PICs)arenotrequiredaspartoftheroutinemonitoring program,buttheyarerequiredbytheSCAtobemaintained asasupplemental orbackupsystem.PICswereusedroutinely atvariouslocations during1997toprovidesupplemental information.
Theterm"river/drinking water,"insteadof"surface/drinking water,"is'usedthroughout thisreportbecausethesurfacewateristakenfromtheColumbiaRiver.Station26,Plant2makeupwaterintakefromtheColumbiaRiverisbothanupstreamsurface,orriver,watersampleandthedrinkingwatercontrolsamplelocation.
Station28(300Area)andStation29samplesaredrinkingwatersamples.TheStation27sample,whichisdrawnfromtheplantdischarge line,istakeninplaceofa"downstream" watersamplenearbutbeyondthemixingzone.Itreflectstheradioactivity presentintheplantdischarge priortoanyriverdilution.
TheSCArequires'two drinkingwaterlocations downstream fromtheplantdischarge andrequiressamplingfromtheplantintakeanddischarge water.Station101,thestormdrainpond,andStation102,theSanitaryWasteTreatment
: Facility, arerepresented individually becausetheyareuniquesamplinglocations requiring specialattention.
(m)(n)Composite (integrated grab)samplesarecollected withequipment whichcollectsanaliquotattimeintervals thatareshortrelativetothecompositing period.AWhenthegrossbetaactivityindrinkingwaterexceeds8pCi/liter, astrontium-90 analysisisperformed.
(o)Whenthedosecalculated viaODCMmethodology forconsumption ofwaterexceeds1mremperyear,iodine-131 analysesareperformed onthedrinkingwatersamples.TheSCArequiressamplingfromwellsusedforfireprotection andasbackupdrinkingwatersources.TheSCArequiressedimentsamplecollection upstreamanddownstream oftheplantdischarge.
Milksampleswillbeobtainedfromfarmsorindividual milkanimalswhicharelocatedinthemostprevalent winddirections fromPlant2.Routinemilksamplesarecollected inareasofhighdosepotential insteadofwithin5kilometers, duetothelocations ofmilkanimals.TheSCArequiresatleastthreemilklocations withinthe10-mileradiusoftheplantandoneinacontrollocation.
(s)Station96isthecontrolstationformilksamplesbecauseitwasdetermined thatthecowsatStation9BinSunnyside weregivenfeedgrownintheFranklinCountyareaacrosstheColumbiaRiverfromPlant2.
TABLE4-1(Cont.)(t)Ifcesium-134 orcesium-137 ismeasuredinanindividual milksampleinexcessof30pCi/1,thenthestrontium-90 analysiswillbeperformed.
(u)Therearenocommercially important speciesintheHanfordReachoftheColumbiaRiver.Mostrecreationally important speciesintheareaareanadromous (primarily salmonids),
whichascendriversfromtheseaforbreeding.
Fourfishspecieswillnormallybecollected bytheelectroshock technique inthevicinityoftheplantdischarge (Station30)andfromtheSnakeRiver(Station38).Ifelectro-shocking producesinsufficient anadromous fishsamplesfromtheSnakeRiver,samplesmaybeobtainedfromthefishtrapatIceHarborDam,LyonsFerryFishHatchery, orothersimilarfacility.
Ifinsufficient anadromous fishsamplesareproducedthroughelectro-shocking ontheColumbiaRiver,samplesmaybeobtainedattheRingoldFishHatchery.
(v)Ifanimpactisindicated, samplingwillbeconducted semiannually.
(w)Gardenproducewillroutinely beobtainedfromfarmsorgardens.usingColumbiaRiverwaterforirrigation.
Onesampleofarootcrop,leafyvegetable, andafruitiscollected eachsampleperiod,ifavailable.
Thevarietyoftheproduceobtainedwillbedependent onseasonalavailability.
(x)Station91isanappleorchardirrigated withColumbiaRiverwater.TheapplecropfromStation91issampledannually.
TABLE4-2REMPSAMPLELOCATIONS BYSECTORSECTOR"N(1)STATION+~
NUMBER5271(1S)475718530.10.30.50.81.17.51614838051201177012068GWTLDTLDAP/AITLDTLDESTIMATED DISTANCE('i MILESMETERSSAMPLETYPE(+NNE(2)NE(3)ENE(4)E(5)ESE(6)72(2S)25473(3S)1948394610174(4S)21201133454475(SS)22102627(')304376(6S)31325123349184236(e)564380.41.86.50.51.84.54.45.00.30.41.51.93.13.64.35.80.42.13.13.23.23.35.80.41.11.22.13.03.54,44.55.67.27.79.7'6.564428961045980528967241708480454836442414305749885792691993323379498851495149531193326441770193133794827563270797241901011585123891561042639TLDTLDTLDTLDTLDAP/AIFITLDSDW/SE/SO/VE TLDAP/AI/SO/TLD TLDTLDSETLDTLDTLDTLDTLDPWDWFITLDTLDGWGWTLDAP/AI/SO/TLD SEFRAP/AI/TLD TLDMIAP/AI/TLD MIFI1997REMPANNUALREPORT4-14 TABLE4-2(Cont.)REMPSAMPLELOCATIONS BYSECTORSECTOR(')
SE(7)STATION+)
NUMBER11877(7S)24341400.30.51.92.05.86.4483'0530573218933210298ESTIMATED DISTANCE" MILESMETERSSAMPLETYPE(4'OTLD.TLDTLDAP/AI/TLD S(9)SSW(10)SW(11)WSW(12)W(13)WNW(14)NW(15)NIAV(16)102119-Control 12078(8S)25552842937119119B79(9S)165680(10S)505681(11S)139682(12S)149A,9B,9C83(13S)1584(14S)16785(15S)4986(16S)17.120.40.20.30.71.66.27.49.311.016.00.20.20.71.37.37.70.81.27.00.71.436.00.51.430.00.51.40.51.42.70.51.20.41.23.16443354831126257499761190714964176992574436638111262092117481238912871931112631126225349250805225348270805225380522534344805193164419314988SWW/SETLDSO/TLDTLD'LDTLDPWAI/AP/TLD PWGPSOTLDTLDAP/AI/SO/TLD TLDAP/AI/TLD TLDTLDTLDTLDTLDMITLDTLDAP/AI/MI/GP/TLD/SO TLDTLDTLDTLDAP/AI/SO/TLD TLDTLDTLDTLD'LD4-151997REMPANNUALREPORT (a)TABLE4-2(Cont.)Theareainthev'icinity ofPlant2isseparated into16separatesectorsforreporting purposes.
The16sectorscover360degreesinequal22.5degreesections, beginning withSector1(N)at348.75to11.25degreesandcontinuing clockwise throughSector16(NNW).(b)Thealternate designations forTLDStations71-86aregiveninparentheses, i.e.,1S-16S.(c)Distances areestimated frommappositions foreachlocationasaradialdistancefromPlant2containment.
(d)SampleTypeKey:.AI-'AirIodineDW-Discharge WaterFR-FruitGW-GroundWaterPW-Surface(River)/Drinking SE-SedimentSWW-SanitaryWasteWaterVE-Vegetation AP-AirParticulate
.Fl-FishGP-GardenProduceMI-MilkWaterSDW-StormDrainWaterSO-SoilTLD-'11iermoluminescent Dosimeter Station9designates theSunnyside-Grandview controlarea.Itisactuallythreeseparatestations(Stations 9AforTLD,Al/APandSO,9Bformilk,and9CforGP)withinafewmilesofeachotherandallwithin30-35milesofPlant2.Station96,whichisthecontrolstationformilk,isalsolocatedwithinthecontrolarea.Itis36milesfromPlant2.Station9B,whichwasthecontrollocationformilkuntil1986,isnowanindicator milklocation.
(e)Duplicate samples,i.e.,samplesdrawnatthesametimeastheroutinesamplesandsubmitted foranalysisasaqualityassurance check,arecollected atthislocation.
Thestationdesignation fortheduplicate ofStation27isStation72forsecondandfourthquartersand92forthefirstquarter.Thestationdesignation fortheduplicate ofStation36isStation37.1997REMPANNUALREPORT4-16 TABLE4-3197FIVEMlLELANDUSECENSUSRESULTSSECTOR('i NEARESTRESIDENTS'>
GARDEN()50M')DAIRY<'>ANIMALSLIVESTOCK 4.34.14.54.2none4.1<<none43(4nonenonenonenone4.8nonenone4.6SEnonenonenonenone(a)Elevenofthesixteenmeteorological sectorswithinthefive-mile radiusofPlant2areonthefederally-owned HanfordSite;theremaining landiscomprised of4.5sq.milesofprivately-owned farmland.Onlythosesectorscontaining pointsofinterestarepresented here.(b)Estimated distances inmiles.(c)Theclosestdairyanimallocations areat8.3milesSEand7.2and9.7milesESE.Thedairyat8.3milesSEisnotusedformilksamplecollection duetotheowner'sreluctance toparticipate inthesamplingprogram.(d)Smallgardenwithbroadleaf; sampleswerenotavailable duetothesmallamountsgrown.4-171997REMPANNUALREPORT TABLE4-4CMPARISONOFTELEDYNENOMINALLOWERLIMITSOFDETECTION WITHOFFSITEDOSECALCULATION MANUALREUIREMENTS NMEDIA(UNITS)Air(pCi/mi)IVateri(pCi/I)Soil/Sediment:
(pCi/kgdry)Fish:(pCi/kgwet)ltiilk:(pCin)ANALYSISGrossBetaGanunaSpectrometry Cs-134Cs-1371-131GrossBetaTritium1-131Sr90GammaSpectrometry Mn-54Fe-59Co-58Co-60Zn-65Zr-95Nh-95Cs-134Cs-137Ba-140La-140GaminsSpectroinetry Co-57Co-60Zn-65Cs-134Cs-137Sr-90GammaSpectrometry Mn-54Fe-59Co-58Co-60Zn-65Cs-134Cs-1371-131GammaSpectrometry Cs-134Cs-137Ba-140La-140Sr-90TELEDYNELLDs0.0030.001.0.0010.014300II102010102020101010201012030100304010203020203020200.510102010IBTPREQUIREDLLDs0.010.050.060.0742000153015IS303015~IS186015150180130260130130260130150IS186015GardenProduce:(pCi/kgwet)GammaSpectroinetry Cs-134Cs-1371-131202030608060'hesearethecontractLLDs.ActualLLDsmaybelower.forspecificsamples.+Ifnodrinkingwaterpathwayexists,avalueof3,000pCi/lmaybeused.1997REMPANNUALREPORT4-18}}

Revision as of 10:51, 6 July 2018

1998 Radiological Environ Monitoring Program for WNP-2 & 1998 Data Tables,Tables a & B. with 990512 Ltr
ML17292B665
Person / Time
Site: Columbia Energy Northwest icon.png
Issue date: 12/31/1998
From: MCDONALD J E, MENDOLA C A, SCHLEDER L S
TELEDYNE BROWN ENGINEERING CO., WASHINGTON PUBLIC POWER SUPPLY SYSTEM
To:
NRC OFFICE OF INFORMATION RESOURCES MANAGEMENT (IRM), WASHINGTON, STATE OF
References
GO2-99-094, GO2-99-94, NUDOCS 9905190200
Download: ML17292B665 (323)


Text

CATEGORY REGULATO Y INFORMATION DISTRIBUTIO SYSTEM (RIDS)ACCESSION NBR:9905190200 DOC.ATE:~l~'31 NOTARIZED:

NO FACIL:50-397 WPPSS Nuclear.Project, Unit 2, Washington Public Powe AUTH.NAME AUTHOR AFFILIATION MCDONALD,J.E.

Washington Public Power Supply System SCHLEDER,L.S., Washington Public Power Supply System MENDOLA.C.A.

Teledyne Brown Engineering Co.RECIP.NAME RECIPIENT AFFILIATION DOCKET 05000397

SUBJECT:

"1998 Radiological Envi=on Monitoring Program for WNP-2." With 9051 tr.DISTRIBUTION CODE: IE25D COPIES RECEIVED:LTR I ENCL I SIZE: IR~TITLE: Environmental Monitoring Rept (per Tech Specs)NOTES: E RECIPXENT ID CODE/NAME LPD4-2 LA CUSHING, J INTERNAL: ACRS NRR/DIPM/IOLB EXTERNAL: NRC PDR 1 1 1 1 1 1 E CENTER 0 RGN4 FILE COPIES RECIPIENT LTTR ENCL ID CODE/NAME 1 1 LPD4-2 PD 1 1 COPIES LTTR ENCL 1 1 1 1 1,1 R'D 0 E NOTE TO ALL"RIDS" RECIPIENTS:

PLEASE HELP US TO REDUCE WASTE.'TO HAVE YOUR NAME OR ORGANIZATION REMOVED FROM DISTRIBUTION LISTS OR REDUCE THE NUMBER OF COPIES RECEIVED BY YOU OR YOUR ORGANIZATION, CONTACT THE DOCUMENT CONTROL DESK (DCD)ON EXTENSION 415-2083 TOTAL NUMBER OF COPIES REQUIRED: LTTR 8 ENCL 8 WASHINGTON PUBLIC POWER SUPPLY SYSTEM P.O.Box 968~Richland, Washiwgtou 99352-0968 May 12, 1999 G02-99-094 Docket No.50-397 U.S.Nuclear Regulatory Commission Document Control Desk Washington, D.C.20555 Energy Facility Site Evaluation Council Attn: EFSEC Manager P.O.Box 43172 Olympia, WA 98504-3172

Subject:

SUPPLY SYSTEM NUCLEAR PLANT NO.2 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM ANNUAL REPORT FOR 1998

References:

1.WNP-2 (Operating License No.NPF-21), Technical Specification 5.6.2 2.EFSEC Resolution No.260, January 13, 1992 Enclosed are three (3)copies of the subject report and separate data volume which are submitted per the referenced requirements.

Respectfully, 8u D.W.Coleman (Mail Drop PE20)Manager, Regulatory Affairs Enclosures cc (report w/o data volume, except as noted): D McBaugh (WDOH)EW Merschoff (NRC RIV)LAlbin (WDOH)(w/data vol)JS Cushing (NRCNRR)RJ Julian (WDOE-Kenn)

NRC Sr Resident Inspector (927N)PD Robinson (Winston k Strawn)RL Dirkes (PNNL)DL Williams (BPA/399)V9OSi9OZOO esiiai PDR ADQCK OSOOO3'F7 R.PDR

~TO YAKNA BARRICADE ROUTE 11A r.wow<RD,J I col 51 z I 10 mi.Radius IO DI 5 al Q I 1I Ivy I3 A cE 0 O I I I I p 0 0@~12 hl Ol Wl I I J Rgf,++0~4'pp>+, VIE'i+0\I HOLUNGSWORTH RD.I I I I go a a a a a a a a a a I BASN HML RD.I I I lsaaaaaaaaa aa BELLFLOWER RD.'I HOLLtNGSWORTH I.Id I CIlHESTlay)I R 170~u.SHEFF1ELD RD.W.KLAMATH RD BASIN CITY BENTON CITY FAY 0 I COUn 224 82 12 RICHLAND LEGEND~PAVED ROAD IllPRVD RD 0 R G RVL ROAD 82>>>>~BOUNDRY UNES PASCO 880334.1 Map Nov 1997 FIGURE 4-1 REMP SAMPLING LOCATIONS WITHIN THE 10-MILE RADIUS.-~0~C Ao Ql Q)~~o"0 Am.33M Cf C: 27 fA WASHINGTON 38~Lyons~Ferry Lower Monumental am Little Goose Dam Snake River Lower Granite Dam~Pomeroy~Dayton AP'ERT'URp CALID IS0 AvaflabIe 0<~~,-r!IUre Card Clarkston~IDAHO~Walla Walla OREGON 1 inch=16 miles 16+Sample Locations\MONS OUTSIDE THE 10-MILE RADIUS 1998 REMP ANNUAL REPORT 4-19 Jan 1999 STATION 9B Q INDEPENDENCE RD SUNN YS/DE Q K 1-0 FACTORY RD STATION 9A+0 A MILK Q AIR+TLD SOIL VEGETABLE I-82 STATION 96~STATION 9C RAY RD Q O O FORSELL RD McCREADIE RD GRANDV I-82 I-82 MABIN SCALE IN MILES 0 1 2 3 4 5 6 22 PRQSSER 880138M FEB 1995 FIGURE 4-3 REMP SAMPLING LOCATIONS SUNNYSIDE/GRANDVIEW AREA THIS PAGE INTENTIONALLY BLANK ROAD FENCEIJNES SHE!NU5 RAILROAO TRACKS NOT TO SCALE FIGURE 4-4 REMP NEAR PLANT SAMPLING LOCATIONS 4-21 1998 REMP ANNUAL REPORT I I I I I I 5.0 ULT ANDDI C SI N During 1998, the analyses of REMP samples were performed by Teledyne Brown Engineering Environmental Services in Westwood, New Jersey.The thermoluminescent dosimeters were processed by Battelle Northwest in Richland, Washington.

Table 5-1 presents the means and ranges of selected 1998 results for each type of sample collected and Table 5-3 provides a summaiy of detectable results.The means and ranges of the preoperational and the previous operational data are also included in the table for comparison.

The data tables of 1998 results comprise a separate volume that is available to interested parties.The data for the prcoperational period and the first six months of 1984 included"less than" (()designations for icsults below the actual LLD, the contractual LLD, or the two-sigma erior, depending upon the convention employed by the analytical contractor.

Consequently, the data averages using"less than" values an: biased high.The use of the"less than" values was discontinued in mid-1984.Since then, REMP data have been reported as net (total results minus the detector counting background).

Since the primary focus of the REMP is to deteimine whether Plant 2 operations had an impact on the environment, the 1998 results are compared in this rcport to the icsults during the prcoperational period and the results obtained during the previous years of Plant 2 operation.

They are also compared to state and federal regulatory limits.Because of the use of"less than" values, mther than net results, during the preoperational period and during the first year of operation, and because of the impact of the 1986 Chernobyl accident on environmental radiation levels, the interpretation of the 1998 measurements relative to previous measurements must bear this in mind.Some of the parameters considered in the evaluations discussed in this icport are the means, ranges and standard deviations or standard errors of the results.Comparative plots and ficquency distributions of the data are some of the tools that have been employed in the interpretation of the 1998 REMP data.The 1998 analytical icsults for the REMP sampling locations established since the picoperational period ate very similar to the results reported for previous years.The 1998 annual and quarterly TLD zcsults were also very much like those observed previously.

No significant trends indicating an enviionmental impact or unexpected change in the environmental concentrations or exposure rates at REMP monitoring stations were observed.5-1 1998 REMP ANNUAL REPORT 5.1 Direct Radiation~Environmental radiation exposure rates at near plant and remote stations, as determined by thermoluminescent dosimeters (TLDs), remained consistent with data from previous years.032 O O.SO 5 O.20 e$0.26 Figure 5-1 presents a plot of the mean 1998 quarterly TLD results for each of the sixteen meteorological sectors at the property boundary of the plant ("S" stations).

The chart also includes the high, low and mean result in each sector for 1984 through 1997.Figure 5-1 Site Boundary Quarterly TLDs 1984-97 Hi/Low/Mean vs.1998 Mean by Sector The relationship of the mean 1998 tcsults to the results for the previous operational periods is very similar for each sector This indicates that there were no significant directional effects observed in the N NNE he ENE E ESE SE SSE S SSW SW WSW W'%NW NW NNW SECTOR o P~PERATIoNAL hlEAN 4 Isso 07 III/LowlhfEAN loss hlEAN 03$1998 TLD results.r ohio 5 0.2$020 N Nhe he ENE E ESE SE SSE S SSW SW WSW W WNW NW NNW The higher exposures in the N, NNE, and NNW sectors for the"S" stations is a result of those TLDs being physically closer to the plant than those of the other"S" station TLDs.Compatc the data presented in Figure 5-1 with that of Figure 5-2, where the near-plant TLDs an: more of an evenly placed distance from the plant.SECTOR 0 PRE.OPERATIONAL hlEAN+IOS4 0211!/LOWA!EAN I SOS hlEAN Figure 5-2 Near-Plant Quarterly TLDs-1984-97 Hi/Low/Mean vs.1998 Mean by Sector Summaries of the environmental radiation exposure rates, determined by thermoluminescent dosimeters (TLDs)are presented in Tables 5-4 and 5-5.1998 REMP ANNUAL REPORT'5-2 0.40 0.38 0.36 0.34 0.32 0.30 g 0.28 K 0.26~0.24 0.22 0.20 0.18 0.16 0.14 N NNE NE ENE E ESE SE SSE S SSW SW WSW W WlAV lAV NNW SECf OR o PRF OPERATIONAL MEAN+1984-97 HVLOW/MEAN

-1998 MEAN Figure 5-3 Remote Quarterly TLDs 1984-97 Hi/Low/Mean vs.1998 Mean by Sector For the Iemote TLDs, Station 46 in the Wahluke Reserve (NE sector)Iemained the location with the highest mean exposure rate, as shown in Figure 5-3.Since the p1eoperational measurement phase, the Iesults for this location have exceeded the Iesults for all other locations.

Variations in the soil and underlying rock composition most likely account for localized differences such as shown in the TLD results for Station 46.The quarterly mean of the four quarterly results for Station 46 was 0.30 mR/day, with a range of 0.27 mR/day to 0.31 mR/day.Frequency distribution plots of the 1998 quarterly TLD Iesults are pIesented in Figure 5-4.The plots were varied slightly from quarter to quarter, with 0.24 mR/day being the most frequent result, followed by 0.25 mR/day, 0.23 mR/day and 0.26 mR/day.The most frequent result for the period 1984 to 1997 was 0.26 mR/day, followed by 0.25 mR/day, 0.27 mR/day and 0.24 mR/day.The frequency distributions for the previous operational TLD results an: shown in Figure 5-5.A comparison of the 1998 annual and mean quarterly TLD result is pIesented in Table 5-6.The 1998 annual TLD Iesults ate generally 5-10%lower than the mean quarterly Iesults because of signal fade.This defference is not significant, in light of the variability commonly observed in TLD results.In most cases, the annual result is within the uncertainty associated with the quarterly TLD IeSultS.5-3 1998 REMP ANNUAL REPORT 70 65 1998 MEAN 0242 mR/DAY TOTAL OCCURRENCES

~227 60 55 50 45 m 40$35 Pg 30 2S 20 IS 10 a}'6l}0.14 0.15 0.16 0.17 0.18 0.19 0.20 0,21 0,22 0.23 0.24 0.25 0.26 0.27 0.28 0.29 0.30 0.31 0.32 0.33 094 035 MEAN mR/DAY~1998 FREQUENCY 1998 CURVE Figure SA Frequency Distribution for 1998 Quarterly TLDs 700 650 600 1984 97 hI EAN~0.251 mR/DAY TOTAI OCCURRENCES~SI40 550 500" 450~}}}}3SO 300 2SO 200 150 100 50."ih 0 4I}m 0.14 0.15 0.16 0.17 0.18 0 19 0,20 0.21 0 22 0.23 0,24 0 25 0.26 0.27 0,28 0,29 0.30 0.31 0.32 0.33 034 0.35 hI RAN mR/DAY~1984.96 FREQUENCY~1984-1997 CURVE Figure 5-5 Frequency Distribution for 1984-97 Quarterly TLDs 1998 REMP ANNUAL REPORT 5-4 5.2 Airborne Particulate/Iodine 'Ihe 1998 mean weekly gross beta on particulate filter icsults for indicator stations near (within 3 miles)Plant 2 are plotted in Figure 5-6.'Ihe yoss beta in air xcsults for 1998 were within the ranges observed during the picoperational period and during previous operational periods, as shown in Table 5-1.In Figure 5-7, the similarity between melts from near-plant locations and those from remote locations can be seen.The control location (Station 9A)insults follow a very similar pattern to the remote and near-plant indicator locations. As observed previously, gross beta levels increased during periods of inversion occurring in the fall and winter months.Gross beta results plotted over a period of several years show a cyclic pattern of fall and winter increases. The increase, which was evident in the results of all the air sampling locations, is due to an increase in radon and radon daughter concentrations during the inversions. The quarterly gamma analyses of the particulate filter composites indicated only the presence of two naturally-occurring radionuclides, beiyHium-7 and potassium-40, at levels above detection limits at indicator locations and the control location.All iodine-131 in air results for 1998 were less than the 0.02 picocuries/cubic meter (pCi/m')LLD.SEEKS l9 75 R)R 1985 ARE NOr INCu)DED IN MEAN DUE TQ IEGII BIAS CAUSED BY CNERNCBYL Io all La aIO~0.09 g aco$ao7 IS aOO 8~ao)aol I 5 5 7 9 II 1515)7)9)I 2)2527%515))557)9 4I 4)454749 5l IRUVAVC I)8597 4$AVERAGE199$ Figure 5-6 1985-97 Weekly Hi/Low/Mean vs.1998 Weekly Mean Gross Beta in Air-Near Plant Stations NOIR'O'EEKS l)-2)fOR I 924 ARE NO7 INCEUDED IN MEAN DUE TO BIO)I BIAS CAUSED BY aKRNOBYL 4.22 w~a)I o a'o$aot 2$ao)o aot OOI I l S I 7 II D 1$27 It II 2l)$27 lt ll)))S)7)t~I 4l 4$47 4t SI WEEK NlfLO/AVCI)9597 ~AVERAGE)992 Figure 5-7 1985-97 Weekly Hi/Low/Mean vs.1998 Weekly Mean Gross Beta in Air-Remote Stations No evidence of any impact of plant operations on the environment was apparent in the particulate filter and charcoal cartridge results for 1998.5-5 1998 REMP ANNUAL REPORT 5.3 Water IO All river/drinking water tcsults for gross beta were within the ranges normally observed and less than 8 picocuries/liter (pCi/1), the level at which a strontium analysis is performed to verify compliance with the Washington State drinking water standard for strontium-90'. The 1998 STATE ANNUAL AVERAGE CONCENTRATION LIMIT I 5:C.)~EJ INTAKE S JOO AREA r3RICIILAND Figure 5-8 Gross Beta in River/Drinking Water-1998 0 gross beta concentrations in FEB MAR APR MAY lUN lUL AUO SEP OCT NOV DEC JAN MONTH river/drinking water, relative to the state annual average concentration limit"", are presented in Figure 5-8.The mean gmss beta results in discharge water for 1998 are presented in Figure 5-9.The 1998 average results compan: well to the averages from previous periods.The gross beta levels in the discharge sample 3cflect the concentrations of naturally-occurring radionuclides, principally potassium-40, and any radionuclides from upstream sources of past Hanford activities present in the makeup water, in addition to radionuclides Aom Plant 2 discharges. The discharge sample results are representative of the radioactivity present in plant discharges before any mixing with river water occurs.All results were below the Washington Department of Health's (WDOH)80 75 70 65 60~55 I 50~is~~i0 g 30 25 20 IO wh, DrriI 833 9XL9F tlXh433UttvrPZtcAIIM38!pe.P JMf IIR CIA>AI~Mat JI;5 JUL AUG sap ocr Nov Dsc hl ONTII Figurc'5.IJ Gross Beta in Discharge Water-1998 investigation level, which is the point the Supply System would notify WDOH of the result.'Strontium-90 is assumed to account for the gross beta result.1998 REMP ANNUAL REPORT'5-'6 The 1998 tritium levels in the river/dm1king water and groundwater were comparable with results obtained for prior years.Tritium levels in the discharge water were higher than the levels observed for the river/drinking water samples because of plant releases and because discharge water samples were taken prior to the water reaching the river and becoming 3 0$406 I.ostol 2.5Bt06 S.os%05 r r ml6.0Er03 6AIEt03ROE@03 1909 I 990 I 99 I I 993)993 I 99I l 995 I 996 I 999 I 990 YEAR diluted.As shown in Figure 5-TRITIIM III/LOW/MEAN ~!FSLIJENT DISCIIARCED 10 the annual mean tritium 9 Figure 5-10 Tritium in Discharge Water and Effluent Discharged 1989-98 continued to be lower than the levels observed in the 1989-96 period.This reduction is due to an overall reduction in the volume of radwaste discharges from a high of over three million gallons in 1993 to a low of 132,000 gallons in 1997.The volume of liquid radwaste discharged in 1998 was 717,000 gaHons.5.0EtM 63Et0l 6.0ER3 33Et03 3.0Em tt SSE403 8 XOE<3 IDEk8 I.OBK8 5.0Et02 0.0Et00 WASIBNGTON DEPARTSIEÃP OF HEALTII INVESISCA'll ON LEVFL tI 000~SECOND TllÃD QUARTER SI COOLINC TOWER DISCIIARCE Figure 5-11 Tritium in Discharge Water-1998 Tritium concentrations in the discharge water for 1998 ranged&om 100 to 4200 pCi/1, which is low when compared to the NRC reporting level of 20,000 pCi/1 for a quarterly average concentration in drinking water.Other than tritium, there were no detectable nuclides in the river/drinking or ground water samples during 1998.The discharge water had detectable tritium and one occurrence of detectable cobalt-60. The cobalt-60 was measured at 6.2 pCi/I, well below the NRC reporting level of 300 pCi/l.5.4 Soil Gamma spectrometry performed on soil samples in 1998 indicated a range of cesium-137 Aom 23 picocuries/kilogram (pCi/kg)to 166 pCi/kg at the indicator stations and a result of 79 pCi/kg at the consol station.As shown in Table 5-1, the cesium-137 levels in the soil samples were well within 5-7 199$REMP ANNUAL REPORT the range observed during preoperational and previous operational sampling.The gamma spectrometry results for the soil samples did not indicate any impact from Plant 2 operations on the environment. No stxontium analysis was xequixcd in 1998.Aside from cesium-137, the only radionuclides detected in the samples were potassium-40, radium-226 and thorium-228. These axe part of the natural radioactivity typically found in soils.5.5 River Sediment The results of gamma spectxometxy of river sediment indicated that aside fxom the naturally occurring radionuclides (potassium-40, radium-226 and thorium-228), cobalt-60 and cesium-137 were detected downstxcam of the plant (Station 34).Cesium-137 was also detected in the upstream control sample (Station 33).The cesium-137 concentrations in the upstream samples were 42'pCi/kg and 60 pCi/kg dxy weight.The concentrations of cesium-137 in the downstxeam samples were 194 pCi/kg and 337 pCi/kg dry weight.Cobalt-60 levels in the two downstream samples were 20 pCi/kg and 22 pCi/kg dry weight, Both cobalt-60 and cesium-137 have been detected in similar quantities in pamperational samples and operational samples.They have also been previously identified as components of the Columbia River sediment originating from the operation of the old Hanfoxd Reservation reactors."" 5.6 Hsh The gamma spectrometry xcsults of fish samples collected in the vicinity of the Plant 2 discharge and at the contxol location on the Snake River were below detection limits, except for potassium-40, a naturally-occurring radionuclide. 5.7 Milk There was one detectable iodine-131 result in 1998.The result of 0.64 pCi/1 was found in the November sample taken at Station 64 and is just above the detection level for this nuclide.The iodine-131 result from the other downwind dairy was below the detection limit.An investigation of plant effluents determined it was not an effect from the plant.All gamma spectxometxy milk sample results for the indicator and control locations were less than the detection limits, except for potassium-40, which is naturally occurring. Because of the loss of the control dairy, it was decided to use the garden produce as a substitute while another suitable dairy was located.No dairy in the area of the control was located that didn'at least use feed grown downwind of the plant as supplemental feed.In August, the REMP began collecting samples of feed grown by the owners of the dairy at Station 9.No radionuclides were detected other than the naturally occurring beryllium-7 and potassium-40. 1998 REMP ANNUAL REPORT 5-8 5.8 Garden Produce The gamma isotopic analysis icsults for all root, fruit and leafy vegetables collected in 1998 were below detection limits other than potassium-40, which occurs naturally. 5.9 Special Interest Stations The storm drain pond, Sanitaiy Waste Treatment Facility (SWTF)and the containerized storage area were incorporated into the routine sampling schedule in 1992.The cooling tower sediment disposal area was added in 1995.Thermoluminescent dosimeters were placed around the spray pond drainfield (Station 120)in June 1995.Discussions of the icsults from each of the locations aic given in the following sections.Until incorporated into the REMP, the sediment samples collected during previous years at the storm drain and SWTF were analyzed by the Supply System.The storm drain and SWTF sediment samples were analyzed wet, so the icsults were in terms of wet weight instead of the dry weight concentrations determined by Teledyne.Consequently, direct comparison of the wet sample icsults with the dried sample icsults is difficult since the peicent solids can vary from sample to sample.5.9.1 Storm Drain Pond (Station 101)The storm drain pond is located approximately 1500 feet northeast of Plant 2.Water is conveyed to the pond via a 18-inch diameter pipe which discharges into a 300-foot long earthen channel that leads to a 100-foot diameter pond.The pond is a shallow, unlined percolation/evaporation basin.REMP personnel collected water, sediment, soil and vegetation samples at the outfall during 1998.Monthly water grab samples and sediment samples were taken&om the pond area beginning in July of 1994 and were discontinued in July 1996.At the outfall, an automatic sampler collected flow proportional composite water samples.Sediment sampling at the outfall was changed from monthly to biannually in July of 1996.Vegetation was sampled annually near the outfall.Tritium was the only isotope detected during 1998.Figure 5-12 shows the monthly averages for 1992 thmugh 1998.The range for positive tritium results at the outfall was from 160 pCi/1 to 3700 pCi/1 and averaged 738 pCi/I.Detectable gross beta activity at the outfall averaged 4.4 pCi/1 with a range of 2.6 to 9.3 pCi/l.In June, an accidental actuation of the fire protection system caused the rupture of a cast iron valve, icsulting in flooding of a stairwell in the Reactor Building.Approximately 160,000 gallons of water was discharged into the stairwell. A sample of the water in the stairwell was taken and counted, per procedure, to free release LLDs by the Plant Chemistry laboratory. There was no detectable activity in this sample.Approximately 17,000 gallons of water was pumped from the stairwell to the storm drain pond when a second sample indicated a possibility of cobalt-60 being present.Pumping activities were suspended. The flow-proportional composite sampler at the outfall collected 171 ml of sample, which upon analysis at Teledyne, confirmed that there was no detectable cobalt-60 present.5-9 1998 REMP ANNUAL REPORT 00 I 1.04+0)5 P I.04+01 JAN FSB O1 991~1991 O1996 JUN JUI MONTH O199S O1 996 81999 1994 Figure 5-12 Average Monthly Tritium at Storm Drain Outfall-1992-98 Sediment at ST101 was sampled biannually at the outfall.In the sediment samples, cobalt-60 and cesium-137 were detected, along with the natural-occurring nuclides potassium-40, radium-226 and thorium-228. Detectable cobalt-60 averaged 174 pCi/kg dry and ranged from 140 pCi/kg dry to 207 pCi/kg dry.The detectable cesium-137 ranged from 38 pCi/kg dry to 44 pCi/kg dry and averaged 41 pCi/kg dry All six soil samples, taken on the east and west banks, had detectable amounts of cesium-137 in them.The natural radionuclides of beryllium-7 potassium-40, radium-226 and thorium-228 were also detected.Cesium-137 averaged 33 pCi/kg and ranged from 30 pCi/kg to 37 pCi/kg.These results an: within the ranges observed in previous years.In the annual vegetation sample taken in the stieam, no detectable radionuclides were found other than potassium-40, which occurs naturally. 5.9.2 Sanitary Waste Treatment Facility (Station 102)The Sanitary Waste Treatment Facility (SWTF), located approximately 0,4 mile south-southeast of Plant 2, processes the sanitary waste from Plant 2, the WNP-1 and WNP-4 sites, the Plant Support Facility (PSF)and the Department of Energy's 400 Area (beginning April, 1997).Discharge standmds and monitoring requirements for the SWTF are established in EFSEC Resolution No.259"".Until April 1992, the SWTF sediment was sampled semiannually and analyzed in the Support Services radiation laboratory and the radionuclide concentrations were given in terms of wet weight.Gross beta icsults for wastewater sampled prior to discharge to the percolation beds averaged 37 pCi/l and ranged Rom 32 pCi/l to 41 pCi/1.An investigation in 1994 into the source of the gross beta indicated potassium', a natural isotope, was the major contributor. Other contributors to the beta appear to be natural isotopes and no fission or activation products were detected that would 1998 REMP ANNUAL REPORT 5-10 indicate Plant 2 as a source.Monthly composite water samples of the 400 Abaca effluent had gross beta results ranging fiom 17 pCi/1 to 41 pCi/1 and averaging 29 pCi/l.Prior to discharge samples and 400 Area effluent samples were also analyzed for gmss alpha.There were no detectable gross alpha results for 1998.Tritium results at the headworks (ST.102B)continued to increase due to the influx of FFTF effluent.The mean at the headworks increased from 466 pCi/1 to 1342 pCi/1.From May until August, tritium levels at the FFTF sewer line (ST.102A)averaged 15000 pCi/1.This was due to FFTF drawing water from another aquifer, known to have tritium levels of approximately 20000 pCi/I, while maintenance was performed on the main pump.The annual average for tritium at ST.102A was 8008 pCi/1 and ranged from 3800 pCi/1 to 20000 pCi/1.Tritium in the prior to discharge samples (ST.102C)averaged 803 pCi/1 and ranged fiom 480 pCi/1 to 1100 pCi/1.Water samples taken fiom the north stabilization pond (ST.102D)ranged fiom 670 pCi/1 to 1200 pCi/1 and average 935 pCi/1 while the south stabilization pond (ST.102E)had a mean of 925 pCi/1 and a range of 550 pCi/1 to 1300 pCi/l.Gamma analysis of sediment samples collected from the north stabilization pond revealed detectable quantities of cobalt-60 and cesium-137 in addition to naturally occurring nuclides.Detectable cobalt-60 ranged fmm 164 pCi/kg dry weight to 2110 pCi/kg diy weight.Cesium-137 results ranged from 72 pCi/kg dry weight to 132 pCi/kg diy weight.After the higher cobalt-60 result was received, a second sample&om the sample area was taken.The cobalt-60 and cesium 137 results for this sample were below the detection limits.5.9.3 Containerized Storage Area (Station 118)Station 118, consists of twenty-nine large metal storage containers holding the low-pressure turbine rotor parts removed from the plant during the 1992 maintenance outage, Soil samples and ionization chamber readings were taken at Station 118.Beginning in September 1994, samples from different areas were composited and sent to Teledyne Brown for analysis Soil samples taken at Station 118 before the storage'of the low-picssure turbine rotor parts contained no detectable radioactivity except that from naturally occurring radionuclides, such as potassium-40 and radium-226. No detectable nuclides, other than those that are naturally occurring, were found in 1998.5.9.4 Cooling Tower Sediment Disposal Area (Station 119)'On May 8, 1995, EFSEC approved Resolution No.278"@that authorized the onsite disposal of cooling tower sediments containing low levels of radionuclides. This area is located just south of the cooling towers.According to Resolution No.278, the REIMP is to monitor the aica's direct radiation exposure rate with annual pressurized ion chamber measurements. Direct radiation dose is measum1 by quarterly and annual TLDs and a dry composite sediment sample is taken from the disposal cell within thirty days following each cleaning to confirm that the disposal criteria outlined in the resolution have not been exceeded.5-11 1998 REMP ANNUAL REPORT An estimated total of 41 cubic yards of material was disposed of during the 1998 cleaning.Using the volume and an average measured dry density of 1.4 g/cm', along with the activity, it is calculated that the following quantities of nuclides were placed in the disposal area: Cobalt-60 Manganese-54 Zinc-65 Cesium-134 1.85E-06 curies 4.56E-07 curies 9.13E-08 curies'1.90E-06 curies Cesium-137 1.00E-05 curies Qf the above nuclides, only cobalt-60 and cesium-137 were above detection levels.The cobalt-60 cult was 42 pCi/kg dry.The cesium-137 result was 228 pCi/kg dry.Since the results for manganese-54, zinc-65 and cesium-134 were lower than the detection limit, the calculated quantities disposed of those nuclides are estimates of maximum possible concentration. Measurements of direct radiation were taken using TLDs and a Reuter Stokes pressurized ion chamber.The TLDs were collected quarterly and annually.Two locations were used, one next to the collection area (ST.119B)and the other approximately 100 yards to the east as the control (ST.119-Control). The mean quarterly TLD result for ST.119B was 0.25 mR/day and ST.119-Control had a mean quarterly result of 0.24 mR/day.The annual TLD results were 0.22 mR/day for ST.119B and 0.23 for ST.119-Control. The pressurized ion chamber readings were taken monthly during 1998.The readings remained consistent throughout the year, with a high mean of 0.0102 mR/hr in March with the plant at 100%power to a low mean of 0.0091 mR/hr in April, with the plant shutdown.The average for the year was 0.0097 mR/hr.5.10 Spray Pond Drain Field (Station 120)Sediment&om spray pond cleanings had been discharge) to a trench located approximately 500 feet south of the spray ponds.In 1995, soil samples taken in, the trcnch indicated detectable amounts of cesium-137 and cobalt-60. In 1996.the deposited sediment was removed to a disposal cell south of the cooling towers.The trencli has continual to be used as the discharge location for spray pond filter backwash water.In 1997, the decision was made to remove the west TLD station inside the trench, and the control TLD station on the south bank.The Station I l9 Control TLD would also act as the control location for Station 120.In 1998, the niean for the quarterly TLD inside the trench was 0.25 mR/day.The quarterly mean for the contrvl location was 0.24 mR/day.The annual results were 0.23 mR/day for both locations. Soil samples were taken in March and October of 1998.The samples are composites, taken from several areas inside the trench.These continued to show that no new radionuclides had been deposited in the trench since the previously deposited sediment was relocated in 1996.Along with the naturally occurring nuclides of beryllium-7, potassium-40, radium-226 and thorium-228, the 1998 REMP ANNVAL REPORT 5-12 only other detectable nuclide was cobalt-60 and cesium-137. The cobalt-60 results were 16 pCi/kg and 61 pCi/kg and the one detectable cesium-137 result was 21 pCi/kg.The cobalt-60 results were far below the pre-cleaning result of 6880 pCi/kg and comparable to results of samples taken immediately after the sediment had been removed in August of 1996.5.11 1998 Sample Deviations Air sampler outages made up the majority of sample deviations for 1998.Problems ranged from pump failure to power outages.Qf the three water sample deviations, one was due to the plant refueling outage and another to an outage of the water source.Deviations are listed in Table 5-2.5-13 1998 REMP ANNUAL REPORT TABLE 5-1 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE

SUMMARY

MEDIA/ANALYSIS PREOPERATIONALto MEAN RANGE PREVIOVS OPERATIONAL&xe MEAN RANGE 1998'" MEAN NGE Air: pCI/m'ross Beta 1-131" Gamma Cs-134 Cs-137 River/Drinking Water: pCi/I Gross Beta Gamma Cs-134 Cs-137 Co-58 Fe-59 Zn-65 H-3 Groundwatert pCi/1 Gamma Cs-134 Cs-137 Co-58 Co-60 Fe-59 Zn-65 H-3<0.02 (<0.003-0.130)<0.05 (<0.01-0.11)<0.01 (<0.001-0.040)<0.01 (<0.001-0.040)<3 (<I-<6)<3.8 (<I-<12)<4.1 (<I-<13)<5.1 (<I-<25)<4.7 (<I-<13)<13.3 (<2-<93)<8.3 (<2-<27)<481.7 (220-<820)<4 (<I-<12)<3.8 (0.8-<8)<4.'7 (<I-<12)<4.1 (0.1-<9)<11.6 (<2-<33)<8.6 (<2-17)<467.8 (<10-2600)0.020 (0.001-0.741)0.00 (%.07-0.82)0.0003 (%.0021-0.0149)0.0006 (%.0011-0.0356)1.9 (W.2-9.1)0.1 (-8.2-5.2)I (-5.7-6.2)4.1 (-3.3-2.9)0.7 (-4.9-7.1)0.7 (-8.9-6.9)4.9 (-16.2-10.5)108.4 (-500-596)0.4 (-4.1-5.4)0.9 (-6-4.9)-0.4 (-3.3-1.9)0.9 (-2.4-8.4)0.8 (-4.5-5.7)-0.6 (-46.8-15)16.7 (-516-324)0.012 (0.002-0.043)0.00 (-0.01-0.01)0.0000 (%.0003-0.0002)0.0000 (%.0003-0.0002)1.6 (0.4-2.4)0.1 (-2.3-2.6)0.7 (-3.2-3.3)%.1 (-2.3-1.1)0.1 (-3.1-1.4)1.6 (-2-6)0.9 (-2.7-5)120.3 (7.1-250)0.2 (-1.5-2.2)0.5 (-2.7-4.2)-0.4 (-2-0.7)0.2 (-2.1-1.7)0.2 (-2.2-3.3)I (-4.3-9.5)47.5 (-47-190)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of thc data means and ranges are biased high due to Chernobyl in 1986.(c)The data used for these avcragcs does not include the less than'alues reported in 1984.(d)Indicator stations only.(e)Charcoal cartridge results.1998 REMP ANNUAL REPORT-5-14 TABLE 5-1 (cont,)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE SUhQ~Y PREOPERATIONALto MEDIA/ANALYSIS MEAN GE MEAN GE PREVIOUS OPERATIONAL' 1998'o GE Discharge Water: pCI/I Gross Beta<2.8 (<1.9-4)16.9 (0.6-56)9.4 (1.1-22)Cs-134 Cs-137 Co-58 Fe 59 Zn-65 H-3 Sr-90<3.7 (<I-<8)<4.7 (<I-16)<1.4 (I-13)<5.0 (<1.9-<13)<11.9 (<3-<38)<8.6 (<2-27)<420 (<80-700)<3 0.5 2 0.0 5.6 0.9 3.8 1907 0.8 (-3.9-10.1)(-5.3-23.1)(-2.6-4.6)(-8.7-57.6)(-5.9-13)(-8.2-86.7)(55-12000)(0.5-1.1)0.5 1.5 W.3 0.6 1.5 0.4 803 (-1.1-1.9)(W.I-3.2)(-1.4-2.7)(-6.5-6.2)(-1.3-4.7)(-2.6-3.9)(62-1600)Analysis Not Performed Storm Drain Water: pCi/I Gross Beta Analysis Not Performed Analysis Not Performed 9.6 (0.2-1100)3.3 (0.3-9.3)Cs-134 Cs-137 Co-58 Co-60 Fe-59 Zn-65 Mn-54 1-131 Ce-141 1-131" H-3 Analysis Not Performed 0.0 1.3-0.4 0.9 0.8 0.8 0.6 W.I-I 0.4 5703.5 (-9.6-8.1)(-11-252)(-7.6-3.4)(A.2-125)(-14-12)(-13-53)(-6.2-6.7)(-17-21.1)(-441-707)(-0.2-8.3)(-330-270000)0.1 0.8 W.3 0.4 0.8 I 0.2 0.5-1.7 (-7.6-2.7)(A.4-7.5)(-3-2.5)(-11-2.9)(-3.5-4.7)(-6.7-1.8)(-2.9-3.5)(-4.2-7.7)(-13.2-3.3)Analysis Not Performed 324.6 (-52-3700)Sanitary Waste Water: pCi/I Gross Alpha Gross Beta Cs-134 Cs-137 Co-58 H-3 Analysis Not Performed Analysis Not Performed Analyses Not Performed 0.5 35.6 0.1 1 A.3 0.4 496.9 (48-2.3)(5.9-61)(-2.6-4.9)(-5.1-4.2)(-2.9-1.8)(-12.9-4)(-170-6700)0.5 31.3 0.2 0.9 W.3 0.1 3723.1 (-I-2.4)(17-41)(-2.3-2.6)(-4.2-3.6)(-1.4-1.6)(-3.2-1.7)(-170-20000)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges are biased high due to Chernobyl in 1986 (c)The data used for these averages does not include the'less than values reported in 1984.(d)Indicator stations only." (e)Resin method 5-15 1998 REMP ANNUAL REPORT TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE

SUMMARY

MEDIA/ANALYSIS PREOPERATIONALro MEAN RANGE PREVIOUS OPERATIONAL"xo NGE 1998'+GE Analysis Not Performed" Cs-134 Cs-137 Co-58 Zn-65 Mn-54 Ce-141 Sanitary Waste Sediment: pCi/kg (dry)Gamma: Analysis Not Performed" Cs-134 Cs-137 Zn-65 Mn-54 Annual Soil: pCi/kg (dry)Gamma River Sediment: pCI/kg (dry)Gamma Cs-134.<112.5 (<50-<150)Cs-137<287 (<50-<560)Co-60<254.6 (130-610)Storm Drain Sediment: pCi/kg (dry)Gamma: 52.1 (7-172)316.1 (136.5-1890)37.4 (9-129)61.6 (4.1-1140)160.6 (-3.6-2900)-1.9 (-27-58)750.7 (-6.4-25400)116.2 (-34.5-4650)22.8 (-9.6-670)35.2 (-28.8-3740)27.7 (-15.6-55.2)148.8 (0-255.1)227.7 (-3.4-728.2)12.1 (-106-125)6.2 (-26-95)32.5 (26.1-38.9)265.5 (193.9-337.1)20.9 (20.3-21.6)12.2 (5.2-19.2)41.2 (38.1-44.4)-7.9 (-8.7--7.1)173.1 (139.6-206.6)4.8 (-34.5-1.2)1.6 (0.1-3.1)4.1 (1.5-6.7)34.6 (25.7-45.8)73.3 (15.7-132.1)760 (4.9-2110)1.6 (-38-37)9.1 (2.6-12.4)Cs-134 Cs-137 Sr-90<65.3 (<20-<150)364.3 (<20-<1880)Analysis Not Performed 24.9 (I-53.2)224.1 (-7.3-735)178.8 (0.2-455)32.7 (29.3-37.1)80.6 (23-165.9)Analysis Not Performed (a)All stations all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges aro biased high due to Chernobyl in 1986 (c)Tho data used for theso averages does not include the less the'alues reported in 1984.(d)Indicator stations only.(o)Prior to February 1992, theso samples werc analyzed as wet weight.These numbers aro for tho samples analyzed as dry weight.1998 REMP ANNUAL REPORT 5-16 TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENrAL MONITORING PROGRAM COMPARITIVE

SUMMARY

MEDIA/ANALYSIS ST 118 Soil: pG/kg (dry)Gamma Cs-134 Cs-137 Storm Drain Soil: pCi/kg (dry)Gamma Cs-134 Cs-137 Milk: pG/I Gamma PREOPERATIONAU'EAN RANGE Analysis Not Performed Analysis Not Performed MEAN NGE 22.4 (-3.5-46)14.9 (0.5-48)22.3 (-1.4-38)41.7 (12.5-77.3)PREVIOUS OPERATIONAL' MEAN 21.8 13.7 24.7 (16.5-29.2)32.9 (30-36.7)Cs-134 Cs-137 Ba-140 La-140 1-131'" Sr-90 Fish: pG/kg (wet)Gamma<3.7 (<0.9-<14)<3.8 (<I-<12)<72.1 (<6-<2000)<33.3 (<5-1000)<0.5 (<0.1-<I)Analysis Not Performed 0.7 2.2 0.2-0.4 0.7 1.9 (-8.7-22.6)(-6.6-47.3)(A4.3-55)(-24.2-9.7)(A.8-143.6)(1.3-3.9)0.1 (-6.5-3.4)1.1 (-4.5-5.1)0.1 (-8.7-8.2)44 (-6.1-2.5)0.0 (A.4-0.6)Analysis Not Performed Cs-134 Cs-137 Co-58 Co-60 Fe-59 Mn-54 Produce: pG/kg (wet)Gamma<61.2 (<6-<130)<88.8 (<10-<130)87.7 (<9-<130)<80.6 (<9-<130)<130 (<30-<260)<88.3 (<8-<130)1.8 (-20.4-24)14.2 (-35.1-57)0.5 (-16.8-25.8)1.6 (-18.4-21)0.2 (-34.2-30)1.5 (-20-30.9)-1.4 8.7 2.5 0.1 1.6 1.6 (-6.7-6.4)(4.4-13.2)(0.4-4.3)(-6.3-4.6)(-1.6-7.2)(N.7-2.9)Cs-134 Cs-137 1-131<49.1 (<10-<140)<69.8 (<10-<140)<105.6 (<10-<1000)0.6 (-24.8-19.8)3 (-9.8-20.9)-0.3 (-26-59)0.4 (-3.4-3.6)1.2 (-1.7-2.4)4.1 (-5.3-3)(a)All stations, all years.(b)Indicator stations only for tho years 1984 to 1997.Some of the data means and ranges aro biased high duo to Chernobyl in 1986.(c)Tho data used for theso averages does not includo the less than values reported in 1984.(d)Indicator stations only.(o)Resin method.5-17 1998 REMP ANNUAL REPORT TABLE 5-1 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM COMPARITIVE SUMIrIARY MEDIA/ANALYSIS Storm Drain Vegetation": pCi/kg (wet)Gamma Mn-54 Co-60 Zn-65 Cs-134 Cs-137 PREOPERATIONALto MEAN RANGE Analysis Not Performed MEAN NGE 11.9 (-2-32.2)18.1 (-3.7-48.2)25 (-4.3-57.4)6.6 (-6.5-45.8)24.7 (-1.6-93.5)PREVIOUS OPERATIONAL' MEAN RANGE 2.2-3.8 26.8-14.8-1.2 Cooling Tower Sediment: pCi/kg (dry)Analysis Not Performed Analysis Not Performed Mn-54 Co-60 Zn-65 Cs-134 Cs-137 8.8 (2.8-14.9)69.7 (69.7-92.3)17 (4.5-27.8)32.1 (28-34.6)228.3 (211-236.9)10.4 32.2 2.1 43.2 228.1 TLD: mR/day Quarterly Annual 0.24 (0.17-0.31)0.24 (0.20-0.29)0.25 (0.16-0.35)0.24 (0.18-0.34)0.24 (0.20-0.31)0.22 (0.19-0.28)(a)All stations, all years.(b)Indicator stations only for the years 1984 to 1997.Some of the data means and ranges are biased high due to Chernobyl in 1986.(c)Tho data used for thesoaverages does not include the less than values reported in 1984.(d)Indicator Stations only.(o)Routino samples from tho outfall only.1998 REMP ANNUAL REPORT 5-18 TABLE 5-2 1998 SAMPLE DEVIATIONS SAMPLE MEDIA DATE Air Particulate/Iodine 02/0242/09 02/0942/17 04/2745/04 05/1145/18 05/1845/26 05/1845/26 05/2646/01 05/2646/01 07/2047-27 11/02-11/09 LOCATION Station 5 Station 5 Station 7 Station 57 Station 1 Station 48 Station 1 Station 48 Station 4 Station 48 PROBLEM Power off for substation repair.Sample volume acceptable Power off for substation repair.Sample volume acceptable Unit failure.Sample volume acceptable. Unit failure.Sample volume acceptable. Power off due to Outage.Sample volume unacceptable. Unit failure.Sample volume unacceptable. Power restored this week.Volume acceptable. Late placement in field.Sample volume acceptable. Unit failure.Sample volume unacceptable. Unit failure.Sample volume unacceptable. Water Soil, Milk R-13 Outage 08/1048/18 12/01-12/10 12/31 2 Quarter Station 27 Station 28 Station 28 Station 101 Station 96 Sampler in Timed mode for plant outage.Sampler out of service for repair.Sample shipped on schedule.300 Area water off.No sam le due to wet weather.Ramerman Dairy quits operation. No suitable replacement found.Substitution of broadleaf vegetables and feed from Station 9 used l 5-19 1998 REMP ANNUAL REPORT TABLE 5-3 RADIOLO ICAL ENVIRONMENTAL MONITORING PROGRAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection~'ean (Ratio)"'D an e Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Control Location Mean (Ratio)"t an e Number of Nonroutine Reported Measurements Air Particulates (pCi/ms)Gross Beta 624 Gamma 48 (Quarterly) 0.003 0.012(572/572) (0.002%.043) 4 6.4 191 SSE 0.013(52/52) 0.012(52/52) 0 (0.004%.043) (0.0034.029) Air Iodine (pCi/m')Soil (pCi/kg dry)Be-7 I-131 624 Gamma 5 Cs-137 Ra-226 Th-228 0.01 0.098(44/44) (0.061%.173)0.01 0.006(5/44) (0.001%.006) 0.01-(0/572)700 14300(4/4) (13400-16700)40 80.6(4/4)(23.0-166) 400 862(4/4)(637-988)50 637(4/4)(457-867)40 6.4mi SE 0.111(4/4) (0.0764.173)4 6.4 mi SSE 0.006(1/4) 7 2.7 mi WNW 166(1/I)23 3.0 mi ESE 988(l/I)23 3.0 mi ESE 867(1/I)23 3.0 mi ESE 16700(1/1) 0.095(4/4) (0.0684.148) -(0/4)-(0/52)12500(l/I) 78.8(1/I)951(l/1)618(1/I)0 mean of positive results above theLLD atNt ratio of those results to the number of sampl LLDs~t LUgggbe loggspeei fjg~tes.~for the parameter of interest. TABLE 5-3 (cont.)RADI LOGICAL ENVIRONMENTAL M ORIN PR RAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'ampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+) Mean (Ratio)@an e Location With Hi est Mean Name Mean (Ratio)"'istance and Direction an e Number of Control Location Nonrou tine Mean (Ratio)"'eported an e Measurements. Water (River/Drinking)(pCi/liter) Gross Beta 36 4 1.66(21/24) (0.40-2.4) 28 7.4 mi SSE 1.88(12/12) (1.1-2.4)1.56(10/12) Tritium 12 Gamma 36 200 197(3/8)(140-250)28 7.4 mi SSE 197(3/4)(140-250)-(0/4)Water (Discharge)(pCi/liter) Gross Beta 12 Tritium 4 Gamma 12 20-(0/24)12 9.44(12/12) (1.1-22)1050(3/4)(62-1600)27 3.2mi E 27 3.2mi E 9.44(12/12) (1.1-22)1050(3/4)(62-1600)-(0/12)-(0/0)-(0/0)Co%0 Cs-137 10-(0/12)10-(0/12)-(0/0)-(0/0)(a)'Ihe mean of positive results above theLLD and ratio of those results to the number of samples analyzed for the parameter of interest.(b)Contract LLDs.hctual LLDs may be lower for specific samples. TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORIN PROGRAM

SUMMARY

WASHINGTON PUBLIC POWER SUPPLY SYSTEM WN P-2 DOCKEI'O.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Water (Ground)(pCi/liter) Sediment (pCi/kg dry)Analysis and Total Number of Analyses Performed Tritium 12 Gamma 12 Gamma 4 Lower Limit of All Indicator Locati Detection~'ean (Ratio)"'LD an e 200-(0/12)-(0/12)ons Location With Hi hest Mean Name Mean (Ratio)t" Distance and Direction an e Control Location Mean (Ratio)t" an e-(0/0)-(0/0)Number of Nonroutine Reported Measurements Co%0 700 15800(2/2) (14400-17200) 30 20.9(2/2)(20.3-21.6) 34 3.5 mi ESE 34 3.5 mi ESE 15800(2/2) (14400-17200) 20.9(2/2)(20.3-21.6) 14450(2/2) (14300-14600) -(0/2)Cs-137 40 266(2/2)(194-337)34 3.5 mi ESE 266(2/2)(194-337)50.3(2/2)(41.0-59.6) Ra-226 Th-228 50 1058(2/2)(986-1130) 738(2/2)(722-754)33 3.6 mi ENE 33 3.6 mi ENE 1280(2/2)(660-1900) 1037(2/2)(523-1550) 1280(2/2)(660-1900) 1037(2/2)(523-1550) mean of positive results above theLLD and ratio of those results to the timber of sampl for the parameter of interea.LLD~I LL~be to~spec~tea.~ TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PR GRAM MARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Fish (pCi/kg wet)hlilk (pCi/liter) Broadleaf In Lieu of hIilk (pCi/kg wet)Roots (pCi/kg wet)Fruits (pCi/kg wet)Vegetables (pCi/kg wet)Analysis and Total Number of Analyses Performed 1-131 57 Gamma 57 Gamma 5 Gamma 8 Gamma 9 Gamma 10 Lower Limit of All Indicator Locations Detection+'ean (Ratio)+LD an e 1000 3363(3/3)(2910-3620) 0.5 0.6(1/54)200 1341(54/54) (1120-2000) 200-(0/0)-(0/4)-(0/5)-(0/5)Location With Hi est ean Name Mean (Ratio)+Distance and Direction e 38 26.5 mi ESE 3747(3/3)(32204460) 64 9.7 mi ESE 0.6(1/54)96 36.0 IIB SW 1383(3/3)(1180-1490) 9G 30.0 mi WSW 5820(5/5)(3720-7760) Control Location Mean (Ratio)@att e 3747(3/3)(3220M60)-(0/3)1383(3/3)(1180-1490) 5820(5/5)(3720-7760) -(0/4)-(0/4)-(0/5)Number of Nonroutine Reported Measurements. '0 (a)'the mean of positive results above theLLD and ratio of those results to the number of samples analyzed for the parameter of interest.(b)Contract LLDs.Actual LLDs msy be lower for specific samples. TABLE 5-3 (cont.)RADIOLOGICAL ENVIROIOIENTAL MONITORING PROGRAM

SUMMARY

WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+'ean (Ratio)o'ane Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Number of Control Location Nonroutine Mean (Ratio)t" Reported an e Measurements .Direct Radiation TLD Quarterly TLDs (mR/day)227 0.25(223/223) (0.204.31) 46 5 88 NE 0.30(4/4)0.22(4/4)0 (0.27%.31) (0.214.23) Direct Radiation Annual TLDs (mR/day)ST119 Direct Radiation TI.D Quarterly TLDs (mR/day)57 0.22(56/56) (0.194.28)0.25(4/4)(0.244.27) 46 Smi NE 119B 0.2mi S 0.28(1/I)0.25(4/4)(0.244.27) 0.20(1/I)0.24(4/4)(0.234.25) STI19 Direct Radiation TLD Annual TLDs (mR/day)ST120 Direct Radiation TLD Quarterly TLDs (mR/day)ST120 Direct Radiation TLD Annual TLDs (mR/day)0.23(l/I)0.25(4/4)0.23(l/1)119Cntrl 0.2 mi SSE 120 0.3 nu SSE 120 0.3 mi SSE 0.23(1/I)0.25(4/4)0.23(1/I)0.23(1/I)mean of positive results above theLLD and ratio of those results to the number of sarnpl for the parameter of interest.LDs~l LUQgbe lo~specifjggles. ~ W M W-W W TABLE 5-3 (cont.)R DI GICAL E ONME AL M R WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 HANFORD WASHINGTON PROGRAM MARY DOCKET NO.50-397 JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit&'I-"'Detection+ Mean (Ratio)+e tion With Hi est Name Mean (Ratio)@Distance and Direction e Control Location Mean (Ratio)@e Number of Nonroutine Reported Measurements ~Storm Drain Sediment Gamma 2 Station 101-Outfall (pCi/kg)Mn-54 700 4855(2/2)(4490-5220) 40$0/2)101 0.3 mi ENE 4855(2/2)(4490-5220) -(0/0)$0/0)0 Co%0 30 205(2/2)(140-270)100 56.3(1/2)101 0.3 mi ENE 101 0.3 nn ENE 205(2/2)(140-270)56.3(1/2)-(0/0)-(0/0)Cs-137 Ra-226 Th-228 40 41.2(2/2)(38%4.4)400 826(2/2)(810-841)50 399(2/2)(363434)101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 41.2(2/2)(38.M.4)826(2/2)(810-841)399(2/2)(363-434)$0/0)-(0/0)-(0/0)(a)tbe mean of positive results above tbeLLD stat ratio of tbose results to tbe number of sampies analysett for tbe parameter of interest.(b)Contract ILDs.hctual I1Ds may be lower for specific samples. TABLE 5-3 (cont.)RADIOLOGICAL ENVIRONMENTAL hiONITORING PROGRAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY I to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of All Indicator Locations Detection+ Mean (Ratio)t" LD an e Location With Hi hest Mean Name Mean (Ratio)" Distance and Direction an e Control Location Mean (Ratio)to an e Number of Nonroutine Reported Measurements. Storm Drain Soil (pCi/kg)Be-7 136(6/6)(101-185)101 0.3 mi ENE 136(6/6)(101-185)-(0/0)700 15217(6/6) (14600-16200) 101 0.3 mi ENE 15217(6/6) -(0/0)(14600-16200) 0.Station 118 Soil (pCi/kg dty)Mn-54 Cs-137 Ra-226 Th-228 Gamma 1 Be-7 Ra-226 Th-228-(0/6)40 32.8(6/6)(29.9-36.7) 400 777(6/6)(677-885)50 467(6/6)(168-561)171(1/I)700 13100(1/1) 40 640(1/1)50 521(1/1)101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 118 0.3 mi SE 118 0.3 mi SE 118 0.3 mi SE 118 0.3 mi SE 32.8(6/6)(29.9-36.7) 777(6/6)(677-885)467(6/6)(168-561)171(1/I)13100(1/I) 640(1/1)521(1/1)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)-(0/0)0~mean of positive results above theLLD and ratio of those results to the number of sampl for the parameter of interest.LLD~at LL~be l~spec~ptas. ~ TABLE 5-3 (cont.)RADI L I LE AL 0 R G WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 HANFORD WASHINGTON PRO RA MARY DOCKET NO.50-397 JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway'ampled nit of Measurement Storm Drain Vegetation (pCi/kg wet)Analysis and Total Number of Analyses Performed Gamma 1 Be-7 Lower Limit Detection+ Mean (Ratio)@an e-(0/1)Location W'th Hi est Name Mean (Ratio)@Distance and Direction e Control Location Mean (Ratio)@e-(0/0)Number of Nonroutine Reported Measurements Storm Drain Water Station 101 (pCi/liter) Gross Beta 47 Tritium 46 Gamma 48 3020(1/1)4 40(22/47)(2.6-9.3)300 738(19/46) (160-3700) 101 0.3 mi ENE 101 0.3 mi ENE 101 0.3 mi ENE 3020(1/1)4.40(22/47) (2.6-9.3)738(19/46) (160-3700) -(0/0)-(0/0)-(0/0)0 Sanitary Waste Treatment Facility Water (pCi/1)Cs-137'Ih-228 Gross Alpha 16 Gross Beta 16 Tritium 32 200-(0/48)10-(0/48)10-(0/48)-(0/16)1 31.2(16/16) (1741)300 3978(30/32) (470-20000) 102C 0.4 mi SSE 102A 0.4 mi SSE 31.2(16/16) (1741)8042(12/12) (3800-20000) $0/0)$0/0)$0/0)$0/0)-(0/0)$0/0)0 (a)iho mean of positive results above thcILD and ratio of those results to thc number of samples analyzed for tho paramctcr of interest.(b)Contract ILDs.hctual ILDs may bo lower for specific samples. TABLE 5-3 (cont.)RADIOLOGICAL ENVIROIAKNTAL MONITORIN PRO RAM UMMARY WASHINGTON PUBLIC POWER SUPPLY SYSTEM WNP-2 DOCKET NO.50-397 HANFORD WASHINGTON JANUARY 1 to DECEMBER 31, 1998 Medium or Pathway Sampled nit of Measurement Analysis and Total Number of Analyses Performed Lower Limit of ll Indicator Locatio Detection"'ean (Ratio)'" LD all e ns Location With Hi est Mean Name Mean (Ratio)+Distance and Direction an e Control Location Mean (Ratio)+an e Number of Nonroutine Reported Measurements .Sanitary Waste Treatment Facility Water (pCi/1)(cont.)Gamma 32 300 56.8(l/22) 102A 0.4 mi SSE 56.8(1/22) -(0/0)Sanitary Waste Treatment Facility Sediment (pCi/kg)Gamma 3 Cs-137 700 10860(3/3) (8980-13200) 30 1137(2/3)(164-2110) 40 74(3/3)(15.9-132) 102 0.4 mi SSE 1020.4 mi SSE 1020.4 mi SSE 10860(3/3) (8980-13200) 1137(2/3)(164-2110) 74(3/3)(15.9-132) -(0/0)-(0/0)-(0/0)Ra-226'Ih-228 400 1413(3/3)(1190-1540) 50 654(3/3)(448-967)1020.4 mi SSE 102 0.4 mi SSE 1413(3/3)(1190-1540) 654(3/3).(448-967)-(0/0)-(0/0)0 mean of positive results above theLLD and ratio of those results to the number of ssrnpl for the parameter of interest.LDsl L~be to~speci~tea. ~ TABLE 5-4 MEAN QUARTERLY TLD DATA SUhGVfARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 19&4-1997 OPERATIONAL 1998 OPERATIONAL STATION MEAN"'TANDARD ERROR MEAN STANDARD ERROR MEAN STANDARD ERROR I 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 40 41 42 43 44 45 46 47 49 50 51 0.24 0.23 0.22 0.22 0.23 0.22 0.23 0.26 0.22 0.23 0.24 0.25 0.24 0.24 0.25 0.24 0.25 0.24 0.24 0.24 0.23 0.24 0.24 0.24 0.25 0.22 0.26 0.25 0.25 0.23 0.23 0.29 0.22 0.24 0.22 0.23 0.02 0.02 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.02 0.02 0.00 0.00 0.01 0.25 0.25 0.24 0.22 0.23 0.23 0.24 0.27 0.23 0.24 0.24 0.26 0.25 0.25 0.26 0.25 0.25 0.25 0.25 0.25 0.23 0.25 0.24 0.25 0.26 0.23 0.26 0.26 0.26 0.24 0.24 0.30 0.23 0.25 0.25 0.24 0.01 0.00 0.00 0.01 0.00 0.00 0.00 0.01 0.00 0.00 0.00 0.01 0.00 0.00 0.01 0.00 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.00 0.01 0.01 0.01 0.00 0.00 0.01 0.01 0.00 0.01 0.00 0.25 0.24 0.23 0.21 0.22 0.22 0.24 0.25 0.22 0.23 0.23 0.25 0.24 0.23 0.25 0.24 0.25 0.24 0.25'.25 0.23 0.24 0.23 0.24 0.25 0.22 0.25 0.24 0.24 0.23 0.23 0.30 0.22 0.24 0.24 0.23 0.01 0.00 0.00 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.00 0.01 0.01 0.00 0.01 0.00 0.01 0.01 0.01 0.01 0.00 0.01 0.00 0.01 0.00 0.01 0.01 0.00 0.00 0.01 0.01 0.02 0.01 0.01 0.02 0.01 (a)This preoperational mean is for the 1982-1983 data only.5-29 1998 REMP ANNUAL REPORT TABLE 5-4 (cont.)MEAN QUARTERLY TLD DATA SUMMITRY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 1984-1997 OPERATIONAL 1998 OPERATIONAL STATION MEAN" STANDARD ERROR MEAN'TANDARD ERROR MEAN STANDARD ERROR 53 54 55 56 61 65 71(1S)72(2S)73(3S)74(4S)75(5S)76(6S)77(7S)78(8S)79(9S)80(10S)81(11S)82(12S)83(13S)84(14S)85(15S)86(16S)119B 119Ctrl 120 East 120West 120 Ctrl All 0.27 0.26 0.23 0.24 (h)(c)0.24 0.25 0.23 0.26 0.22 0.24 0.25 0.25 0.25 0.24 0.24 0.26 0.25 0.24 0.26 0.25 (d)(d)(d)(d)(d)0.25 0.00 0.00 0.00 0.00 0.02 0.01 0.01 0.01 0.02, 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.01 0.01 0.02 0.01 0.00 0.27 0.26 0.24 0.25 0.27 0.24 0.28 0.27 0.24 0.27 0.25 0.25 0.25 0.25 0.25 0.24 0.25 0.25 0.26 0.25 0.26 0.28 0.26 0.26 0.27 0.28 0.25 O.~d 0.01 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.04 0.01 0.01 0.25 0.24 0.24 0.24 (h)0.23 0.28 0.27 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.25 0.24 0.25 0.25 0.27 0.25 0.24 0.25 (d)(d)0.25 0.01 0.01 0.00 0.01 0.01 0.02 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.01 0.02 0.01 0.01 0.01 0.01 (a)This preoperational mean is for 1982-1983 data only (b)Station 61 was added in 1989 and discontinued m 199'c)Station 65 added in 1997.(d)Stations 119B, 119Ctrl, 120East, 120West and l20Ctrl added>n l995.Stations 120Wcst and 120Ctrl discontinued in 1997.1998 REMP ANNUAL REPORT 5-30 TABLE 5-5 ANNUAL TLD DATA SUhQVIARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day STATION PREOPERATIONAL 1984-1997 OPERATIONAL MEAN" STANDARD ERROR MEAN STANDARD ERROR 1998 OPERATIONAL RESULT 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 24 25 40 41 42 43 44 45 46 47 49 0.25 0.23 0.23 0.24 0.24 0.22 0.23 0.26 0.22 0.23 0.24 0.26 0.24 0.23 0.25 0.25 0.24 0.25 0.24>>0.24 0.22 0.24 0.23 0.24 0.25 0.21>>0.26 0.24>>0.24>>0.24 0.23 0.29 0 22>>(c)0.04 0.00 0.01 0.07 0.03 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.01 0.00 0.03 0.01 0.02 0.03 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.01 0.01 0.24 0.23 0.22 0.21 0.22 0.22 0.23 0.26 0.21 0.22 0.23 0.25 0.23 0.23 0.25 0.24 0.24 0.24 0.24 0.24 0.22 0.23 0.23 0.24 0.25 0.22 0.25 0.24 0.25 0.23 0.23 0.29 0.22 0.23 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.22 0.22 0.21 0.19 0.19 0.20 0.21 0.24 0.20 0.22 0.22 0.24 0.22 0.22 0.23 0.23 0.23 0.24 0.24 0.23 0.20 0.23 0.21 0.22 0.22 0.20 0.22 0.22 0.20 0.20 0.22 0.28 0.21 0.22 (a)This prcopcrational mean is for 1982-1983 data only.(b)Thcro was only ono annual exchange during tho preoperational period.(c)Stations 49-56 were first monitored during Fourth Quarter 1983.(d)TLD missing.5-31 1998 REMP ANNUAL REPORT TABLE 5-5 (cont.)ANNUAL TLD DATA SUhQVlARY FOR THE PREOPERATIONAL AND OPERATIONAL PERIODS Results in mR/day PREOPERATIONAL 1984-1997 OPERATIONAL STATION MEAN" STANDARD ERROR MEAN STANDARD ERROR 1998 OPERATIONAL RESULT 50 51 53 54 55 56 61 71 (1$)72 (2S)73 (3S)74 (4S)75(SS)76(6S)77 (7S)78 (8S)79 (9S)80 (IOS)81 (I IS)82 (12S)83 (13S)84 (14S)85 (ISS)86 (16S)119B 119Ctrl 120East 120 West 120 Ctrl All (c)(c)(c)(c)(c)(c)(c)O.24>>P 25>>0.23>>O.24>>0.24>>O.24>>O.25>>0.25>>P 25>>0.23>>P 23>>P 25>>0.25>P 23>>0.25">0.24>>0.24 0.00 0.23 0.23 0.26 0.25 0.23 0.24 O.26>>0.27 0.26 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.24 0.25 0.24 0.25 0.27 0.28 0.28 0.30 0.33 0.29 0.24 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.03 0.01 0.02 0.00 0.23 0.22 0.24 0.23 0.21 0.22 (d)0.25 0.25 0.22 0.24 0.22 0.22 0.22 0.22 0.22 0.23 0.22 0.22 0.23 0.23 0.24 0.26 0.22 0.23 0.23 (e)(e)0.22 (a)This preoperational mean is for 1982-1983 data only.(b)There was only one annual exchange during the preoperational period.(c)Stations 49-56 were first monitored during Fourth Quarter 1983.Station 61 was added in 1989.(d)Station 61 discontinued on June 29, 1992 (e)Stations 120West and 120Ctrl were discontinued in 1997 1998 REMP ANNUAL REPORT ,5-32 TABLE 5-6 1998 MEAN QUARTERLY VERSUS ANNUAL TLD DATA Results in mR/day 1984-97 TLDs QUARTERLY ANNUAL STATION MEAN"'EAN QUARTERLY MEAN'" 1998 TLDs ANNUAL RESULTS I 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1&19 20 21 22 23 24 25 40 41 42 43 44 45 46 47 49 50 0.25 0.25 0.24 0.22 0.23 0.23 0.24 0.27 0.23 0.24 0.24 0.26 0.25 0.25 0.26 0.25 0.25 0.25 0.25 0.25 0.23 0.25 0.24 0.25 0.26 0.23 0.26 0.26 0.26 0.24 0.25 0.30 0.23 0.25 0.25 0.24 0.23 0.22 0.21 0.22 0.22 0.23 0.26 0.21 0.22 0.23 0.25 0.23 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.22 0.23 0.23 0.24 0.25 0.22 0.25 0.24 0.25 0.23 0.23 0.29 0.22 0.23 0.23 1.05 1.05 1.07 1.06 1.07 1.06 1.05 1.03 1.06 1.07 1.06 1.06 1.06 1.07 1.05 1.06 1.04 1.05 1.06 1.05 1.06 1.06 1.06 1.06 1.05 1.07 1.06 1.07 1.06 1.06 1.07 1.04 1.05 1.06 1.07 0.25 0.24 0.23 0.21 0.22 0.22 0.24 0.25 0.22 0.23 0.23 0.25 0.24 0.23 0.25 0.24 0.25 0.24 0.25 0.25 0.23 0.24 0.23 0.24 0.25 0.22 0.25 0.24 0.24 0.23 0.23 0.30 0.22 0.24 0.24 0.22 0.22 0.21 0.19 0.19 0.20 0.21 0.24 0.20 0.22 0.22 0.24 0.22 0.22 0.23 0.23 0.23 0.24 0.24 0.23 0.20 0.23 0.21 0.22 0.22 0.20 0.22 0.22 0.20 0.20 0.22 0.28 0.21 0.22 0.23 1.12 1.10 1.09 1.09 1.11 1.12 1.15 1.03 1.08 1.08 1.06 1.05 1.07 1.09 1.09 1.07 1.12 1.03 1.04 1.06 1.13 1.04 1.12 1.12 1.12 1.10 1.10 1.10 1.22 1.16 1.08 1.05 1.05 1.07 1.05 (a)Mean of the quarterly results.(b)Quarterly result/Annual result (c)TLD missing 5-33" 1998 REMP ANNUAL REPORT TABLE 5-6 (cont.)1998 MEAN QUARTERLY VERSUS ANNUAL TLD DATA Results in mR/day 1984-97 TLDs QUARTERLY ANNUAL STATION MEAN" MEAN RATIO"'998 TLDs QUARTERLY ANNUAL MEAN" RESULTS RATIO~'1 53 54 55 56 61<<65<<71 (IS)72 (2S)73 (3S)74 (4S)75 (SS)76 (6S)77 (7S)78 (8S)79 (9S)80 (IOS)81 (I IS)82 (12S)83 (13S)84 (14S)85 (15S)86 (16S)I 19B 119 Ctrl 120East 120 West 120Ctrl ALL 0.24 0.27 0.26 0.24 0.25 0.27 0.25 0.28 0.27 0.24 0.27 0.25 0.25 0.25 0.25 0.25 0.24 0.25 0.25 0.26" 0.25 0.27 0.28 0.26 0.26 0.28 0.28 0.25 0.25 0.23 0.26 0.25 0.23 0.24 0.26 0.24 0.27 0.26 0.23 0.25 0.24 0.24 0.24 0.23 0.23 0.23 0.23 0.24 0.25 0.24 0.25 0.27 0.28 0.28 0.30 0.33 0.29 0.24 1.06 1.05 1.05 1.06 1.05 1.06 1.04 1.05 1.04 1.07 1.06 1.06 1.05 1.06 1.05 1.07 1.06 1.06 1.04 1.05.1.06 1.05 1.04 0.93 0.95 0.93 0.86 0.86 1.04 0.23 0.28 0.27 0.23 0.25 0.24 0.24 0.24 0.23 0.24 0.23 0.23 0.25 0.24 0.25 0.25 0.27 0.25 0.24 0.25 (e)(c)0.24 0.22 0.25 0.25 0.22 0.24 0.22 0.22 0.22 0.22 0.22 0.23 0.22 0.22 0.23 0.23 0.24 0.26 0.22 0.23 0.23 (e)(e)0.22 1.04 1.11 1.10 1.05 1.05 1.08 1.11 1.09 1.07 1.09 1.00 1.09 1.15 1.08 1.13 1.05 1.04'.14 1.07 1.08 1.09 0.23 0.22 1.07 0.25 0.24 1.07 0.24 0.23 1.08 0.24 0.21 1.15 0.24 0.22 1.08 (a)Mean of the quarterly results.(b)Quarterly result/Annual result.(c)Station 61 was added in 1989 and discontinued in 1992.(d)Station 65 added in 1997.(e)Stations discontinued in 1997.1998 REMP ANNUAL REPORT 5-34 6.0 UALITY ASSURANCE AND UALITY CONTROL The REMP is designed to meet the quality assurance and quality control criteria of Regulatory Guide 4.15"'.To accomplish this, the REMP requires that its analytical contractors meet these criteria also.In<epth audits are performed of the REMP records and activities and the records and activities of its support organizations at least annually by the Supply System Quality Assurance group.Quality assurance and technical audits of the analytical contractor (Teledyne Brown Engineering) are also conducted periodically to verify their compliance to regulatory and contractual requirements. The adequacy of their quality assurance program is also assessed during the audits.Intercomparison programs, which involve the comparison of Supply System analytical melts of samples containing known concentrations of various radionuclides, to the known values and also with the icsults reported by other monitoring programs, are a major component of the quality assurance activities of the REMP.The program participates in the Environmental Protection Agency (EPA)and Environmental Measurements Laboratoiy (EML)inteicomparison programs.It also participates in local and regional intercomparison studies.The following sections summarize the quality assurance and quality control aspects of the TLD and analytical components of the REIMP.6.1 Quality Control For the Supply System Environmental TLD Program The Quality Control Program includes the pieparation, processing and evaluation of environmental TLDs.To begin with, all environmental TLDs, including controls, which are to be used in the same quarter (or year for annuals), are annealed at the same time.This allows for uniform accumulation of and cornxtion for background radiation. From the time the TLDs an: annealed to the time they are placed in the field, they are stool and transported together.Once the field TLDs are collected, they are again stored together with the controls until processed. Reader QC dosimeters aa: prepared by the TLD processor and serve as indicators that the invader calibration is satisfactory and that the TLDs were pmcessed correctly. These TLDs are annealed just prior to being given a known exposure (typically 100 mR)to'"Cs and processed among the field dosimeters. The number of QA dosimeters used during each pmcessing is generally 10%of the number of field dosimeters. If the mean icader QC dosimeter results vary by more than+5%from the given exposure, the processor is contacted and an investigation into the source of the disciepancy is initiated. Evaluation of the 1998 reader QC dosimeter results indicated satisfactory agnmment for all four quarters and the annual processing results.Control dosimeters (trip controls)are used for each set of field dosimeters to monitor the contribution of the exposure received by the field TLDs while in transit.The radiation background in the storage area is also monitor by a separate set of control dosimeters (building controls). If the trip control results are greater tlian the building control results, the difference between the two is subtracted fiom the field dosimeters. 6-1 1998 REMP ANNUAL REPORT Spiked dosimeters, which are exposed by the Supply System, are irradiated 25 mR cesium-137 for quarterly dosimeters or 85 mR for annual dosimeters. These spiked dosimeters aa: also processed with the field dosimeters during each run to verify the accuracy and consistency of the environmental TLD evaluations. All results were within,J5% of the known exposure and aie piovided in Table 6-1.Extra sets of control dosimeters, known as zero dose dosimeters, are also included with the field dosimeters for processing. These zero dose TLDs are stored in a shielded container throughout the quarter (or year for annuals)and are used as an additional indication of reader performance. These TLDs may also be used as substitutes if a field TLD is lost.6.2 Quality Control For the Analytical Program Quality control for the analytical program involves two components: the quality contml activities performed by the Supply System and the quality control program of the analytical contractor, Teledyne Brown Engineering. Both of these components are described in the following sections.6.2.1 Supply System Quality Control Activities The Supply System has participated in the U.S.Department of Energy's Environmental Measurements Laboratory (EML)Quality Assessment Program since 1987.In general, the Teledyne Brown icsults ayeed with the EML values as seen in Table 6-2.All results were either acceptable or acceptable with warning.Duplicate samples were submitted to Teledyne Brown for analysis during 1998.These duplicates consisted of two sets of milk samples and one set of air filters from EML.The milk duplicates were marked Station 37 and were submitted for analysis at the same time as the milk samples fiom Station 36.6.2.2 Teledyne Brown Engineering Quality Control Program The goal of the quality control program at Teledyne Brown Engineering -Envimnmental Services is to pioduce analytical icsults which are accurate, precise and supported by adequate documentation. The program is based on the requirements of 10CFR50, Appendix B, Nuclear Regulatory Guide 4.15 and the program, as described in Teledyne's Quality Assurance Manual (IWI 0032-395)and Quality Control Manual (IWL-0032-365). All measuring equipment is calibrated for efficiency at least annually using standi reference material traceable to the National Institute of Standards and Technology (NIST).For alpha and beta counting, check sources are prepared and counted each weekday the counter is in use.Control charts aic maintained with thine-sigma limits specified. Backgiounds are usually measured at least once per week."'998 REMP ANNUAL REPORT 6-2 The gamma spectrometers are calibrated annually with a NIST-traceable standard reference material selected to cover the energy range of the nuclides to be monitor for all of the geometries measured.Backgrounds are determined every other week and check sources are counted weekly.The energy resolution and efficiency an: plotted at two energy levels (59.5 and 1332 KeV)and held within three-sigma control limits."'he efficiency of the liquid scintillation counters is determined at least annuaHy by counting NIST traceable standards which have been diluted in a known amount of distilled water and various amounts of quenching agent."'he background of each counter is measured with each batch of samples.A control chart is maintained for the background and check source measurements as a stability check.Results are reviewed before being entered into the data system by the Quality Assurance and/or the Department Manager for reasonableness of the parameters (background, efficiency, decay, etc.).Any results that are suspect, being higher or lower than results in the past, are returned to the laboratory for recount.If a longer count, decay check, recount on another system or recalculation does not give acceptable icsults based on experience, a new aliquot is analyzed.The complete information about the sample is contained on the worksheets accompanying the sample results.Teledyne Brown also participates in the US EPA Interlaboratory Comparison Pa)gram to the fullest extent possible.That is, they participate in the program for all radioactive isotopes prepared and at the maximum&cquency of availability. Beginning with 1996, the US EPA discontinued providing milk and air particulate filter samples.Teledyne purchased comparable spiked samples from Analytics, Inc.Tables 6-3 and 6-4 present the Teledyne Brown quality control data icsults for blanks and spikes, respectively. Table 6-5 pments the results of the 1998 EPA Intercomparison as icported to the Supply System.Footnotes in the table refer to investigations of problems encountered in a few cases and the steps taken by Teledyne Brown to prevent esurience. Table 6-6 presents the Analytics Cross Check Comparison results for 1998.No deviations from written procedures occurred during 1998.A summary of the quality control blank and spiked sample results follow.Iodine-131 Cartridges A blank charcoal filter was analyzed with each group of samples assayed.Fifty-two blanks were analyzed in 1998.The average activity was-1.8 J 10.0 E-01 total pCi.Activities were calculated without considering detection limits.Gross-Beta -Filters One blank filter was measured with each set of filters assayed.Fifty-two blanks were counted for 1998.The average activity 1.0 J 0.2 E+00 total pCi, which indicated a relatively stable background for the filter and the gross beta proportional counters.6-3 1998 REMP ANNUAL REPORT I-131-Milk A blank milk was analyzed with each youp of samples assayed.The msults showed that there was no contamination in the laboratory or counting area.The measurements of the blank samples indicated that there was no bias on the low background counters.The average activity for eighteen samples in 1998 was-1.3 J 9.8 E-02 pCi/liter without considering detection limits.In addition ten blanks were analyzed as part of the Teledyne Brown Engineering -Environmental Services'uality control program.The average result for 1998 was 5.3+15 E-01 pCi/liter. Sr-90-Milk and Water Eleven blank water samples were analyzed during 1998.The average result, without considering the detection limits, was 1.2+1.9 E-01 pCi/liter. Eleven spiked water samples were analyzed during 1998, The average value of the samples was 3.4 J 0.4 E+01 pCi/1 compared with a spike level of 3.5 J 0.6 E+01 pCi/1.During 1998, a total of ten spiked milk samples were analyzed.The average value of the samples was 3.2+0.9 E+01 pCi/1 compared with a spike value of 3.5 J 0.6 E+01 pCi/l.These results were within the limits as specified by the EPA Intercomparison Studies Program.Ten blank milk samples were analyzed with an average activity of 6.6 J 2.9 E-01 pCi/1 of Sr-90, which is the natural content of milk.Gross Beta-Water Eleven blanks were prepared from distilled water.The average result without considering detection limits for 1998 was 1.3 J 3.7 E-01 pCi/1.Eleven gross beta samples with a spike level of 2.2+0.7 E+01 pCi/1 were analyzed during 1998.The average zesult was 2.1+0.3 E+01 pCi/1.The msults were well within the guidelines outlined in Table 2,of the document,"Environmental Radioactivity Laboratory Intercomparison Studies Program," EPA-600/4-81-004. Tritium in Water Thirteen blank samples were analyzed during 1998.The average result, without considering detection levels, was 1.0 J 6.9 E+01 pCi/I.Thirty:n tritium samples with a spike level of 1.7 J 0.5 E+03 pCi/1 were analyzed by liquid scintillation counting during 1998.The average result was 1.5+0.2 E+03 pCi/I.Gamma Spectroscopy A blank water sample was analyzed weekly in the garrrma spectroscopy laboratory. All nuclides were less than the normal level of detection indicating no contamination. Spike samples were measured weekly using the Cs-137 peak at 662 KcV.The average activity of eleven measurements during 1998 was 2.2+0.05 E+04 pCi/1 as comparLd with a spike level of 2.0+0.3 E+04 pCi/l.1998 REMP ANNUAL REPORT 6-4 TABLE 6-1 1998 ENVIRONMENTAL SPIKED DOSIMETER RESULTS DISTRIBUTION PERIOD GIVEN EXPOSURE mR REPORTED EXPOSURE mR BIAS First Quarter Second Quarter Third Quarter Fourth Quarter 24.0 25.0 25.0 25.0 85.0 23.1 23.2 23.4 24.3 25.1 24.5 23.8 24.5 24.4 25.1 24,2 24.0 80.6 80.4 80.1-3.8 303-2.5-2.8+4.0-2.0-4.8-2.0-2.4+0.2 303-4.1-5.2-5.4-5.8 6-5 1998 REMP ANNUAL REPORT TABLE 6-2 1998 ENVIRONMENTAL MEASUREMENTS LABORATORY (EML)QUALITY ASSESSMENT PROGRAM RESULTS SAMPLE REPORTED EML EML RATIO DATE TYPE" NUCLIDE RESULT ERROR VALUE ERROR REPORTED/EML 06/98 Air Mn-54 (Bq/filter) Co%0 Sb-125 Cs-137 Gr-p Ce-144 06/98 Soil K-40 (Bq/kg)Sr-90 Cs-137 5.81E+00 8.71E+00 1.28E+01 1.22E+01 2.11E+00 7.36E+00 3.89E+02 1.30E+01 3.92E+02 2.5E-01 3.3E%1 6.3E+1 3.3EAI 7.4E%2 5.7E<1 1.4E+01 2.2E+00 3.4E+00 SA4E+00 9.09E+00 1.22E+01 1.19E+01 1.96E+00 8.21E+00 3.14E+02 1.31E+01 3.30E+02 4.9E%1 7.3EZl 1.2E%1 9.6E%1 3.0E41 8.0EAl 1.0E+01 2.8EAl 9.3E+00 1.07 0.96 1.05 1.03 1.08 0.90 1.24 0.99 1.19 06/98 Vegetation K-40 8.38E+02 2.2E+01 7.07E+02 2.5E+01 1.18 (Bq/kg)Co-60 1.33E+01 1.2E+00 1.06E+01 2.1E%1 1.26 Cs-137 2.23E+02 3.0E+00 1.82E+02 7.1E+00 1.23 06/98 Water H-3 (Bq/l)Mn-54 Co-60 Cs-137 Gr-tx Gr-3.40E+02 5.61E+01 1.36E+01 4.72E+01 L40E+03 5.3E+01+i 4.8E+01 1.3E+00 8.0E%1 1.2E+00 1.1E+02 2.0E+00 2.18E+02 5.70E+01 1.36E+01 4.60E+01 1.42E+03 2.20E+03 6.5E+00 1.9E+00 1.2E+00 1.7E+00 1.0E+02 1.0E+02 1.56 0.98 1.00 1.03 0.99 0.02 Bq=becquerel; the EML results are reported in becquerel instead of picocuries. One picocurie equals 0.037 becquerel Supply System result was entered wrong on EML database.Result should have been 1.96E+03 Bq/l.1998 REMP ANNUAL REPORT 6-6 TABLE 6-3 1998 TELEDYNE BROWN QUALIIY CONTROL DATA-BLANKS NUCLIDE MEDIUM NUMBER AVERAGE RESULT UNITS I-131 Sr-90 H-3 Gross Beta Gamma Gross Beta I-131 Water Water Water Water AP Filter Charcoal 18()10(b)13(c)52 52(c)(4)52(a)(c)-1.3+9.8E-02 5.3 J 15E-01 1.2+1.9E-01 1.0+6.9E+01 1.3 J 3.7E-01 1.0 J 0.2E+00-1.8+10E-01 pCi/I pCi/1 pCi/1 pCi/1 pCi/1 pCi/I Total pCi Total pCi Footnotes: All nuclides less than minimum detection level a)This average is calculated from the Supply System quality control samples without considering detection limits.b)This is the natural content in milk.c)The in-house weekly quality control blanks for AP filters and charcoals are calculated in total pCi.d)This average includes only the blank AP filters analyzed for the Supply System.A blank planchette (counter background) and a blank filter are counted with each set of filters analyzed (approximately 10 sets per week).6-7 1998 REMP ANNUAL REPORT TABLE 6-4 1998 TELEDYNE BROWN QUAIZIY CONTROL DATA-SPIKES NUCLIDE MEDIUM NUMBER.AVERAGE RESULT SPIKE LEVEL Gross Beta H-3 Sr-90 Sr-90 Gamma'*~Water Water Water Milk Water 13 10 2.1 g 0.3E+01 1.5 g 0.2E+03 3.4 g 0.4E+01 3.2+0.9E+01 2.2+0.7E+01 1.7 g 0.5E+03 3.5+0.6E+01 3.5+0.6E+01 2.2+0.05E+04 2.0+0.3E+04 Footnotes: a)Measured Cs-137 peak at 662 KeV.1998 REMP ANNUAL REPORT 6-8 TABLE 6-5 1998 EPA INTERCOMPARISON PROGRAM RESULTS COLLECTION ISOTOPE DATE MEDIUM-WATER Ci/liter TI RESULTS<i EPA RESULTS+~OTHER LABS"~Sr-89 Sr-90 Sr-89 Sr-90 Sr-89 Sr-90 Sr-89 Sr-90 Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta Gr-Alpha Gr-Beta I-131 I-131 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 Ra-226 Ra-228 01/16/98 01/16/98 04/21/98 04/21/98 07/17/98 07/17/98 10/20/98 10/20/98 01/30/98 01/30/98 04/21/98 04/21/98 07/24/98 07/24/98 10/20/98 10/20/98 02/06/98 09/11/98 02/13/98 02/13/98 04/21/98 04/21/98 06/12/98 06/12/98 09/18/98 09/18/98 10/20/98 10/20/98 5.00 g 1.73 31.67+0.58 4.67 2 1.15 21.67+1.15 21.00+1.00 6.33 2 0.58 18.33+1.53 8.33+1.15 33.00 J 2.65 5.60 g 0.90 50.00+1.73 102.00+6.56 5.43 2 0.64 14.67+2.08 21.67+2.31 74.67 g 7.64 110.00+0.00 5.93+0.55 14.67 g 0.58 32.00+2.00 15.00+0.00 8.50 g 0.20 4.47 2 0.85 1.93 g 0.21 1.53 2 0.46 6.70 2 0.35 4.67 2 0.25 1.90 g 0.20 8.0 2 5.0 32.0+5.0 6.0 g 5.0 18.0 2 5.0 21.0+5.0 7.0 g 5.0 19.0 J 5.0 8.0 g 5.0 30.5 2 7.6 3.9 J 5.0 54.4 2 13.6 94.7 g 10.0 7.2+5.0 12.8 g 5.0 30.1+7.5 94.0 g 10.0 104.9+10.5 6.1+2.0 16.0+2.4 33.3 2 8.3 15.0 2 2.3 9.3+2.3 4.9 g 0.7 2.1+0.5 1.7 g 0.3 5.7 J 1.4 4.5 g 0.7 1.5+0.4 9.33 g 4.70 29.51 2 3.39 6.15 2 2.53 17.06+2.75 20.53 2 3.50 6.82 g 1.80 18.25+3.33 7.24 g 1.61 21.36 2 5.99 7 44+2.59 53.26+9.73 97.73 J 9.53 7.27 2 1.98 13.23 g 2.84 30.01+5.15 94.20+10.64t~105.74+5.43 6.70+1.17 16.05 g 1.67 31.89+5.93 14.57 2 1.70 9.50 2 1.61 4.70 g 0.70 2.62 g 0.64 1.82+0.29 5.76+0.82 4.53 2 0.98 1.92+0.51 H-3 03/13/98 1833.33 g 57.74 2155.0+348.0 2159.47 2 234.20 Co%0 Cs-134 Cs-137 Co-60 Zn-65 Cs-134 Cs-137 Ba-133 Co-60 Cs-134 Cs-137 Co-60 04/21/98 04/21/98 04/21/98 06/05/98 06/05/98 06/05/98 06/05/98 06/05/98 10/20/98 10/20/98 10/20/98 11/11/98 52.33 R 1.53 21.00 g 1.00 11.67 g 0.58 13.00 g 1.00 111.67 f 2.52 32.33 g 0.58 37.67 g 2.08 35.00 g 2.65 22.33 g 1.15 6.67 g 0.58 56.33 2 3.79 38.67+2.52 50.0 g 5.0 22.0 g 5.0 10.0 R 5.0 12.0+5.0 104.0 g 10.0 31.0+5.0 35.0+5.0 40.0 g 5.0 21.0+5.0 6.0 2 5.0 50.0 g 5.0 38.0 2 5.0 49.65 g 2.25 20.74+2.29 10.82 g 1.72 12.74+1.81 108.45 2 7.54 28.42+2.16 36.13+2.06 38.11+2.84 21.77 2 2.03 6 40+1.57 50.88 g 2.72t'~38.17+2.38 6-9 1998 REMP ANNUAL REPORT TABLE 6-5 (cont.)1998 EPA INIERCOMPARISON PROGRAM RESULTS ISOTOPE COLLECTION DATE Tr RESULTS<i EPA RESULTS+'THER LABS'n45 Cs-134 Cs-137 Ba-133 11/11/98 11/11/98 11/11/98 11/11/98 140.67 g 10.97 103.00+2.00 115.33+1.53 46.33 2 2.52 131.0 J 13.0 105.0+5.0 111.0+6.0 56.0 R 6.0 137.21 1 7.65 97.11 g 6.14 113.38+5.42 53.11 g 3.64 Footnotes: a)Teledyne Results-Average P one sigma.Units are pCi/incr for<<~icr aod inilk except K is in mg/liter.Units are total pCi for air particulate filters.b)EPA Results-Expected laboratory precision (I sigma i Unns are pCi'leer for<<ster and milk except K is in mg/liter.Units are total pCi for air particulate filters.C)Average concentration g one sigma, based on range of values coc>>uotcccd ln>m other labs.d)The special EPA instmctions concerning multiple csap>ration<<ith c>>o.cntratcd nitric acid (to purge)chlorides derived from HCl preservative were omitted by oversight. The chlondca cau>c greater>ct(aha>rption and lead to lower results.Two additional aliquots using tow evaporations with concentrated nitric acid<<crc analyzed The results, when corrected for decay of Sr-89, were 87 and 83 pCi/liter, which compare favorably with the EPA result e)An investigation is being conducted; result will hc~callable shortly, 1998 REMP ANNUAL REPORT 6-10 TABLE 6-6 1998 ANALYTICS, INC.CROSS CHECK COMPARISON PROGRAM SAMPLE ID MEDIA NUCLIDE TI RESULT o ANALYTICS RESULT RATIO"I E1346-396 TI¹71657 03/12/98 E1460-396 TI¹78921 06/11/98 E1630-396 TI¹94881 12/14/98 E1631-396 TI¹94882 12/14/98 E1632-396 TI¹94883 12/14/98 Milk Milk Milk Filter Water 1-131 Ce-141 Cr-51 Cs-134 Cs-137 Mn-54 Fe-59 Zn-65 Co-60 1-131 Ce-141 Cr-51 Cs-134 C@-137 Mn-54 Fe-59 Zn-65 Co-60 1-131 Ce-141 Cr-Sl Cs-134 Cs-137 Mn-54 Fe-59 Zn45 Co-60 Sr-89 Sr-90 Ce-141 Cr-Sl Cs-134 Cs-137 Mn-54 Fe-59 Zn 65 Co.60 H.3 87 g 9 66 g 7 220 g 30 85+9 180~20 130 J 10 110 J 10 160 J 20 82+8 68 g 7 94 J 9 97 J 31 101 g I-79~8 112~11 58 g 9 143+14 157 R 16 65 g I 647 2 65 900 g 90 200+20 177 J 18 136 g 14 156 J 16 132+14 169+17 20~2 16/1 566 2 57 800 g 80 147 g 15 158 g 16 122 g 12 134~13 129~13 134+13 5500~200 82 J 4 70 J 4 201 g 10 84+4 161 J 8 133 g 7 95 g 5 142 g 7 85 g 4 67 g 3 99 g 5 132+7 95 g 5 70+4 106 g 5 45+2 122 g 6 143+7 71 J 4 746 g 37 979 J 49 220 g ll 183 g 9 142 J 7 148 2 7 140 J 7 178 g 9 69+3 41 J2 524 2 26 687 g 49 154 J 8 128+6 100 J 5 104 g 5 98 g 5 125 g 6 5980 2 299 1.06 0.94 1.09 1.01 1.12 0.98 1.16 1.13 0.96 1.01 0.95 0.73 1.06 1.13 1.06 1.29 1.17 1.10 0.92 0.87 0.92 0.91 0.97 0.96 1.05 0.94 0.95 0.29" 0.39"'.08 1.16 0.95 1.23 1.22 1.29 1.32 1.07 1.08 E1633-396 Tl¹94884 12/14/98 Water Am 241 Pu.239 8.3+1.5 9.8 g 1.8 7.9 g 0.4 8.9+0.4 1.05 1.10 6-11 1998 REMP ANNUAL REPORT TABLE 6-6(cont.) 1998 ANALYTlCS, INC.CROSS CHECK COMPARISON PROGRAM Footnotes: a)Teledyne Results-counting error is two standard deviations. Units are pCi/liter for water and milk.For gamma icsults, if two standard deviations are less than 10%, then a 10%error is reported.Units are total pCi for air particulate filters.b)Ratio of Teledyne Brown Engineering to Analytics results.Acceptance criteria are based on USNRC acceptance criteria described in USNRC Procedure 84750 dated March 15, 1994.c)Investigation in progress.1998 REMP ANNUAL REPORT 6-12

7.0 REFERENCES

1.U.S.Nuclear Regulatory Commission,"Programs For Monitoring Radioactivity in the Environs of Nuclear Power Plants," Regulatory Guide 4.1, Revision 1, April 1975.2.U.S.Nuclear Regulatory Commission,"Environmental Technical Specifications For Nuclear Power Plants," Regulatory Guide 4.8, December 1975.3.U.S.Nuclear Regulatory Commission,"An Acceptable Radiological Environmental Monitoring Program," Assessment Branch Technical Position Revision 1, November 1979.4.U.S.Nuclear Regulatory Commission,"Quality Assurance For Radiological Environmental Monitoring Program (Normal Operations), Effluent Streams and the Environment," Regulatory Guide 4.15, Revision 1, February 1979.5.U.S.Nuclear Regulatory Commission,"Performance, Testing and Procedural Specifications For Thermoluminescence Dosimetry-Environmental Applications," Regulatory Guide 4.13, Revision 1, July 1977.6.Energy Facility Site Evaluation Council, Resolution No.260, January 1992.7.Washington Public Power Supply System Nuclear Plant No.2, Operating License NSF-21, Technical S ecificati n Section 5.5.1, 5.5.4, and 5.6.2 8.WNP-2 Offsite Dose Calculation Manual (ODCM).9.Code of Federal Regulations, Title 10 Part 20,"Standards For Protection Against Radiation." 10.Code of Federal Regulations, Title 10 Part 50,"Domestic Licensing of Production and Utilization Facilities." 11.Washington Administrative Code 246-290,"Group A Public Water Systems." 12.Washington Administrative Code 173-200,"Water Quality Standards for Ground Water of the State of Washington." 13.Washington Administrative Code 173-201A,"Water Quality Standards for Surface Waters of the State of Washington." 14.Robertson, D.E., and J.J.Fix,"Association of Hanford Origin Radionuclides With Columbia River Sediment", BNWL-2305, August 1977.15.Energy Facility Site Evaluation Council, Resolution No.259, amended November 1994.N 16.Energy Facility Site Evaluation Council, Resolution No.278, approved May 8, 1995.7-1 1998 REMP ANNUAL REPORT 17.Teledyne Brown Engineering -Environmental Services PRO-032-27,"Calibration and Control of Alpha/Beta Counters," 18.Teledyne Brown Engineering -Environmental Services PRO-042-44,"Calibration and Control of Gamma Ray Spectrometers." 19.Teledyne Brown Engineering -Environmental Services PRO-052-35,"Determination of Tritium by Liquid Scintillation." 1998 REMP ANNUAL REPORT 7-2 8.0 1 M2VIP MH'ORT 7<&RATA Corrections to errors found in the 1997 Radiological Environmental Monitoring Program Annual Report are listed below.Pa e 4-14 Table 4-2: Two stations in north sector have wrong distance.Station 47 and Station 57 should both be 0.9 miles and 1448 meters.Pa e 4-15 Table 4-2: Station 65 in the south sector should read 8.7 miles and 13999 meters estimated distance.Pa e 5-14 Table 5-1: Mean cesium-137 result in annual soil, previous operational should read 235.3 pCi/kg.Pa e 5-16 Table 5-1: Mean cesium-137 result in river sediment, previous operational should read 317.8 pCi/kg.8-1 1998 REMP ANNUAL REPORT I I WASHINGTON PUBLIC POWBR 4N SUPPLY SYSTEM WASHINGTON PUBLIC POWER SUPPLY SYSTEM NUCLEAR PLANT 2 1998 DATA TABLES TABLES A and B JANUARY 1 to DECEMBER 31, 1998 RADIOLOGICAL %PA~ON V0~2TTAL MONITORING PROGRAM Prepared by J.E.McDonald and L.S.Schleder Washington Public Power Supply System Richland, WA and C.A.Mendola Teledyne Brown Engineering Environmental Services Westwood, NJ S I~g i 5 I 1 S DATA TABLES TABLE A'OVIINE RESULTS TABLE B: SPECIAL IÃZEREST SAMPLE RESULTS TABLE A'OUTINE RESULTS A-1.1 1998 Quarterly TLD Results A-1.2 1998 Annual TLD Results A-1.3 1998 TLD Results-Summary A-2.1 Gross Beta On Air Particulate Filters A-2.2 Gross Beta On Air Particulate Filters-Summary A-3.1 Gamma Spectrometry of Particulate Filters A-3.2 Gamma Spectrometry of Particulate Filters-Summary A-4.1 I-131 in Charcoal Cartridges A-4.2 A-5.1 A-5.2 A-6.1 I-131 in Charcoal Cartridges -Summary Gross Beta in Water Gross Beta in Water-Summary Tritium in Water A-6.2 Tritium in Water-Summary A-7.1 A-7.2 A-8.1 A-8.2 A-9.1 A-9.2 A-10.1 A-10.2 A-11.1 A-11.2 A-12.1 A-12.2 Gamma Spectrometry of Water Gamma Spectrometry of Water-Summary Gamma Spectrometry of Soil Gamma Spectrometry of Soil-Summary Gamma Spectrometry of Sediment Gamma Spectrometry of Sediment-Summary Gamma Spectrometry of Fish Gamma Spectrometry of Fish-Summary I-131 in Milk I-131 in Milk-Summary Gamma Spectrometry of Milk Gamma Spectrometry of Milk-Summary I 5 1 8 DATA TABLES A-13.1 Gamma Spectrometry of Broadleaf in Lieu of Milk A-13.2 Gamma Spectrometry of Broadleaf in Lieu of Milk-Summary A-14.1 Gamma Spectrometry of Roots A-14.2 Gamma Spectrometry of Roots-Summary A-15.1 Gamma Spectrometry of Fruit A-15.2 Gamma Spectrometry of Fruit-Summary A-16.1 Gamma Spectrometry of Vegetables A-16.2 Gamma Spectrometry of Vegetables -Summary

1998 DATA TABL TABLE B: SPECIAL INTEREST SAMPLE RESULTS B-2.1 Gamma Spectrometry of Storm Drain Water B-2.2 Gamma Spectrometry of Storm Drain Water-Summary B-3.1 Gross Beta in Storm Drain Water B-3.2 Gross Beta in Storm Drain Water-Summary B-4.1 Tritium in Storm Drain Water B-4.2 Tritium in Storm Drain Water-Summary B-5.1 Gamma Spectrometry of Storm Drain Sediment B-5.2 Gamma Spectrometry of Storm Drain Sediment-Summary B-6.1 B-6.2 B-7.1 B-7.2 B-8.1 B-8.2 B-9.1 B-9.2 B-10.1 B-10.2 B-11.1 B-11.2'-12.1 B-12.2 B-13.1 B-13.2 Gamma Spectrometry of Storm Drain Soil Gamma Spectrometry of Storm Drain Soil-Summary Gamma Spectrometry of Storm Drain Vegetation Gamma Spectrometry of Storm Drain Vegetation -Summary Gross Alpha in Sanitary Waste Treatment Water Gross Alpha in Sanitary Waste Treatment Water-Summary Gross Beta in Sanitary Waste Treatment Water Gross Beta in Sanitary Waste Treatment Water-Summary Gamma Spectrometry of Sanitary Waste Treatment Water Gamma Spectrometry of Sanitary Waste Treatment Water-Summary Tritium in Sanitary Waste Treatment Water Tritium in Sanitary Waste Treatment Water-Summary Gamma Spectrometry of Sanitary Waste Treatment Sediment Gamma Spectrometry of Sanitary Waste Treatment Sediment-Summary Gamma Spectrometry of Station 118 Soil Gamma Spectrometry of Station 118 Soil-Summary I LOCATION 19 8 TABLE A-1.1 UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.239 0.249 0.239 0.260 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.236 0.234 0.241 0.243 0.233 0.229 0.230 0.240 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/9&03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.204 0.218 0.202 0.218 0.215 0.217 0.205 0.223 0.223 0.222 0.217 0.230 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.253 0.231 0.242 0.239'.216 0.259 0.253 0.265 LOCATION 10 8 TABLE A-1.1 (cont.)UARTKRLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.234 0.213 0.211 0.217 0.239 0.236 0.226 0.237 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.229 0.235 0.233 0.238 12 13 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.248 0.256 0.248 0.266 0.238 0.240 0.234 0.246 14 15 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.234 0.235 0.229 0.240 0.250 0.253 0.250 0.263 16 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.238 0.242 0.243 0.243 LOCATION 17 1 98 TABLE A-l.1 (cont.)UARTKRLY TLD R ULT Results in mR/Day COLLECTION PEMOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.245 0.256 0.251 0.259 18 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98.to 12/31/98 0.239 0.256 0.239 0.245 19 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.243 0.250 0.250 0.260 20 21 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.246 0.239 0.246 0.255 0.226 0.229 0.225 0.232 22 23 24 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/3 l/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.233 0.240 0.237 0.246 0.235 0.235 0.230 0.237 0.229 0.254 0.231 0.257 LOCATION 25 1 98 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98'6/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.243 0.254 0.247 0.251 40 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.210 0.221 0.212 0.225 41 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.245 0.252 0.236 0.250 42 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.240 0.243 0.247 0.241 43 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 (a)0.238 0.240 0.236 45 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.225 0.235 0.222 0.244 0.229 0.230 0.242 0.236 46 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.272 0.306 0.300 0.311 (a)TLD missing LOCATION 47 49 50 1 8 TABLE A-l.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.218 0.219 0.211 0.227 0.239 0.219 0.233 0.251 0.230 0.240 0.226 0.264 51 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.225 0.233 0.226 0.244 53 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.247 0.253 0.245 0.272 54 55 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.232 0.253 0.235 0.253 0.244 0.240 0.235 0.246 56 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.237 0.234 0.234 0.259 LOCATION 65 19 8 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.222 0.234 0.217 0.238 71 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.286 0.254 0.283 0.305 72 73 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.272 0.258 0.273 0.286 0.234 0.228 0.228 0.241 74 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.249 0.250 0.253 0.267 75 12/30/97 to 03/27/98 , 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.239 0.235 0.238 0.251 76 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.250 0.231 0.244 0.248 77 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.238 0,230 0.241 0.252 LOCATION 1998 TABLE A-1.1 (cont.)UARTERLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.229 0.238 0.229 0.243 79 80 81-'12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.231 0.244 0.242 0.249 0.226 0.231 0.224 0.239 0.225 0.238 0.228 0.245 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.241 0.251 0.241 0.258 83 84 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.239 0.242 0.244 0.249 0;244 0.253 0.242 0.274 85 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.243 0.249 0.258 0.262 LOCATION TABLE A-1.1 (cont.)1 98 UARTKRLY TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 RESULT 0.277 0.254 0.274 0.293 119 119-Control 120 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 12/30/97 to 03/27/98 03/27/98 to 06/25/98 06/25/98 to 09/29/98 09/29/98 to 12/31/98 0.242 0.250 0.238 0.266 0.249 0.234 0.242 0.250 0.254 0.248 0.241 0.261 LOCATION 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 40 41 42 43 45 46 47 TABLE A-1.2 1998 A5INUAL TLD RESULTS Results in mtuDay COLLECTION PERIOD 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/3 l/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 RESULT 0.220 0.217 0.213 0.194 0.194 0.200 0.210 0.240 0.203 0.218 0.220 0.242 0.223 0.215 0.233 0.225 0.225 0.238 0.242 0.233 0.202 0.229 0.209 0.217 0.223 0.197 0.223 0.220 0.195 0.200 0.217 0.283 0.209 LOCATION 49 50 51 53 54 55 56 65 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 119 119-Control 120 TABLE A-1.2 (cont.)1998 ANNUAL TLD RESULTS Results in mR/Day COLLECTION PERIOD 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12'/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 12/30/97 to 12/31/98 RESULT 0.221 0.228 0.216 0.237 0.226 0.210-0.223 0.219 0.254 0.248 0.222 0.242 0.223 0.220 0.220 0.220 0.222 0.231 0.215 0.216 0.226 0.225 0.241 0.263 0.219 0.227 0.232 TABLE A-1.3 19 S TLD R ULTS-

SUMMARY

Results in mR/Day NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER=SAMPLES POSITIVE UARTERLY TLD RESULTS TLD (I)TLD (C)0.242 0.219 0.202 0.211 0.311 0.234 235 4 235 TLD (I)TLD (C)0.223 0.203 ANNUAL TLD RESULTS 0.194 0.283 0.203 0.203 59 1 59 1 I R BETA TABLE A-2.1 AIR P RTI LATE FII TER LOCATION COLLECTION PERIOD Results in pCi/cubic meter RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-0 1/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (a)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/9S-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/9S 07/27/9iS-08/03/9iS 08/03/98-08/10/98 08/10/98-08/ l 7/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/9S 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/9iS-09/28/9S 1.3 1.4 2.2 4.7 9.2 1.8 5.6 6.7 7.7 1.1 8.9 1.5 4 9 7.8 6.9 1.2 1.0 7.7 1.1 4.6 1.1 6.2 1.0 7.4 6.5 5.0 9.0 1.1 9.8 1.1 1.4 1.3 6.0 1.1 1.8 2.1 l.3 1.7 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-02 E-02 E-03 E-02 E-02.E-02 E-02 E-02 E-02 2P 2Q 2.0 1.7 2.1 2.0 1.7 2 1.9 2.0 2 P 2.0 1.7 2.0 2.0 2.0 2.0 1.9 2.0 1.8 4.0 25 2Q 1.8 1.7 1.7 2 Q 2Q 1.8 2.0 2P 2P 1.8 2 P 2.0 2P 2 P 2P 2P E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume duc to poivcr outage.Not included in averages. TABLE A-2.1 (Cont.)AIR P RTI I TE kILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.5 E-02 1.0 E-02 8.4 E-03 3.5 E-02 1.4 E-02 1.9 E-02 1.6 E-02 5.5 E-03 8.9 E-03 7.3 E-03 1.4 E-02 1.4 E-02 2.5 E-02 2.0 E-03 2.0 E-03 2.1 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.6 E-03 2.1 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)rR 8 BETA AIR PARTI UI YE FIL ERS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 (3)07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.3 1.6 1.9 5.7 1.0 1.8 5.5 6.4 9.8 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 9.9 1.4 7.0 7.8 6.1 1.2 1.6 2.5 1.1 5.1 8.3 5.0 1.2 7.3 6.9 4 3 1.2 1.2 2 1.9 1.5 1.0 1.5 2 P 2.2 1.4 1.4 1.5 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 6.7 E-03 2.0 2P 2.0 1.8 2.0 2.0 1.7 2.1 2 Q 1.8 2 Q 2 Q 1.8 2 P 2 P 2 P 2 Q 3.0 2 Q 1.8 1.6 1.9 2Q 1.8 1.7 1.7 2 P 2 P 2 P 4.0 2 P 2.0 2 P 2 P 2 P 2 P 2.0 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 , E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Unit failure;low sample volume. TABLE A-2.1 (Cont.)R BET N AIR PARTI Results in pCi/cubic meter TF FII TER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-1 1/02/98 11/02/98-11/09/98 11/09/98-11/16/98 (a)11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.7 E-02 1.3 E-02 9.0 E-03 4.3 E-02 1.5 E-02 2.0 E-02 1.2 E-02 7.3 E-03 8.2 E-03 8.1 E-03 1.4 E-02 1.6 E-02 2.7 E-02 2.0 E-03 2.0 E-03 2.1 E-03 3.0 E-03 2.0 E-03 2.0 E-03 4.0 E-03 1.7 E-03 2.0 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (a)Power off at unit. TABLE A-2.1 (Cont.)vR S BET N AIR PARTI I TE FII TER Results in pCi/cubic meter LOCATION COLLECTION-PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98;09/21/98 09/21/98-09/28/98 1.0 1.6 1.9 3.1 1.1 1.5 4.5 5.0 7.0 1.2 7.2 1.3 6.1 7.6 5.7 1.1 1.3 2.3 1.2 4.7 9.1 3.4 8.5 7.8 8.0 7.2 14 1.4 1.2 1.5 1.6 1.5 1.0 l.l l.7 2.1 1.4 1.3 1.7 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 2 Q 2.0 2.0 1.6 2.0 2.0 1.8 2.0 1.8 2.0 1.9 2Q 1.8 1.9 1.9 2.0 2.0 3.0 2Q 1.8 1.6 1.8 1.9 1.8 1.8 1.8 2.0 2.0 2.0 2 P 2Q 2Q 2.0 2.0 2Q 2 P 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)R 8 BETA N AIR AR I LATE lII.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.9 E-03 6.8 E-03 3.5 E-02 1.3 E-02 1.8 E-02 1.1 E-02 5.4 E-03 6.9 E-03 5.1 E-03 1.2 E-02 1.2 E-02 2.5 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.6 E-03 2.0 E-03 1.6 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)vR BFTA'IR PARTI Results in pCi/cubic meter ATE FILTFR LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/) 2/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 (a)02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/1 5/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/9iS-07/27/98 07/27/9S-OS/03/98 08/03/98-08/10/9iS 08/l 0/9S-OS/17/98 08/17/9iS-08/24/98 08/24/98-08/31/98 08/31/9S-09/08/98 09/08/9S-09/l 4/98 09/14/98-09/21/98 09/2 l/9iS-09/28/9S 1.1 1.3 1.7 6.2 1.2).8 1 7 7.7 9.0 7.5 1.6 6.0 6.3 3.9 9.7 1.3'7'7 1.0 4.5 8.3 3.8 1.4 8.3 7.8 5.8 1.2 1.3 l.2 l.4 l.7 1.4 8 o I.1 1.9 2.2 1.4 1.2 1.5 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E Q2 E-02 E-02 E-02 E-02 E-03 E-02 E 02 E-02 E-02 E-02 E-02 2.0 2.0 2.0 1.8 2.0 2.0 1.4 1.9 1.9 1.9 1.9 2.0 1.8 1.9 1.8 1.9 2.0 3.0 2.0 1.8 1.6 1.9 2Q 1.8 1.8 1.8 2.0 2Q 2Q 2.0 2.0 2.0).9 2.0 2.0 2.0 2.0 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Filter light in disposition. Denotes a result less than thc detection limit. TABLE A-2.1 (Cont.)R 8<TA N RP Results in pCi/cubic meter E FlI.TER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.5 E-02 8.8 E-03 6.6 E-03 4.2 E-02 1.5 E-02 2.2 E-02 1.3 E-02 6.2 E-03 1.0 E-02 9.1 E-03 1.9 E-02 1.4 E-02 3.1 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.9 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)R BETA N AIR PARTI LATF F LTHR Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-0 1/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 (a)05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/9S 08/10/98-08/17/98 08/17/98-OS/24/98 08/24/98-08/3 I/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 1.3 1.8 E-02 E-02 E-02 1.4 4.7 49 8.2 1.0 7.5 1.4 4.8 5.6 5.5 1.2 1.1 2.7 1.0 5.3 8.5 5.4 I 2 9 2 5.6 4.6 9.5 9.8 I.I 1.0 I.5 1.1 9.5 1.0 l.4 2 P 1.2 I.p l.2 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 , E-03 E-02 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 4.1 E-03 1.1 E-02 2.0 2.0 2.0 1.7 2.0 2 P 1.6 2.0 1.9 2.0 1.9 2.0 1.7 1.8 1.9 2.0 2.0 4.0 2.0 1.8 1.6 2.0 2 Q 1.9 1.6 1.7 2P 2.0 2 P 2.0 2.0 2Q 2 P 2 P 2Q 2 Q 2 Q 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume due to unit failure. TABLE A-2.1 (Cont.)vR BETA N AIR PARTI LATE F<II TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-1 1/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.2 E-03 5.3 E-03 3.2 E-02 1.2 E-02 1.9 E-02 1.1 E-02 6.2 E-03 8.1 E-03 4.2 E-03 1.1 E-02 1.2 E-02 2.1 E-02 2.0 E-03 1.8 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.6 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)HFTA AIR P RTI L'FII R Results in pCi/cubic meter , LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY '8 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/1 7/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/1 6/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-OS/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/1 3/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/]0/98-08/17/98 08/17/98-08/24/98 08/24/98-08/3]/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 1.4 1.8 4.0 7.0 1.5 3.7 5 2 7.0 9.8 8.3 1.4 4.9 6.0 4.9 1.1 1.1 2 P 8.6 3.1 7.6 29 1.1 7.0 7.7 3.1 9.]8.5 9.8 1.2 8.5 1.1 6.7 1.2 1.9 2.1]4 1.5 1.4 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03, E-03*E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2 Q 2.0 1.7 2.0 2 P 1.6 2.0 1.8 2.0 2P 2.0 1.7 1.9 1.9 2 P 2.0 3.0 1.9 1.7 1.5 1.8 2.0 1.8 1.8 1.6 2.0 1.9 1.8 2 P 1.8 2 Q 1.8 2.0 2.0 2.0 2 P 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)vR BETA N AIR P RTI I E FILTER Results in pCi/cubic meter., LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.3 E-02 1.1 E-02 5.9 E-03 3.9 E-02 1.4 E-02 1.9 E-02 1.5 E-02 7.2 E-03 7.6 E-03 7.0 E-03 1.2 E-02 1.2 E-02 2.9 E-02 2.0 E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)S BEMATA AIR PARTI I.ATE FIIT<R Results in pCi/cubic meter LOCATION M COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-'05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/9S-07/13/98 07/l 3/98-07/20/98 07/20/98-07/27/98 07/27/9S-08/03/98 08/03/')S-QS/10/98 OS/l 0/98-08/17/98 08/l 7/')8-08/24/<) 8 08/24/98-08/3 l/98 08/51/94-09/()8/9S 09/QS/98-09/l a/98 09/l 4/98-09/2 l/98 09/2 l/98-09/28/98 9.1 1.4 1.8 2.7 8.3 1.7 3.6 3.8 8.5 8.7 1.0 1.6 4.3 7.0 3.6 1 2 1.3 2 Q 1.3 4.7 7.9 3.5 9.3 7.2 7.6 4.5 1.1 1.2 94 1.4 1.7 1.1 9.0 1.2 1.6 1.6 1.3 1.3 1.4 E-03 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2 P 2Q 1.6 2.1 2 P 1.6 1.9 1.9 1.9 2 P 2 P 1.7 1.9 1.8 2.0 2Q 2.0 2.0 1.8 1.6 1.8 2.0 1.8 1.7 1.7 2 P 2.0 1.8 2.0 2.0 2 P 2.0 2 P 2P 2 Q 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 LOCATION TABLE A-2.1 (Cont.)R BETA'IR P RTI Results in pCi/cubic meter COLLECTION PERIOD TE I ILTFR RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.2 E-02 7.4 E-03 6.0 E-03 , 2.9 E-02 1.1 E-02 1.7 E-02 1.0 E-02 7.1 E-03 4.7 E-03 3.7 E-03 6.0 E-02 1.2 E-02 1.9 E-02 2.0 E-03 1.8 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 1.9 E-03 1.5 E-03 1.7 E-03 2.0 E-03 2.0 E-03 TABLE A-2.1 (Cont.)8 8<TA N AIR PA.RTIC I AT<.FILT<R Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 Ol/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 , 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-OS/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/9S-OS/31/98 08/31/98-09/OS/98 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/98-09/28/98 1.1 1.0 1.9 3.4 1.7 42 5.6 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 1.5 4.7 4.5 9.7 1.0 2.2 9.6 8.8 3.9 9.0 8.2 5.9 4.6 9.9 7.3 8.9 1.1 1.5 9.7 7.1 9.3 1.6 1.7 9.8 1.1 1.3 E-02 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-03 E-02 E-02 6.8 E-03 1.0 E-02 9.2, E-03 2Q 2 P 2.0 1.6 2.1 2.0 1.6 2 1.8 2Q 2.0 2 P 1.7 1.9 1~9 1.9 2Q 3.0 1.9 1.7 1.6 1.9 2.0 1.8 1.6 1.7 2 1.8 1.8 2 P 2.0 2P 1.9 2 P 2.0 2 P 2.1 2.0 2 Q E-03 E-03, E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)vR BETA N AIR P RTI LAT i FILTER Results in pCi/cubic meter LOCATION COLLECTION 'PERIOD RESULT OVERALL UNCERTAINTY 21 09/28/98-10/05/98 (a)10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6.E-02 1.2 E-02 5.7 E-03 4.0 E-02 1.5 E-02 2.1 E-02 1.4 E-02 8.0 E-03 7.9 E-03 6.0 E-03 1.3 E-02 1.4 E-02 2.8 E-02 2.0 E-03 2.0 E-03 1.9 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.8 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (n)Power off due to maintenance work. TABLE A-2.1 (Cont.)BETA N AIR PARTI I ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 23 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.1 , 1.4 2.2 4.7 8.9 1.8 3.2 49 6.9 1~2 8.8 1.4 6.6 6.3 4.9 1.3 1.2 2.2 2 4.5 92 3.9 1.1 7.9 6.7 4.8 1.0 1.3 2 1.4 1.6 1.3 8 2 9.S 1.8 2.2 1.5 1.3 1.3 E-02 E-02 E-02 E-03, E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-03 E-03 E-02 E-02 E-02 E-02 E-02 2 Q 2 P 2P 1.7 2.1 2.0 1.5 2.0 1.8 2.0 2.0 2.0 1.8 1.9 1.9 2 P 2.0 3.0 2.0 1.8 1.6 1.9 2 Q 1.8 1.7 1.7 2 P E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 2.0 2 P 2.0 2.0 1.9 2 Q 2.0 2P 2 P 2.0 2 Q E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 2.0, E-03 R BI<'.T TABLE A-2.1 (Cont.)AIR ARTI LATE I<'I<R Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 23 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.4 E-02 8.8 E-03 4.5 E-03 3.6 E-02 1.4 E-02 2.0 E-02 1.4 E-02 6.1 E-03 6.9 E-03 6.1 E-03 1.4 E-02 1.1 E-02 3.0 E-02 2.0 E-03 1.9 E-03 1.9 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 vR TABLE A-2.1 (Cont.)BETA AIR PARTI LATE FII TER Results in pCi/cubic meter LOCATION COLLECTION FERIOD RESULT OVERALL UNCERTAINTY 40 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/9S 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/9S 07/27/9S-OS/03/9S 08/03/9$-08/l 0/9S 08/l 0/9S-OS/l 7/9$0$/l 7/9$-0S/24/9$08/24/94-OS/~ l/t)ll 08/31/9$-09/0$/t)8 09/0$/9$-09/l 4/t)8 09/I 4/9$-09/2 l/9$09/2 l/9$-09/2$/9$1.1 1.3 1.9 3.8 8.7 1.6 5.3 5.3 6.8 1.1 8.8 1.4 7.1 7.8 5.2 1.1 1.1 2 Q 1.2 3.4 7.6 3.7 1.1 7.5 6.9 3.6 8.7 1.1 8.0 9.5 1.4 9.7 6.6 1.3 1.9 2.1 1.6 1.5 1.6 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-02 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2P 2Q 2.0 1.7 2.1 2P 1.7 2 Q 1.8 2 P 2.0 2 P 1.8 1.9 1.9 2.0 2.0 3.0 2.0 1.7 1.5 1.9 2 P 1.8 1.7 1.6 2.0 2 P 1.7 1.9 2 P 2.0 1.8 2.0 2.0 2P 2 P 2 P 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 TABLE A-2.1 (Cont.)R 8 HFT N AIR P RTI UIATE FI TiR Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 40 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6 E-02 9.4 E-03 7.5 E-03 3.7 E-02 1.2 E-02 2.0 E-02 1.1 E-02 7.2 E-03 7.5 E-03 6.2 E-03 1.3 E-02 1.4 E-02 2.8 E-02 2.0 E-03 1.9 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.1 (Cont.)BETA N AIR PARTI LATF.FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (a)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/9S-07/27/98 07/27/98-08/03/98 08/03/98-OS/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/9S-09/08/98 09/08/98-09/14/98 09/14/9S-09/21/98 09/21/98-09/28/98 1 2 1.5 2.2 5.2 1.1 1.8 5.1 5.8 8.9 1.0'1.0'.8 5.4 7.6 5.1 1.2 1.3 2.2 1.1 6.0 5 4 4.7 8.8 6.7 6.2 4.6 8.3 1.4 1.1 1.3 1.9 1.3 8.3 2 1.8 1.9 1.4 1.2 1.6 E-02 E-02 E-02 E-03 E-02 E-02, E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-03 E-02 E-02 E-02 E-02 E-02 E-02 2 P 2P 2.0 1.7 2.0 2.0 1.6 2.1 1.9 2.0 2.0 2.0 1.8 1.9 1.9 2 Q 2.0 3.0 2.0 1.9 8.0 2.2 1.9 1.7 1.7 1.7 2Q 2Q 2.0 2.0 2.0 2 P 1.9 2.0 2.0 2.0 2.0 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume due to unit failure.Denotes a result less than thc detection limit.Low sample volume due to unit failure. TABLE A-2.1 (Cont.)R BETA IR P RTI LATE<<II ER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 48 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-1 1/09/98 (a)11/09/98-1 1/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.6 E-02 1.1 E-02 7.1 E-03 3.9 E-02 1.4 E-02 2.3 E-02 1.2 E-02 6.0 E-03 7.5 E-03 5.9 E-03 1.5 E-02 1.4 E-02 2.7 E-02 2.0 E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 9.0 E-03 2.0 E-03 1.7 E-03 2.0 E-03 1.7 E-03 2.0 E-03 2.0 E-03 3.0 E-03 (a)Power off;low sample volume.Not included in averages.~ vR TABLE A-2.1 (Cont.)BFT W AIR PARTI ATF.FILTL<R Results in pCi/cubic mctcr LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 57 12/29/97-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 (8)05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 1.4 1.6 2.3 5.8 1.0 1.7 5.2 5.7 6.2 E-02 E-02 E-02 E-03 E-02 E-02 E-03 E-03 E-03 8.3 1.5 6.7 6.7 5 2 1.2 1.2 2.4 1.2 x 2 8 9.7 5.0 I 2 8.7 8.6 6.6 1.2 1.4 I.I 1.4 1.9 1.5 1.0 I.I 1.9 2.1 I.4 1.5 1.4 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 E-02 1.1'E-02 2Q 2 P 2.0 1.8 2.0 2.0 1.6 2.1 1.8 2 P 2 Q 2.0 1.8 1.9 1.9 2Q 2 Q 3.0 2 P 2.6 1.6 1.9 2P 1.8 1.8 1.8 2 P 2 P 2.0 2.0 2 P 2P 2 P 2 P 2.0 2 P 2 Q 2.0 2.0 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume.Denotes a result less than the detection limit.Low sample volume. TABLE A-2.1 (Cont.)ROSS BETA N AIR PARTICUI ATI".I'II.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 57 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 1.3 E-02 1.1 E-02 6.9 E-03 4.0 E-02 1.5 E-02 2.1 E-02 1.4 E-02 8.1 E-03 7.8 E-03 7.4 E-03 1.3 E-02 1.3 E-02 2.5 E-02 2.0'E-03 2.0 E-03 2.0 E-03 3.0 E-03 2.0 E-03 2.0 E-03 2.0 E-03 1.8 E-03 2.0 E-03 1.8 E-03 2.0 E-03 2.0 E-03 3.0 E-03 TABLE A-2.2'RO S BETA ON'AIR PARTI I.ATE FII.TERS-8 MMARY Results in pCi/cubic mctcr NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Gr-Beta (I)Gr-Beta (C)1.17E-02 1.06E-02 1.7E-03 2.7E-03 4.3E-02 29E 02 572 52 569 52 L (I)Indicator Stations (C)Control Station TABLE A-3.1 AMMA PE TR METRY F PARTI Results in pCi/cubic meter LATF.FILTER LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.12"-1.22"'.21<292"-2.52": 193"'-1.17" 5.03 9.17~5.97":-1 59"'.94 x-1 71 x 2P9"-8.44" 3.73 E-02 E-03 E-04 E-04 E-04 E-04 E-03 E-04 E-02 E-04 E-04 E-04 E-04 E-05 E-04 E-05 7.89 3.00 5.61 2.09 2.30 2.30 3.92 3.61 1.04 2.79 7.50 1.96 2.03 1.93 3.53 3.27 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 06/29/98-09/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 1.62": 1.19"':-4.30 E-pl E-03 E-04": 8.53" 1.07%-2.35"505 E-05 E-04 E-03 E-04~-1.82 E-04 1.12 2.83 6.28 1.64 1.90 1.89 3.40 3.35 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-I 34.Cs-137 Ra-226 Th-228 7.05~2.84"-1.94":-9.86~9.29'7 la~22P*-7.21 E-02 E-04 E-04 E-04 E-05 E-04 E-03 E-05 8.26 3.04 6.04 2.07 2.14 2.08 3.67 3.39 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than'the detection limit. TABLE A-3.1 (Cont.)XAAM A PE TR METRY F PARTI I.ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-l06 Cs-I 34 Cs-137 R;t-226 TI)-228 6.79*-1.10~1.14"'-1.44" 8.32"'.77":-1.23" 4.26 9.79"'.26 3 9P"-3.41"-1.46"-I 08"-3.08"'-3.27 1.62 6.I 8"QPQ': (S.63" 6.90"-I 3 I 1.3()I 09 x'(7g ((9" 1.99'" I 46"'-IÃ9 x-3.66 E-02 E-03 E-04 E-03 E-05 E-05 E-03 E-04 E-02 E-04 E-04 E-04 E-04 E-04 E-03 E-04 E-01 E-03 E-04 E+00 E-06 E-05 E-03 E-04 E-0" E-03 E-04 F-04 E-04 E-04 E-04 E-04 6.50 4.20 5.53 1.77 2.37 2.07 2 74 2.61 9.33 2.19 6.1 1 1.58 1.67 1.59 3.81 3.23 9.96 2.28 5.87 1.51 1.55 1.47 2.66 2.57 7.99 6.29 7.19 2.30 2.72 2.50 3.40 3.13 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc detection limit. +AMMA PE TR TABLE A-3.1 (Cont.)METRY F PARTI I ATE FII TERS Results in'pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 CG-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 7.06"'-6.99&113": 1.57 x x 3$9":-3.76":-1.83 9.25":-2.17"-4.06 19": 6.57 I 39'":-7.65 x 432 1.48" 1.93": 1.84"'.18": 0.00" 9.89 x gp5"'.37 8.58 A 4'73 A'7P9"" ppp'": 2.70": 1.84"-2.33 x 571 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-05 E-03 E-05 E-04 E-04 E-05 E-pl E-03 E-04 E-05 E+00 E-05 E-03 E-04 E-02 E-04 E-04 E+00 E-05 E-04 E-03 E-04 7.00 5.57 6.08 2.34 2 4P 57 3.35 2.96 8.17 4.04 6.61 1.93 2.16 1.92 2.44 2.55 9.50 4.05 6.14 1.84 2.04 1.89 2.54 2.62 9.14 2.21 5.44 1.71 1.86 1.69 3.14 3.19 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit. AM A PF TR TABLE A-3.1 (Cont.)METRY F PARTI LATE FII.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.77"-4.07" 1.39" 1.97*1.07":-1.08*-4.07~-1.37 1.02 4.77" 2.50":-1.07": 303"-2.58"-1 9Q"666 1.36" 146":-2.39"-5.67 x 751 A 1.00":-1.44"'-8.76 8.80" 1.83":-3.69": 8.74"000" 1.18"3.38'7 PQ E-02 E-04 E-04 E-04 E-04 E-04 E-04 E-04 E-01 E-03 E-04 E-03 E-05 E-04 E-03 E-04 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-05 E-02 E-04 E-04 E-04 E+00 E-04 E-04 E-05 8.20 3.00 4.62 1.71 1.77 1.60 3.19 2.88 9.28 1.94 6.83 1.86 1.86 2.14 3.06 3.05 9.10 2.62 5.49 1.43 1.46 1.46 2.52 2.53 7.09 3.46 5.13 1.76 1.78 1.74 2.44 2.39 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit. TABLE A-3.1 (Cont.)GRAMMA SPECTR METRY F PARTI I ATE FILTER Results in pCi/cubic rnetcr COLLECTION LOCATION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/28/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-128 Be-7 K-40 Ru-l03 Ru-106 Cs-134 Cs-137 R:t-226 I h-228 6.65":-1.37": 3.91": 2.70":-6.44"'.53": 853 2.23 9.99": 135"-2.45"-1.02"-8.85 x 716"-2.54~-7.26 1.35": 1.76" 3.70*9.73":-7.65 x'7 14":-6.04": 5.03 7.77"'-8.14"-1.35"'.06'1.37":-8.84<<-3.04":-2 43 E-02 E-03 E-05 E-04 E-05 E-04 E-04 E-04 E-02 E-03 E-04 E-03 E-06 E-06 E-03 E-05 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-05 E-02 E-04 E-04 E-04 E-05 E-05 E-04 E-04 5.79 349 4.61 1.65 1.84 1.79 2.46 2.41 9.10 2.96 6.52 1.93 2.06 1.92 2 40 2.48 9.08 2.94 6.00 1.89 2.02 1.95 2.35 2.40 9.37 3.12 5.71 1.89 1.89 2.10 3.70 3.55 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc detection litnit. TABLE A-3.1 (Cont.)rAMMA SPE TR METRY F PARTI I ATE FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 8.12": 1.58":-9.56 x 3 0'7~1.50"-1.77 x 2pg x 552 8.73 x 6+4 x 8/7" 9.51~8.31"-2.01"-7.13" 1.66 1.37"3.00": 3.19"-4.39"-1.65"'.26*-1.18": 474 8.62 4.65":.-1.66": 1.79 2 42" 1.46"-1.50~3.08 E-02 E-03 E-05 E-04 E-04 E-04 E-03 E-05 E-02 E-04 E-05 E-04 E-05 E-04 E-04 E-05 E-01 E-03 E-04 E-04 E-05 E-04 E-04 E-04 E-02 E-03 E-04 E-04 E-05 E-04 E-03 E-04 8.35 2.92 5.46 1.97 2.20 2.08 3.69 3.50 8.03 2.61 6.41 1.54 1.66 1.87 2.78 2.68 8.89 2.79 6.01 1.71 1.87 2.06 2.88 2.92 8.36 2.69 5.18 1.73 1.87 1.90 3.37 3.06 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit. TABLE A-3.1 (Cont.)AMMA PFCTR METRY F PARTI Results in pCi/cubic mctcr LATE FILTER LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9A 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 6.87 x g 99"-3.04"-1 95"'.19"'.29 x 402"'.69 9.71~2.74 x 25'7"'.1.12 x 455 x 1 8'7"-9.89~-8.60 1.48":-3.46"-5.05"-1.02 337 154": 973": 935 6.76"'-3.85"ppp" 7.49" 0.00" 9.89 x 6+9": 6.00 E-02 E-04 E-04 E-04 E-04 E-04 E-03 E-05 E-02 E-03 E-04 E-03 E-05 E-05 E-06 E-05 E-pl E-03 E-05 E-03 E-05 E-04 E-04 E-04 E-02 E-04 E+00 E-04 E+00 E-05 E-04 E-04 8.46 3.19 6.27 1.95 2.32 2.10 3.87 3.46 1.10 6.00 9.47 2.57 2.85 2.59 3.48 3.50 1.19 6.23 9.12 2.56 2.68 2.62 3.69 3.82 7.20 2.55 4.73 1.64 1.60 1.57 3.81 3.46 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes n result less than the dctcction limit. +AMMA PE TR TABLE A-3.1 (Cont.)METRY F PARTI ULATE<FIL'TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 21 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 CH-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Ci-137 Rtt-226 I'l-228 6.05": 9.76~3.65":-2.06": 1.48~-8.78*-3.05 x 1.00 1 9'7" 2.29": 8.06 x 3'98~-1.06"145" 5.43 1.38'": 3.12'"'.85'09 7><)7.90 E-02 E-04 E-04 E-04 E-04 E-05 E-03 E-04 E-01 E-03 E-04 E-04 E-05 E-05 E-03 E-04 E-01 E-04 E-04 E-04 E-05 E-05 E-04 E-04 E-02 E-03 E-04 E-04 E-06 E-05 E-04 E-04 6.60 4.27 5.45 1.94 2.25 2.01 2.68 2.59 1.02 3.42 7.80 1.91 1.96 1.93 3.74 3.40 1.13 3.07 6.96 1.96 1.95 1.93 3.64 3.40 6.79 3.95 5.44 1.80 2.00 1.88 2.37 2.57 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit. TABLE A-3.1 (Cont.)AMMA SPECTROMETRY OF PARTICUI,ATE FII.TERS Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL'NCERTAINTY 23 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-l3 7 R't-226 Th-228 6.96":-I 36 x 373": 8.08 x+87": 1.48":-1.49": 2.71 9.81 2.74":-8.17":-1.60":-3.15"645":-1.22":-8.82 1.28"-5.57 x 577 x'734 x 543": 8.73":.-~79':-3.28 6.50 x$09'2.00<<524"-1.30'":-9.61 x 1+5" 5.00 E-02 E-02 E-04 E-04 E-04 E-05 E-03 E-04 E-02 E-02'-05 E-03 E-05 E-06 E-03 E-05 E-pl E-04 E-04 E-03 E-05 E-05 E-03 E-05 E-02 E-03 E-05 E-04 E-04 E-05 E-04 E-04 7.06 5.29 6.26 2.20 2.59 2.34 3.35 3.08 9.58 4.94 8.10 2.20 2.43 2.24 2.91 2.81 1.00 4.80 8.20 2.19 2.40 2.1 I 2.77 2.90 7.17 2.71 5.57 1.80 1.89 2.26 3.06 2.89 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than thc dctcction limit. GRAMMA PECTR TABLE A-3.1 (Cont.)METRY F PARTI LATE FILTERS Results in pCi/cubic mctcr LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 40 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 RU-103'u-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 CN-137 Ra-226 Th-228 Be-7 K-40 Ru-I 03 Ru-l06 Cs-l34 Cs-l37 R;t-226 Th-228 8.63"-1.76"-1.65*1.48'.88"-1.08" 3.16*-8.86 1.07+419 x-3 57"-1.10 x 7/8 x 152~-4.31 x 449 1.73 pg" 1.54"'.08 x 55/'"'.89 x')19"'" 1.00 7.62" 7.06:.ppp'00'"'-5.06'" 6.20"'.20"'.52 E-02 E-03 E-04 E-03 E-04 E-05 E-03 E-05 E-pl E-04 E-05 E-04 E-05 E-04 E-04 E-04 E-01 E-03 E-04 E-04 E-05 E-04 E-03 E-03 E-02 E-04 E+00 E+00 E-05 E-05 E-04 E-04 8.13 2.63 4.59 1.77 2.07 1.78 3.18 2.99 1.08 3.18 7.1 1 1.89 2 02 2.07 3.62 3.52 1.24 2.76 7.28 1.78 2.10 2.07 3.49 3.84 7.06 3.09 5.10 1.76 1.88 1.78 2.37 2.33 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Dcnotcs a result less than thc dctcction litnit. GAMMA SPECTR TABLE A-3.1 (Cont.)METRY Ol PARTICUI ATE FILTERS Results in pCi/cuhic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 12/29/97-03/30/98 Be-7 K-40 Ru-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 7.62 x'757":-2.66"'-2.71"-7.16*0.00"'.62":-6.09 E-02 E-03 E-05 E-04 E-06 E+00 E-03 E-06 6.34 3.64 4.59 1.69 1.92 1.70 2 47 2.35 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 03/30/98-06/29/98 Be-7 K-40 RU-103 Ru-106, Cs-134 Cs-137 Ra-226 Th-228 8.86 6.79"-I P4" 1.83 x g 34"-I 50"'-1.27 E-02 E-03 E-04 E-03 E-05 E-04 E-03 E-04 E-03 E-04 E-04 1.48 1.69 1.67 2.72 2.55 E-03 E-04 8.21 E-03 2.92 E-03 5.89 E-04 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-l06 Cs-134 Cs-I 37 Rtt-226 Th-228 Be-7 K-4()I(tt-I 03 Rtt-l()6 ('i-I 34 (i-l 37 I<:t-22(i I'It-228 1.50": 648 v.3'35" 5.95" I.l I": 6.36':.1.67'"-9 40 7.56:.1.75'3.54'I.19'"" 7.88".I.90'2.18':-5.51 E-01 E-04 E-04 E-05 E-04 E-05 E-03 E-07 E P2 E-03 E-05 E-03 E-05 E-04 E-03 E-05 8.62 2.48 4.91 1.34 1.52 1.47 2.56 2 40 7.67 2.85 5.53 1.59 1.79 2.15 2 84 2.70 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the tleteetion lintit. GAMMA SPE TR TABLE A-3.1 (Cont.)ETRY F PARTI UI ATF.FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 57 12/29/97-03/30/98 03/30/98-06/29/98 06/29/98-09/28/98 09/28/98-12/28/98 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 RU-103 RU-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Ru-103 Ru-106 Cs-134 Cs-137 Ra-226 Th-228 7.60": 1.19~7.30 x"546": 443":-3 79"'-1.42 9.90":-3.81 x 466 x 1+9 x": 757"-4 64"'.38 1.34":-5 93":-4 30"ppp":-1 30": 8.40""-" 04": 1.49 7.87'": 7.59 x" 0.00":-8.96":-9.07": 3.90": 3.37 E-02 E-03 E-05 E-03 E-05 E-05 E-04 E-04 E-02 E-03 E-05 E-03 E-04 E-05 E-03 E-04 E-01 E-03 E-04 E+00 E-04 E-05 E-03 E-04 E-02 E-04 E-04 E+00 E-05 E-05 E-03 E-04 8.40 2.93 5.43 1.85 2.06 2.09 3.67 3.47 9.34 4.82 8.48 2.12 2.25 2.19 2.81 2.96 1.01 4.44 7.15 2.08 2.20 2.15 2.85 2.90 9.49 6.22 7.96 2.50 2.85 2.56 3.58 3.62 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-04 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-04 Denotes a result less than the detection limit. TABLE A-3.2 (Cont.)C" AMMA PE TR MIs TRY OF PARTI I.ATE FILTERS-

SUMMARY

Results in pCi/cubic meter NUCLIDE NUMBER AVERAGE LOW NUMBER HIGH SAMPLES POSITIVE Be-7 (I)Be-7 (C)9.83E-02 9.54E-02 6.05E-02 6.76E-02 1.73E-01 1.48E-01 44 44 K-40,'I)K-40 (C)6.44E-04-2.02E-04-1.36E-02-3.46E-03 2.74E-02 2.74E-03 44 RU-103 (I)RU-103 (C)-2.17E-05-2.56E-05-4.30E-04-3.04E-04 5.77E-04 2.52E-04 RU-106 (I)RU-106 (C)-7.96E-06 1.64E-04-1.62E-03-1.02E-03 2.34E-03 1.12E-03 44 Cs-134 (I)Cs-134 (C)4.30E-08 3.27E-05-2.87E-04-3.37E-05 1.99E-04 1.19E-04 Cs-137 (I)Cs-137 (C)5.64E-05 1.00E-04-2.58E-04 I.82E-05 3.29E-04 1.54E-04 g)Indicator Stations (C)Control Station TABLE A-4.1 I-131 IN HAR AI.FILTERS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (8)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/ I 3/98 07/13/98-07/20/<)8 07/20/98-07/27/<) 8 07/27/98-08/03/<) 8 08/03/98-08/ I ()/<)I)08/10/98-08/ I 7/98 08/17/98-08/24/<)i) 08/24/98-08/3 I/98 08/31/98-09/()8/98 09/08/98-0<)/ I 4/<)8 09/14/98-09/ I/98 09/21/98-09/28/<) 8":-3 00": 2.46 x 772" 1.49 x I'74 x 3 4944 x 394": 2.55<425 x 129 xg3$":-2.30":-3.66 x 9 g4": 1.8l x I 7I r'c 4 7Q":-7.16'.-3.I 4":-I.52)"" 3>l"" 4.<)I'"-I ()')4<)<)()'--/.3()i))'-I.').)().()(),.)7"-.).7()~))7"3.14-i).())-1.()l E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-02 E-03 E-03 E-03 E-04'-03 E-03 E-04 E-04 E-03 E-02 E-03 E-()3 r-o.~I-()3 I:-()3 I:-()3 I':-()0 I'.-().: I:-()3 I:-()0 I:-()3 I:-()3)I;:-())I'.-()3 I'-()0 I;-()3 I:-()0 I'.-()3 5.73 6.22 1.16 1.12 1.27 6.70 9.51 7.14 5.99 6.55 1.13 5.65 1.07 6.72 1.15 6.08 5.74 6.54 6.31 5.78 1.37 1.05 1.10 6.41 5.80 1.09 6.67 5.97 5.06 6.65 3.33 1.18 6.48 6.76 6.93 5.11 7.80 6.85 5.77 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume duc to power outa c.Y<)t incluilcil in;)vera cs.Denotes a result less than thc dc(ection lin)it. TABLE A-4.1 (Cont.)-13 IN HAR I FI ER Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT":-1.61 E-03": 1.26 E-03*1.37 E-03*-3.69 E-03": 1.79 E-04": 1.25 E-03"-4.32 E-04*-7.73 E-03*1.40 E-03*1.80 E-03'-2.00 E-03"-2.23 E-03"'-1.29 E-03 OVERALL UNCERTAINTY 6.56 E-03 8.85 E-03 7.14 E-03 5.51 E-03 6.57 E-03 5.94 E-03 8.98 E-03 1.05 E-02 6.39 E-03 6.03 E-03 5.96 E-03 5.69 E-03 5.72 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-131 I HAR L<ILT<R LOCATION COLLECTION PERIOD Results in pCi/cubic meter RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 (8)07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/74/98 08/24/98-08/3 l/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 g 93 A 2.40": 7.29" 146 x 133":-3.17"'.28":-3.88": 2.51": 4.19": 1.29 x 233 x gg6*-3.60" 9.24" 1.78": 1.68"465":-7 03":-3 09": 5.46'": 2.67": 4.81":-1.08 x 490 xgq0'.16"-7.22": 1.90 89":-4 75~5.93')53":-l 70 x'7'73": 3.08"-3 48":-7.88":-3.23 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03-E-02.'-03'-03 E-03 E-04 E-03 E-03 E-04 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-03 5.60 6.07 1.09 1.10 1.36 6.59 9.35 7.02 5.89 6.46 1.13 5.66 1.05 6.61 1.15 5.97 5.64 6.43 6.20 5.70 4.92 8.01 1.08 6.32 5.70 1.09 6.60 5.85 4.99 1.43 3.27 1.15 6.37 6.66 6.82 5.03 7.69 6.68 4.61 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Unit failure;low sample volume.Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-l31 IN H R LFII TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 (a)11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT*-1.59 E-03*1.24 E-03 x135 E03"'-3.63 E-03"1.76 E-04"1.24 E-03"-8.28 E-04":-4.35 E-03"'.37 E-03~1.75 E-03"-1.98 E-03~-2.19 E-03'-1.27 E-03 OVERALL UNCERTAINTY 6.46 E-03 8.70 E-03 7.03 E-03 5.43 E-03 6.47 E-03 5.86 E-03 1.72 E-02 5.88 E-03 6.27 E-03 5.89 E-03 5.89 E-03 5.60 E-03 5.64 E-03 (a)Poweroffatunit. Denotes a result less than the detection limit. TABLE A-4.1 (Cont.).I-131 I HAR AI I ILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 x:-~95 Q" 4')*7.63" 1.47" 1.23"'-3.34": 1.08"-3.89"'.52*4.21'1.27 AQ29"-2.27"-3.62": 9.01 x I 79"'.69": 4.67":-7.06 A')88" 5.48"'.68 4 8g x-1 08 4 94 7 3'7"6.19 x 7')5" 1.91*1.33":-4.78'" 5.96 5a"-3.72)7$"': 3.10 x 3 gp-~792 3'74 E-03 E-03 E-03 E-03 E-03 E-03 E-02'E-03 E-04 E-03, E-02 E-03 E-03 E-03 E-04 E-03 E-03 E-04 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-03 5.64 6.12 1.14 1.11 1.26 6.95 1.09 7.03 5.92 6.49 1.11 5.57 1.05 6.65 1.12 6.00 5.67 6.46 6.23 5.30 4 94 8.05 1.08 6.33 5.75 1.09 6.63 5.88 5.01 6.56 3.29 1.16 6.42 6.70 6.84 5.05 7.73 6.72 4.63 E-03 E-03 E-02 E-02 E-02 E-03 E-02 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than the dctcction limit. TABLE A-4.1 (Cont.)I-131 I HAR AL FII TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT"'-1.60 E-03"1.24 E-03" 1.36 E-03":-3.65 E-03" 1.76 E-04": 1.24 E-03"-4.29 E-04"-4.37 E-03": 1.38 E-03 1.77 E-03":-1.98 E-03":-2.20 E-03":-1.28 E-03 OVERALL UNCERTAINTY 6.50 E-03 8.74 E-03 7.08 E-03 5.45 E-03 6.48 E-03 5.88 E-03 8.91 E-03 5.91 E-03 6.32 E-03 5.94 E-03 5.91 E-03'.63 E-03 5.66 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-131 N HAR ALFILT iR Results in pCi/cubic meter LOCATION COLLECTION PERIOD'RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-OS/ l 0/9S 08/10/98-08/17/98 08/17/98-08/24/9S 08/24/9S-08/31/9S 08/31/98-09/OS/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 "-2.98 x'745"'.69 x 149" 1.24":-3.21 x 941'-3.92 8 2.55 x 424": 1.28 AQ3g"-2.29"'-3.65"'.01": 1.80": 1.7l":.470":-7.l 2":-3.14-5.53)7 1": 4.87 v.l 09"-4.98" 6.l7 v 7 I.t)2 gl 6.04".5()-3 75 I x-l).03~-3.26 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-02 E-03 E-03 E-03 E-04 E-03 E-03 E-04 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 I:-04 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-03 5.70 6.19 1.15 1.12 1.27 6.68 9.48 7.09 5.98 6.53 1.12 5.63 1.06 6.70 1.12 6.06 5.72 6.50 6.28 5.78 4.99 8.12 1.09 6.38 5.79 1.1 1 6.61 5.96 5.03 6.58 3.32 1.17 6.46 6.76 6.90 5.10 7.78 6.81 4.65 E-03 E-03 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than thc detection limit. TABLE A-4.1 (Cont.)I-'l31 IN HAR Al FII YER Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT*-1.61 E-03~1.25 E-03" 1.37 E-03":-3.68 E-03" 1.78 E-04" 1.25 E-03*-4.32 E-04"'-4.40 E-03~1.39 E-03 A 1.79 E-03*-2.00 E-03"-2.22 E-03"-1.29 E-03 OVERALL UNCERTAINTY 6.56 E-03 8.81 E-03 7.14 E-03 5.50 E-03 6.54 E-03 5.93 E-03 8.98 E-03 5.96 E-03 6.37 E-03 6.01 E-03 5.95 E-03 5.68 E-03 5.71 E-03 Denotes a result less than the dctcction limit. TABLE A-4.1 (Cont.)I-131 IN HAR AL I<'ILYFRS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/0 9/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 (a)05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/l 0/98 08/10/98-08/ l 7/98 08/17/98-08/24/98 08/24/98-08/3 l/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 g 29": 1.83"'.80"'7 34" 6.1 1"-2 40"'.65"'-2.85": 1.91" 3.38~6.33"-1.78"-1.13"-2.73 x 4.49": 135~1.28": 6.41":-5.68":-2.35 x 4'75": 1.85 x g 40":-8.67 Y.373":-1.32": 5.58 x 550": 1.48 E-03 E-03 E-03 E-04 E-04 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-04 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-04 E-03')Q4":-~99"-1.79": 2.40 x')80"-6 40"-3.10 E-03 E-03 E-03 E-04 E-03 E-04 E-03""9 l5 E-Q4":-3.60 E-04": 2.98'-03 4.38 4.63 5.69 5.52 6.28 4.99 4.69 5.16 4.47 5.20 5.55 4.33 5.24 5.01 5.58 4.53 4.29 8.87 5.01 4 32 3.83 5.56 5.38 5.08 4.33 6.22 5.98 4.46 3.88 4.52 2.48 5.80 5.15 5.38 5.49 3.92 6.19 5.43 4 42 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 (a)Low sample volume due to unit failure.Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-131 I HAR A FII TER.Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT"-1.28 E-03"8.34 E-04 A 1.10 E-03"-2.83 E-03" 1.33 E-04~9.35 E-04"-2.97 E-04":-3.51 E-03" 1.11 E-03" 1.34 E-03":-1.49 E-03"-1.93 E-03"-1.12 E-03 OVERALL UNCERTAINTY 5.23 E-03 5.86 E-03 5.74 E-03 4.23 E-03 4.89 E-03 4.43 E-03 6.17 E-03 4.75 E-03 5.08 E-03 4.49 E-03 4.45 E-03 4.94 E-03 4.95 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-131 IN HARCOAI FIT T&:RS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 ": 7.80 4 74 x 2pg":-3 03"ppp x 9 64~1.78 xgp4*2.59": 1.46": 947":-3.71"-5.13"'.70"141": 3.04*-3.84"'.56*-1.48~3.50~-5.02 x'779~1.09": 1.71 65":-2.65 x 444 x 67$":244>-228 x o g4":-1.09'": 4.61'" 1.01 g$8': 4.38':-3.81':"-3.31'9.51 E-04 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-04 9.40 1.23 1.22 6.46 1.23 5.87 4.91 7.70 5.20 6.61 6.58 9.41 6.23 6.24 6.69 5.35 4.91 5.57 6.20 5.24 7.92 8.10 6.43 6.61 5.33 6.44 6.58 6.48 8.25 5.40 6.67 6.57 6.80 6.62 6.80 8.18 7.80 6.86 8.79 E-03 E-02 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than thc detection limit. TABLE A-4.1 (Cont.)-131 IN H R I.I<II YL<R Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 .12/21/98-12/28/98 RESULT"'.40 E-03" 3.31 E-03"-1.86 E-03"-1.14 E-03*3.96 E-03 A2.34 E-03":0.00 E+00" 1.42 E-03*-2.40 E-04"-1.26 E-03"'-2.00 E-03": 4.31 E-04~7.42 E-04 OVERALL UNCERTAINTY 6.56 E-03 6.89 E-03 5.84 E-03 8.76 E-03 5.91 E-03 5.29 E-03 6.64 E-03 6.06 E-03 6.64 E-03 5.31 E-03 5.39 E-03 5.11 E-03 6.12 E-03 Denotes a result less than thc dctcction limit. TABLE A-4.1 (Cont.)I-131 IN.HAR AI, I II TI RS Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/ I 0/9l)08/10/98-08/ I 7/9)08/17/98-08/24/98 08/24/98-08/31/t) 8 08/31/98-09/08/98 09/08/98-09/ I 4/98 09/14/98-09/21/') 8 09/21/98-09/28/98 ": 7.86"4.78 x)03 x-I 71"ppp": 8.89 I 79":-2.05 x g 6p": 1.19" 9.53-3 73"-5.15": 5.73": 1.42":306"'-3.86": S.60 x 1.49""-~0~"" 2.8()"'.IO'.j"": 2.()()jg'-().59-I.I()A.()A'.()1.4()9 55 E-04 E-03 E-03 E-02 E+00 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-()3 E-03 E-()3 E-()3 I:-()3 I:-()3 E-()3 r:.-().: I'.-()3 I'.-()4 I:-()3 I'.-()3 I:.-()3 I:-()3 I:-()3 E-()3 I:-()0 1.22 3.63 1.24 5.42 4.94 7.74 5 22 5.37 6.62 9.46 6.25 6.28 6.73 5.38 4.94 5.60 6.22 5.27 7.97 8.15 6.48 6.66 5.36 6.68 6.63 6.32 8.26 5.41 6.70 6.62 6.84 6.65 6.85 8.23 7.82 6.91 8.84 E-02 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 9.47 E-03 1.24 E-02 (a)Low sample volume duc to pnNcr nutauc.i%i)t includctl in avcra.cs.Denotes a result less than the detection lin)it. TABLE A-4.1 (Cont.)I-131 I H R AL I'ILT R Results in pCi/cubic meter LOCATION COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT A 3.42 E-03*3.33 E-03 A-1.87 E-03*-1.14 E-03*3.99 E-03~2.36 E-03*0.00 E+00*1.43 E-03*-2.41 E-04*-1.27 E-03*-2.02 E-03" 4.34 E-04+7.46 E-04 OVERALL UNCERTAINTY 6.61 E-03 6.93 E-03 5.87 E-03 8.81 E-03 5.95 E-03 5.33 E-03 6.68 E-03 6.09 E-03 6.68 E-03 5.34 E-03 5.42 E-03 5.14 E-03 6.15 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)I-'131 IN HAR AL'ILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 '2/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/9S 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 '.7.94 x 4'83 A'704"-3.07"000"'.78" 1.81"-2.07'": 2.63" 1.48+9.63"-3.77"-5.21"5.79~1.44" 3.09"'-3.90" 8.68"-1.50 x 3 54":-5.09--2.84*1.1 1": 1.73": 2.68 x":-4.48":-6.87":.2.46 x+30'2.38'"-I.1 2" 4.68"'.03":-3.33"-R 85<-3.39 x 961 E-04 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-04 9.58 1.26 1.23 6.53 1.25 5.96 4.99 7.81 5.28 6.69 6.69 9.57 6.32 6.33 6.79 5.43 4.99 5.65 6.29 5.31 8.03 8.25 6.53 6.72 5.40 6.45 6.64 6.59 8.33 5.47 6.76 6.70 6.90 6.69 6.91 8.30 7.89 7.02 8.89 E-03 E-02 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)1-13 I 8 R AI FII R Results in pCi/cubic meter LOCATION 21 COLLECTION PERIOD 09/28/98-10/05/98 (a)10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT": 3.63 E-03": 3 37 E-03":-2.30 E-03":-1.15 E-03": 4 03 E-03"2.37 E-03":0.00 E+00" 1.44 E-03":-2.44 E-04"-1.28 E-03":-2.03 E-03" 4.37 E-04"'.47 E-04 OVERALL UNCERTAINTY 7.01 E-03 7.00 E-03 7.22 E-03 8.88 E-03 6.01 E-03 5.36 E-03 6.71 E-03 6.14 E-03 6.75 E-03 5.40 E-03 5.46 E-03 5.18 E-03 5.34 E-03 (a)Power off due to maintenance work.Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)1-131 HAR AL F<II.TFR Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 23 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98 "7.94 x 483 Q p4 x-3 07"'.00": 977"'.81":-2.07" 1.48":957"-3.77":-5:20"'.78" 1.43 3 P9":-3.90+8.68"'-1.50" 3.54":-5 09 x'783" 1.11": 1.73 x f68'.-2.66"-4 48"-6.86 x Q 47" 2.31 o 37 111" 4.68'": 1.02-3 33":444":-3 85":-3.39"958 E-04 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-04 E-03 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03'-03 E-03 E-03 E-04 9.57 1.26 1.23 6.53 1.25 5.95 4.99 7.83 5.27 6.68 6.64 9.57 6.32 6.33 6.79 5.43 4.98 5.65 6.28 5.30 8.03 8.24 6.54 6.71 5.39 6.44 6.63 6.58 8.35 5.48 6.76 6.69 6.90 6.69 6.90 8.29 7.88 7.01 8.86 E-03 E-02 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)1-131 I HAR L FILTERS Results in pCi/cubic meter LOCATION 23 COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98. 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT"'.44 E-03"'.36 E-03*-2.32 E-03"-1.15 E-03 x 402 E 03": 2.37 E-03":0.00 E+00 x144 E03"-2.43 E-04"-1.28 E-03":-2.03 E-03" 4.37 E-04": 6.48 E-04 OVERALL UNCERTAINTY 6.65'-03 6.99 E-03 7.30 E-03 8.87 E-03 6.00 E-03 5.36 E-03 6.71 E-03 6.13 E-03 6.73 E-03 5.39 E-03 5.45 E-03 5.18 E-03 5.35 E-03 Denotes a result less than thc detection limit. TABLE A-4.1 (Cont.)-131 IN HAR AI.FII.YI:R Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 40 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/ l 3/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/9S 08/03/98-08/ l 0/98 08/10/98-0S/ l 7/98 08/17/98-0S/24/9S 08/24/98-0S/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98'-09/28/98 ": 5.36 x')34"-1.32"-')41": 0.00 x 741 x 133":-1.63": 1.99": 1.07": 7.05":-2.50":-4 09": 4.38" 9.68 x')34 95"656":-1.08": 2.69 v-")4S": 7.50'" 2.04 x-2.06 x-.).fit)'.67'.75-1.70-S.l 8)Q()"~Ol 77 x-6.53 E-04 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-03 E-03 E-04 E-03 E-04 E-04 E-04 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-05 E-03 E-04 E-03 E-03 E-03 E-03 E-04 6.46 6.10 7.95 5.14 8.05 4.51 3.67 6.14 3.99 4.81 4.90 6.34 4.96 4.80 4.58 4.1 1 3.78 4 27 4.50 4.03 5.44 6.45 4 42 4.81 4.10 5.01 5.47 5.19 5.67 4.15 4.85 4.91 4.96 4.82 4.96 5.62 5.68 5.00 6.04 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 Denotes a result less than thc dctcction limit. TABLE A-4.1 (Cont.)I-31 IN H 8 AI V<I TFR Results in pCi/cubic meter LOCATION.40 COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT": 2.48 E-03"2.64 E-03"-1.67 E-03*-7.16 E-04": 3 05 E-03": 1.80 E-03 x 0'00 E+00"'.04 E-03":-1.75 E-04":-9.70 E-04"-1.54 E-03*3.31 E-04"'.81 E-04 OVERALL UNCERTAINTY 4.79 E-03 5.49 E-03 5.24 E-03 5.52 E-03 4.55 E-03 4.07 E-03 5.29 E-03 4.41 E-03 4.84 E-03 4.08 E-03 4.14 E-03 3.93 E-03 3.97 E-03 Denotes a result less than the detection limit. TABLE A-4.1 (Cont.)"'-131 IN HAR AL I'II.TER Results in pCi/cubic meter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 48 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 05/18/98-05/26/98 (a)05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/9S 08/03/98-08/10/98 08/10/98-08/17/98 08/17/98-08/24/98 08/24/98-QS/31/98 08/31/98-09/08/98 09/08/98-09/14/98 09/14/98-09/21/98 09/21/98-09/28/98

  • 2.85" 1.73 x 171"-2.42" 1.21"-4 65" 4.03" 1.65~6.12 A 2.45": 7.62"ppp"7.19"-1.25": 5.10"'-5.65 x 2+9'7 Sg"-3 57"'.48"-1 46 4'74":-4 13"-5.33" 3.61 77"-7.89":-1.87":-1.74 v.731'": 4.19~6.14" 1.14'":-1.97:".4 Q4"-I QR':-1.26"-8.60 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03'E-03 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-04 E-04 E-03 E-04 E-02 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-02 E-04 6.74 7.69 5.40 1.09 4.34 1.11 1.38 8.17 8.52 6.96 1.09 1.09 6.12 9 72 5.74 8.89 7.99 9.07 6.06 5.36 3.56 5.71 5.57 3.80 8.35 6.53 8.95 6.75 6.18 5.55 1.14 5.93 1.20 9.23 6.37 5.70 6.20 1.14 6.06 E-03 E-03 E-03 E-02 E-03 E-02 E-02 E-03 E-03 E-03 E-02 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-02 E-03 E-02 E-03 E-03 E-03 E-03 E-02 E-03 (a)Low sample volume duc to power outage.Not included in averages.Denotes a result less than the detection limit.

TABLE A-4.1 (Cont.)I-131 IN HAR FILTER Results in pCi/cubic meter LOCATION COLLECTION PERIOD,.RESULT OVERALL UNCERTAINTY 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 (a)11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98

  • 2.31*-7.48*1.52*-1.45"'-3.09"7.50"'3 ll~0.00"-5.36" 6.18*3.56*7.13"-1.05 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E+00 E-04 E-03 E-03 E-04 E-04 5.86 E-03 6.33 E-03 5.41 E-03 1.05 E-02 5.38 E-03 3.35 E-02 6.61 E-03 5.36 E-03 3.86 E-03 8.30 E-03 8.43 E-03 8.06 E-03 8.57 E-03 (a)Power off;low sample volume.Not included in averages.Denotes a result less than the detection limit.

TABLE A-4.1 (Cont.)I-131 I HAR AI F<II.TI<.R Results in pCi/cubic meter'OCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 57 12/29/98-01/05/98 01/05/98-01/12/98 01/12/98-01/19/98 01/19/98-01/26/98 01/26/98-02/02/98 02/02/98-02/09/98 02/09/98-02/17/98 02/17/98-02/23/98. 02/23/98-03/02/98 03/02/98-03/09/98 03/09/98-03/16/98 03/16/98-03/23/98 03/23/98-03/30/98 03/30/98-04/06/98 04/06/98-04/13/98 04/13/98-04/20/98 04/20/98-04/27/98 04/27/98-05/04/98 05/04/98-05/11/98 05/11/98-05/18/98 (a)05/18/98-05/26/98 05/26/98-06/01/98 06/01/98-06/08/98 06/08/98-06/15/98 06/15/98-06/22/98 06/22/98-06/29/98 06/29/98-07/06/98 07/06/98-07/13/98 07/13/98-07/20/98 07/20/98-07/27/98 07/27/98-08/03/98 08/03/98-08/l 0/98 08/10/9S-08/ l 7/98 08/17/98-08/24/98 08/24/98-08/31/98 08/31/98-09/08/98 09/08/98-09/ l 4/98 09/14/98-09/21/98 09/21/98-09/28/98 xg91"-3.71 x-2 17":-6.38" 1.86'73"-4.73"410": 1.68~6.21 x'7 45" 7.76"000 x731'77"5.19 5 74 x Q 33": 0.00 x 727": 0.00 x'753 x431 x 153":-5.41": 3.66 x'778'":-7.97"':-1.90~-3.52":-7 43: 4.28'.23": 1.16'"-2.01'": 4.07 3 8')'77":-8.71 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E-03 E+00 E-04 E-03 E-03 E-04 E-04 E+00 E-03 E+00 E-03 E-04 E-03 E-03 E-04 E-03 E-04 E-03 E-03 E-03 E-03 E-03 E-04 E-03 E-03 E-03 E-02 E-04 6.88 E-03 7.19 E-03 5.06 E-03 1.11 E-02 6.45 E-03 1.13 E-02 1.40 E-02 8.31 E-03 8.69 E-03 7.06 E-03 1.09 E-02 1.10 E-02 6.22 E-03 9.89 E-03 5.84 E-03 9.04 E-03 8.13 E-03 9.23 E-03 3.95 E-03 7.20 E-03 4.01 E-03 7.36 E-03 5.66 E-03 5.82 E-03 8.47 E-03 6.61 E-03 8.99 E-03 6.83 E-03 6.27 E-03 8.42 E-03 1.16 E-02 6.06 E-03 1.22 E-02 9.39 E-03 6.48 E-03 5.75 E-03 8.61 E-03 1.15,E-02 6.13 E-03 (a)Low sample volume.Denotes a result less than thc dctcction limit. TABLE A-4.1 (Cont.)-31 IN 8 R I FII YER Results in pCi/cubic meter LOCATION 57 COLLECTION PERIOD 09/28/98-10/05/98 10/05/98-10/12/98 10/12/98-10/19/98 10/19/98-10/26/98 10/26/98-11/02/98 11/02/98-11/09/98 11/09/98-11/16/98 11/16/98-11/23/98 11/23/98-11/30/98 11/30/98-12/07/98 12/07/98-12/14/98 12/14/98-12/21/98 12/21/98-12/28/98 RESULT": 2.33 E-03":-7.61 E-03"-2.96 E-03":-1.47 E-03"-5.50 E-04~144 E-03*3.15 E-03": 0.00 E+00"-2.87 E-04" 6.31 E-03*3.61 E-03"7.27 E-04"-1.06 E-04 OVERALL UNCERTAINTY 5.92 E-03 6.44 E-03 4.53 E-03 1.07 E-02 9.55 E-03 6.43 E-03 6.70 E-03 5.44 E-03 5.84 E-03 8.47 E-03 8.54 E-03 8.22 E-03 8.67 E-03 Denotes a result less than thc dctcction limit. TABLE A-4.2 I-131 IN HAR AI.FILTER-MARY Results in pCi/cubic meter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE I-131 (I)I-131 (C)1.97E-04-2.82E-04-1.27E-02-1.71E-02 1.29E-02 4.78E-03 572 52 (I)Indicator Stations (C)Control Station I TABLE A-5.1 ("R BF<.T I VIVAT<R Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 26 28 29 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-I 2/01/98 12/01/98-01/05/99 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/0 I/9S 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/0 I/98 07/01/98-08/05/98 08/OS/98-09/02/9S 09/02/98-10/06/98 10/06/98-I I/03/98 11/03/98-12/01/98 12/01/98-01/05/99 River Drinkin 9.1 1.5 1.2 2 5 1.2 1.4~8.7<t: 9Q 1.5 2.2 1.1 2.1 1.9 1.6 2.1 1.1 1.6 24 1.7 1.9 l.7 2.3 9.6 4 Q 1.2 l.4 I.l I.I x 9 3 1.8 2.3 1.3 1.3 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E-OI E-OI E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 6.2 7.0 7.0 8.0 7.0 6.0 7.6 6.7 7.0 7.0 7.0 7.0 7.0 7.0 8.0 8.0 7.0 6.0 9.0 8.0 7.0 7.0 7.0 7.0 6.2 5.8 7.0 7.0 7.0 6.0 7.7 6.8 7.0 7.0 8.0 6.0 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-OI E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-01 E-OI E-01 E-OI E-01 E-01 E-O I E-OI E-01 E-OI E-01 E-01 E-01 E-01 Denotes a result less than the detection limit. TABLE A-5.1 (Cont.)Bi A I W TeR Results in pCi/liter LOCATION 27 COLLECTION .PERIOD 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 RESULT~iachar e 1.5 E+01 2.2 E+01 8.3 E+00 6.7 E+00 1.1 E+00 3.0 E+00 1.0 E+01 7.8 E+00 1.5 E+01 8.4 E+00 4.0 E+00 1.2 E+01 OVERALL-UNCERTAINTY 2.0 E+00 3.0 E+00 1.5 E+00 1.2 E+00 7.0 E-01 8.0 E-01 2.0 E+00 1.6 E+00 2.0 E+00 1.4 E+00 1.1 E+00 2.0 E+00 TABLE A-5.2 R 81<TA I WATER-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER SAMPLES NUMBER POSITIVE River/Drinkin Gr-Beta (I)Gr-Beta (C)1.56E+00 1.45E+00 4.0E-01 8.7E-01 2.4E+00 2.5E+00 24 12 21 10 Gr-Beta (I)9.44E+00~Diechar e 1.1E+00 2:2E+01 12 12 (I)Indicator Stations (C)Control Station I I I I I I I TABLE A-6.1 TRI I I WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 26 28 29 01/06/98-04/01/98 04/01/98-07/01/98 07/01/98-10/06/98 10/06/98-01/05/99 01/06/98-04/01/98 04/01/98-07/01/98 07/01/98-10/06/98 10/06/98-01/05/99 01/06/98-04/01/98 04/01/98-07/01/98 07/01/98-10/06/98 10/06/98-01/05/99 River/Drinkin

  • 1.7 E+01"-4.0 E+01*2.5 E+Ol"5.9 E+01*1.4 E+02 1.4 E+02 2.5 E+02 2.0 E+02": 7.1 E+00*1.9 E+01" 1.7 E+02"'.6 E+01 8.88 E+01 8.20 E+Ol 1.15 E+02 1.08 E+02 9.52 E+01 9.0 E+01 1.2 E+02 1.2 E+02 8.83 E+01 8.53 E+01 1.20 E+02 1.12 E+02 27 01/06/98-04/01/98 04/01/98-07/01/98 07/01/98-10/06/98 10/06/98-01/05/99

~Dischnr e l.0 E+03 l.6 E+03 5.5 E+02": 6.2 E+O1 1.0 E+02 1.0 E+02 1.3 E+02 1.1 E+02 Denotes a result less than thc detection limit. TABLE A-6.1 (Cont.)TRITI I WAT<R Results in pCi/liter L'OCATION'OLLECTION PERIOD RESULT OVERALL UNCERTAINTY 31 (Well 1)03/03/98 06/03/98 09/02/98 12/01/98~round":-4 7 E+00~-9.5 E+00 1.6 E+02"'9 E+01 8.46E+01 8.74E+01 9.0 E+01 1.04E+02 32 (Well 2)03/03/98 06/03/98 09/02/98 12/01/98*-4.7 E+01*-4.3 E+01": 50 E+01"'.2 E+01 8.21E+01 8.56E+01 8.12E+01 1.05E+02 52 (Well 3)03/03/98 06/03/98 09/02/98 12/01/98*4.7 E+01"'.6 E+01 1.9 E+02" 9.0 E+01 8.74E+01 8.98E+01 9.0 E+01 1.06E+02 Denotes a result less than the detection limit. TABLE A-6.2 TRITI M IN YVAT&'R-

SUMMARY

Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE River Drinkin H-3 H-3 1.20E+02 1.53E+01 7.1E+00-4.0E+01 2.5E+02 5.9E+01~round H-3 4.75E+01-4.7E+01 1.9E+02 12~Discher e H-3 8.03E+02 6.2E+01 1.6E+03 g)Indicator Stations (C)Control Station ~p r I I AMMA TABLE A-7.1 PE TR METRY F WVATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 26 01/06/98-02/03/98 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 LA-140 Ra-226 Th-228*-5.16"-4.80": 147*-3.33"'.63"'-2.18"4pp" 1.76"-7.73 x+03*6.73"'.65"-1.56"'-1.25~482"-1.85": 135'"-6.85"'-1.07 x 467" 5.37"'.-3.49": 303" 1.37": 130 x 444" 1.79"-3.85'7 1 E+00 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E-01 E-01 E+02 E+01 E+00 E+01 E-01 E-01 E-01 E-01 E+00 E-01 E-p 1 E+00 E+00 E-01 E+00 E+01 E-01 1.73 2.98 2.00 1.89 3.84 2.02 4.1 1 3.87 2.03 2.23 2.16 5.75 2.45 3.49 3.09 1.51 2.15 1.59 1.54 3.20 1.65 3.38 3.16 1.60 1.77 1.83 5.17 2.25 4.03 3.25 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00, E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE A-7.1 (Cont.)C'AMMA SPFCTR METRY OI WATER Results in pCi/liter. LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 26 03/03/98-04/01/98 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-l34 Cs-l37 Ba-140 L t-140 R't-226 Th-228":-1.67":-3.38 A-6.40 x 1'79" 1.48"'.29":-1.04"'-2.90" 2.08"-4.92 A 8.02*-8.87": 2.30":-4.06~5.51":-1 37~4.44" 1.47"-3.59*2.05"'.6.25~1.61 19 A 340":-3 0~" 9.30":-3.19":-1 89'":-2.68":-5 75 E+00 E+01 E-01 E+00 E+00 E-01 E+00 E-01 E+00 E-01 E-01 E-02 E-01 E+01 E-01 E+01 E+00 E+00 E-01 E+00 E-Ol E+00 E+00 E-Ol E-01 E-Ol E+00 E+00 E+Ol E+00 1.26 1.89 1.26 1.31 2.43 1.36 2.74 2.62 1.38 1.48 1.50 4.14 1.83 3.41 2.95 1.67 2.43 1.74 1.83 3.61 1.95 3.86 4.07 1.95 1.94 1.94 6.59 3.02 4 26 3.57 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00'+01 E+00 Denotes a result less than thc detection limit. TABLE A-7.1 (Cont.)GRAMMA SPF.TR METRY 0F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 26 05/06/98-06/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 0.00"-3.45" 7.86*-6.57"'-2.22~-1.25" 2.96" 5.36 8 4'7": 9.02"'.23": 6.81"-1.26 x 165 x f01 E+00 E+00 E-01 E-OI E-01 E+00 E+00 E-01 E-01 E-01 E+00 E-01 E+00 E+01 E+00 1.50 E+01 2.18 E+01 1.67 E+00 1.54 E+00 3.21 E+00 1.59 E+00 3.44 E+00 3.01 E+00 1.54 E+00 1.78 E+00 1.84 E+00 5.42 E+00 2.34 E+00 3.72 E-01 3.22 E+00 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-S8 Fe->9 Co-60 Zn-65 Zr-9S i4b-9 i Cs-I 34 Cs-137 8;t-I40 L;t-I40 R:t-226 1'It-228": 1.89 7 I'" l.88"" 4.13'"'-I.12.": 7.68"'.I3"4)I"'.Id 6.9()3.g()2.2()E+00 E+00 E-Ol E-Ol E+00 E-0 I E+00 E-0 I E+00 I.-O I E-Ol E-Ol E-0 I E+()I I:+0()1.21 1.81 1.19 1.27 2.39 1.33 2.67 2.51 1.35 1.40 1.46 3.84 1.66 3.37 2 79 E+01 E+Ol E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection lintit. M A TABLE A-7.1 (Cont.)PE TR VIFTRY F%V Results in pCi/liter T<R LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin~ RESULT OVERALL UNCERTAINTY 26 07/01/98-08/05/98 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 1 4'7":-1 31"'-6.51": 8.41 3 4'7" 1.59 7'7"'-2.63" 3.45":-1.62"'.68" 1.94":-4.88 x 117"-9.49":-2.26"-8 06 x 460" 2.73 19"-I 1":-1.21": 8.37": 1.36<<: 282 73'":-1.78":-5 3~3 Po E+01 E+02 E-01 E-01 E+00 E-01 E+00 E+00 E-pl E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-02 E-pl E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 1.77 3.38 1.84 1.92 3.96 1.86 3.89 3.65 1.99 2.05 2.10 7.38 2.69 3.64 3.08 1.58 2.30 1.61 1.65 3.53 1.78 3.37 3.24 1.66 1.77 2.08 6.09 2.60 3.81 3.16 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. v VfMA TABLE A-7.1 (Cont.)PE TR ETRY I'ATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 26 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 CH-137 Ba-140 La-140 Ra-226 Th-228":-6.36"-2.75"'.07":-7.79"-1 9'3 x 9'34": 3.50": 2.61 x 185 x 79'3 x 173 x'398" 1.90": 1.99" 3.23 7 43":-3.05": 9.67": 8.00 A'3 Q7 x 1 34'": 9.88 x Q 3Q": 1.20": 139 1.77": 6.73'":-9.99"'-1.65'7 9]E+00 E+01 E-01 E-01 E+00 E-02 E+00 E+00 E-01 E-01 E+00 E+00 E-01 E+01 E+00 E+00 E+01 E-01 E-01 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E-01 E+01 E+00 1.89 2.31 1.81 1.92 4.41 2.08 4.35 4.06 2.06 2.05 2.1 1 8.18 3.62 3.97 3.53 1.80 2.73 , 1.90 1.90 3.91 2.1 1 4.03 3.71 1.95 1.93 2.07 7.33 3.28 4.43 3.74 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit. TABLE A-7.1 (Cont.)P<TR RY F<W Results in pCi/liter TER LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin RESULT OVERALL UNCERTAINTY 26 11/03/98-12/01/98 12/01/98-01/05/99 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-l37 13<<-l40 La-l40 R;t-226 Th-228*2.16"-5 40 A 6.54 5 g3~1.96"'-8.13*1.57*1.40*5.28"-4.1 1 1 3Q" 1.52" 2.26 x 469*2.73*5.57~-7.71 2'71~-5.98"-4.37'" 6.54": 1.50": 5.71" 1.24" 0.00~1.17 x'754" 5.66 4 9P x'771 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-01 E-01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E+01 E+00 1.62 3.55 1.75 1.78 3.72 1.87 3.89 3.59 1.77 1.92 2.00 5.83 2.27 3.40 2.95 1.67 3.55 1.81 1.84 3.89 1.86 3.82 3.81 1.89 2.04 2.05 5.97 2.41 3.56 3.02 E+01 E+Ol E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+Ol E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection limit. TABLE A-7.1 (Cont.)+AMMA PE TR VIETRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 28 01/06/98-02/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 1.09-5 11"'.22"650" 3.32 x 5pg": 2.45"'.86*1.41"'-9.40":531*5.23"-8.23":-3.60" 6.18 E+01 E+01 E-01 E-01 E+00 E-pl E+00 E-pl E+00 E-01 E-01 E-01 E-01 E+01 E-01 1.67 3.45 1.81 1.76 3.70 1.78 3.87 3.47 1.78 1.95 2.03 5.42 2.16 3.63 3.03 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BB-140 LQ-140 Ra-226 Th-228"ppp":-4.88'.62":-5 34 x 3 37": 8.12": 503"-1.66": 1.58 v 229" 9.88'7 p5":-1~7":-6.75 x'79o E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+01 E+00 1.62 3.45 1.73 1.75 3.73 1.79 3.77 3.56 1.83 1.93 2.03 5.68 2.1 1 3.28 3.05 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection limit. vA TABLE A-7.1 (Cont.)pi E RY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE iver Drinkin RESULT OVERALL UNCERTAINTY 28 03/03/98-04/01/98 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BG-140 LQ-140 RQ-226 Th-228 x 23p 4g"-1.06"-9.30"" ppp":-6.74": 191%-2.03"'.89'.16 x 3 19"'-2.81"-1.01 x'7 23" 9.61"-1 PP~-5.19"'.22" 106": 157": 6.80"'71" 3.68": 319 g 03 x'7'75 y'7 9Q"-8.81": 5.87"565 E+00 E+01 E+00 E-pl E+00 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+01 E-02 E+01 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E-pl E-01 E-pl E+00 E-01 E+01 E+00 1.33 2.13 1.40 1.37 2.97 1.49 3.03 2.69 1.43 1.62 1.88 4.33 1.80 3.37 2.70 1.51 2.40 1.57 1.46 3.27 1.53 3.14 3.20 1.53 1.65 1.73 5.65 2.20 3.81 3~17 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE A-7.1 (Cont.)AMMA PE TR ETRY F W Results in pCi/liter TER LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin RESULT OVERALL UNCERTAINTY 28 05/06/98-06/03/98 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140.La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-I 40 L;t-I 40 R;t-22)6 Tit-22)8*-3.47-7 33" 3.26":-5.20": 339" 2.36": 1.90 4 7g~3.28%-5.32" 5.80": 5.85 7'70":-7.10":-')31": 1.08": 6.06 x 7": 8.70":-4.60'": 4.60"'.I7"I~9" h.l()x-4.3())())x->.85 E-01 E-01 E-01 E-pl E+00 E-01 E+00 E-01 E-pl E-01 E-01 E-01 E-01 E+01 E+00 E+01 E+01 E-01 E-Ol E-Ol E-Ol E+00 E-Ol E-Ol E-OI E-Ol E-Ol E+00 E+Ol E+00 1.06 1.68 1.27 1.20 2.59 1.34 2.73 2 44 1.31 1.38 1.37 3.66 1.65 2.33 2.03 1.38 2.52 1.52 1.49 2.96 1.57 3.14 3.19 1.50 1.77 1.74 4.40 1.92 2.86 2.46 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. GRAMMA TABLE A-7.1 (Cont.)PECTR METRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 28 07/01/98-08/05/98 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-l40 La-I40 Rtt-226 Th-228~1.09":-5 53 94": 9.61*1.32~0.00"-2.20*1.84" 1.83 x 7 57": 2.78*0.00" 5.12":-6 74" 1.54":-1.27"-2.23":-9 09":-1.52":.5.96"-7.06 x g 68":-~.13": 7.64"-9.47'": 7.82":.8.72" 9.93'"-2 09"-9 34 E+01 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E+01 E+00 E+00 E+02 E-01 E+00 E+00 E-01 E+00 E+00 E-Ol E-01 E-01 E+00 E-01 E+01 E+00 2.04 4.50 2.13 2.21 4.69 2.22 4.68 4.45 2.20 2.46 2.40 8.54 3.28 4.10 3.61 1.72 3.11 1.84 1.82 4.03 1.81 3.98 3.72 1.85 2.02 2.04 7.13 2.79 3.59 2.99 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcctinn limit. TABLE A-7.1 (Cont.)GAMMA SPE TR METRV OF WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin RESULT OVERALL UNCERTAINTY 28 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137~Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-l34 Cs-l37 Ba-140 L<<-140 R;t-226 Th-228 x-4 13"-6.27":-3 09"-2.34" 2.63"-1 05*9.15"-3.14" 1.04" 6.09" 3.31 x" 2.29 13":-1.92"-4 50" 8.88":-2.64":573": 7.84 x 38'7 x 355"ppp": l.76""-2.87'": 8.28'6.08'l.l 9':"-1.33'": 1.06 E+00 E+01 E-01 E+00 E+00 E+00 E-01 E-p 1 E+00 E-pl E+00 E+00 E+00 E+01 E+00 E+00 E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E-Ol E-01 E+00 E+00 E+01 E+O1 2.49 5.89 2.55 2.62 5.88 2.55 5.72 5.30 2.68 2.75 2.77 1.14 4.45 5.06 4.39 1.62 3.56 1.71 1.78 3.64 1.76 3.97 3.64 1.86 1.94 1.97 5.86 2.35 3.32 3.10 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection lhnit. AM A TABLE A-7.1 (Cont.)PE>>TR METRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin RESULT OVERALL UNCERTAINTY 28 11/03/98-12/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 4.28":-3.91"'.08 3.27"-1.99~1.39":-9.46~-1.52" 8.39*-1.55 x 57'7"-3.35 x 1'74-2.63"-6.12 E+00 E+01 E-01 E-01 E+00 E+00 E-01 E+00 E-01 E-01 E-01 E-01 E+00 E+01 E+00 1.51 2.23 1.55 1.57 3.16 1.87 3.23 3.20 1.67 1.72 1.78 4.98 2.27 3.69 3.19 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 12/01/98-01/05/99 Be-7 K-40 itin-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 tabb-95 CH-I 34 Cs-137 8;i-I40 L;i-I 40 fk;t-226 Ttt-228"'-6.03"-5.13'7 48 x g 24 4 3g 0.00": 1.49"-1.24": 1.81.":-6.31'" 9.73'7 8'7".-1.36'7 05 x 548 E+00 E+01 E-pl E-pl E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E+00 E+01 E+00 3.02 1.58 3.33 3.08 1.55 1.68 1.69 4.84 1.85 3.08 2.64 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 1.38 E+01 2.90 E+01 1.51 E+00 1.45 E+00 Denotes a result less than thc detection limit. TABLE A-7.1 (Cont.)rAM A PE TR ME RY F%VATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 29 01/06/98-02/03/98 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-]34 Cs-137 Ba-]40 La-140 Ra-226 Th-228"-1.10":-2.38"'.15"ppp x 203*1.40" 1.65": 138 2.73"'.02" 5.51" 1.48":-4 53 1.24" 3.38":-3 59" 1.58": 474" 0.00"466" 2.41"'.66 x 5]4 x x]Q3"-2.61]@9/5": 1.59" 1.28 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E-pl E+00 E+01 E-02 E+00 E-pl E-01 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+0]E+00 1.77 2.66 1.75 1.85 3.56 2.12 4.03 3.78 1.77 2.02 2.16 5.69 2.40 4.38 3.79 1.37 2.13 1.41~1.39 2.91 1.45 3.02 2.68 1.50 1.53 1.86 4.45 2.04 3.38 2.72 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. v IA TABLE A-7.1 (Cont.)PE R ETRY F WAT Results in pCi/liter , LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 29 03/03/98-04/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.91":-1.59'"-7.35":-6.12": 1.62"-3.22":-7.96": 179 x 1 g":-2.09" 2.65": 6.58": 135 x 1'30"-1 60 E+00 E+01 E-01 E-01 E+00 E-01 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+02 E+01 1.44 2.56 1.55 1.62 3.26 1.67 3.27 3.17 1.60 1.76 1.83 4.93 2.02 2.88 2.51 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+Ol E+00 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 R t-226 Th-228" 106 x 18$": 389 x 1'73 x 379":-3 07"-1 40"'31": 1.31" 1.45 x 182":-3 35":-6.87"-5.40":.-8.37 E+01 E+01 E-01 E-01 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+01 E+00 1.49 3.42 1.69 3.16 2.93 1.63 1.71 1.81 5.96 2.53 4.04 3.35 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 1.58 E+01 2.13'+01 1.55 E+00 Denotes a result less than the dctcction limit. vA VIA TABLE A-7.1 (Cont.)PE TR METRV F YVATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 29 05/06/98-06/03/98 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 LQ-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 FG-59 Co-60 Zn-65 Zr-95 i4 b-95 Cs-134 Cs-137 BB-l40-L;t-140 R;t-226 TIt-""$"ppp": 6.72 0'c 1'71" 3.61 x 757 5'73*2.62~-6.28": 1.87": 0.00~1.17"'-6.20": 6.04":-2.20'": 2.96'": 0.00 7')":-l.62": 7.83'l.09 g(\8'0 o ()()'7'$.26 I.46)4()'"-7.56"-7 6$".-7.54 E+00 E+00 E+00 E-01 E-01 E-01 E+00 E-02 E-pl E+00 E+00 E-01 E-01 E+Ol E+00 E+00 E+01 E-01 E-01 E+00 E-02'E+00 E+00 E+00 E-Ol E+00 E-01 E-01 E+01 E+00 1.25 2.03 1.31 1.28 2.52 1.37 2.58 2 54 1.26 1.39 1.52 3.97 1.69 3.25 2.74 1.46 3.56 1.60 1.64 3.30 1.72 3.67 3.21 1.67 1.84 1.89 4.79 1.80 3.22 2.76 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+Ol E+00 Denotes a result less than the dctcction limit. TABLE A-7.1 (Cont.)GRAMMA i%PE TROMETRY F WATER Results in pCi/liter-LOCATION'OL'LECTION 'ERIOD NUCLIDE River Drinkin RESULT OVERALL UNCERTAINTY 29 07/01/98-08/05/98 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BB-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-l 37 Ba-l40 La-l40 Ra-226 Th-228 x 1 69 4 13""-5 01":-1.26":-2.51"-1 45":-1.89" 4.96" 3.51%-2.70"-5.27" 0.00 x 778"'-1.18":-1.85"-1.30"-3.15" 1.13"561": 8.47" 7.79"'.1.48""~06 x 486 x 5'79.": 7.03~446'3.34 7 7')9'7 E+00 E+01 E-01 E+00 E-01 E-01 E+00 E+00 E-01 E-01 E-01 E+00 E-01 E+02 E+00 E+01 E+00 E+00 E-01 E-01 E-01 E+00 E+00 E-02 E-01 E-01 E+00 E+00 E+01 E+00 1.63 2.36 1.56 1.62 3.33 1.74 3.27 3.43 1.57 1.77 1.66 6.78 2.69 3.95 3.30 1.64 2.43 1.66 1.64 3.41 1.77 3.52 3.48 1.58 1.79 1.83 6.69 2.53 4.08 3.36 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction litnit. GRAMMA'ABLE A-7.1 (Cont.)PE TR METRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River/Drinkin RESULT OVERALL~UNCERTAINTY 29 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 R;t-226 Th-228~'20 115"-4.84":-3.16*3.33"-5 19":-1.20"'-1.83"'43":-6.84": 1.26"'335 x 1 p4"-1 09'7 75"'.2.75 x-3 40":-5 73" 0.00 x 479": 1.28":-3.66 39 2 32 2 P4":.403":.3.69:-241": 3.89 E+00 E+01 E-01 E-01 E+00 E-02 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+01 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E-01 E-pl E+00 E-01 E+00 E-01 E-01 E+01 E+00 1.71 3.27 1.77 1.85 3.85 1.80 3.58 3.73 1.93 1.93 1.95 7.70 3.00 3.53 3.13 1.84 2.70 1.89 1.75 4.08 1.90 3 92 3.72 1.91 2.08 2.10 7.08 3.30 4.29 3.81 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction litnit. TABLE A-7.1 (Cont.)GAMMA SPE TR METRV OF WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE River/Dr In kin RESULT OVERALL UNCERTAINTY 29~11/03/98-12/01/98 12/01/98-01/05/99 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 iXh-95 Cs-l34 Ci-137 lk;t-I 0()I;t-IAO lk;t-226 I it-"28":.-9.62"-1.70"-1.80"-4.57"-1.07"1PP"'-2.40"'-8.72 9 94 g 45"'.00"'.83"'-5 93":-2.55"15":-4.28"-2.51"114 7 5'7 x 14/x'7 Q3" 2.16"-5.73 8 2.27": 4.83 1.23-8.37 I.I I'2.37'": 5.88 E+00 E+01 E-pl E-02 E-pl E+00 E+00 E-02 E-01 E-pl E+00 E-01 E-01 E+00 E+00 E+00 E+O1 E+00 E-01 E+00 E-01 E+00 E-p I E+00 E-Ol E+00 E-Ol E-OI E+01 E+00 1.50 2.21 1.49 1.62 3.12 1.76 3.52 3.07 1.63 1.74 1.83 5.07 2.20 4.10 3.31 1.60 2.37 1.65 1.71 3.43 1.91 3.87 3.36 1.75 1.85 1.86 5.48 2.47 3.89 3.42 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes n result less than the detection lhnit. TABLE A-7.1 AMMA SPE TR ETRY F WVATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Dischar e RESULT OVERALL UNCERTAINTY 27 01/06/98-02/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 7.56":-4 74":-1 17"ppp": 1.26":-2.64 3.72 x 9'03": 190": 3.16 x 327": 3.67":-1.56"-5 05 E+00 E+01 E+00 E+00 E+00 E+00 E+00 E-pl E+00 E+00 E+00 E+00 E+00 E+00 E+00 1.76 2.88 1.86 1.88 3.87 1.96 4.07 3.59 1.94 2.03 2.17 5.85 2.89 4.55 3.77 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 iXb-95 Cs-134 Cs-137 B;t-140 L t-I40 R:t-226 Th-228 4'7 x$75":-1 13 x 8 4'7":-6.21"8~3":.947": 1.10": 1.31"115 1.90":-1.98'":-9.76":-6.41 x'7 7'7 E+00 E+01 E-01 E-01 E-01 E-01 E-02 E+00 E+00 E+00 E+00 E+00 E-01 E+01 E+00 1.25 1.82 1.27 1.23 2.46 1.42 2.55 2.55 1.39 1.39 1.46 4.15 1.71 3.35 2.87 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit. AM A TABLE A-7.1 (Cont.)PE TR ETRY.F%ATC<R Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Di.char e RESULT OVERALL UNCERTAINTY 27 03/03/98-04/01/98 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-2.08"-9.34 e'c 8 gp"'.91 rhg2p" 1.43 x 1 97 9c 3g9 x 1 g5"'.65" 169"'-8.53"'-7.31":-3.31 X": 3.88~-7.54 x 465*2.68":-1.31 9 77~0.00 5'77"ppp"000": 1.90":-5.11<<'c]5g"'-3.29 r'c E+00 E+00 E-01 E-02 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E-01 E-01 E+01 E+00 E+00 E+01 E-01 E+00 E+00 E-02 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+01 E+01 1.60 3.51 1.73 1.73 3.52 1.86 3.73 3.36 1.72 1.98 1.97 5.23 2.12 3.29 2.98 1.94 2.56 1.88 1.98 3.88 1.96 4.17 3.94 1.99 2.05 2.13 7.26 2.71 4.89 3.84 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection limit. TABLE A-7.1 (Cont.),AMMA PE TR METRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Dischar e RESULT OVERALL UNCERTAINTY 27 05/06/98-06/03/98 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95.Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228)58'-3.64"'.60 8-6.12~'42":-3.73"-2.37" 1.23": 979 8-2.65~3.1 1*8.45*-9.97 Bc913" 2.68~7.88 x')89 1 99"'-1.38~8.65 6.21*1.45 A 35/":-3.05"'.19'7 04'" 3.08":-9 99~-1.09" 1.48 E+00 E+01 E-01 E-01 E+00 E-01 E-pl E+00 E-01 E-01 E-pl E-01 E-01 E+01 E+00 E+00 E+01 E+00 E-01 E-pl E+00 E+00 E-01 E-01 E-01 E+00 E+00 E-01 E+00 E-Ol 1.36 2.83*1.47 1.46 3.01 1.52 3.31 2 95 1.47 1.61 1.63 4.53 1.69 2.92 2.49 1.49 2.31 1.57 1.49 3.16 2.16 3.48 2.95 1.48 1.56 1.70 5.81 2.24 3.72 3.06 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. AM A TABLE A-7.1 (Cont.)P TR FTRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Digchar e RESULT OVERALL UNCERTAINTY 27 07/01/98-08/05/98 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Y.b-95 Cs-l34 Cs-137 Ba-l4()La-140 Ra-226 Th-228" 4.12 3 94~2.68 9 ,*3.70" 1.27" 1.30": 1.96 ,*0.00" 2.78+3.95"-2.35"-8.16 9 2'7":-6.89 x 85o":-1.61 xo96":-8.42 l 81": 7.69" 0.00" 1.96 x-~l9" 2.31" 0.00"'-1.35"').l 7"7.29 E+00 E+01 E+00 E-01 E+00 E+00 E-Ol E+00 E+00 E-01 E-01 E+00 E-01 E+01 E+00 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E+00 F+00 E+00 E+00 E-Ol 1.68 2.47 1.68 1.67 3.47 1.58 3.58 3.41 1.67 1.65 1.75 6.63 2.67 3.99 3.27 1.96 2.46 1.87 1.91 4.11 2.07 4.17 3.79 2.00 2 02 2.04 7.37 3.49 4.49 3.90 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection liinit. vA A TABLE A-7.1 (Cont.)PE TR METRY F WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Dischar e RESULT OVERALL UNCERTAINTY 27 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 pp 4 19 x 1 3p"-1 PP" 2.42" 3.93*-2.53 1 4g x 55/": 6.44 4g"-1.11"'-5.92 x 6 77": 390" 2.71"-1 Q A g QQ": 5.55": 467 x": 0.00"'.07 xgp9~1.75": 2.35":-~.19" 2.62":-5 70 E+00 E+01 E+00 E+00 E+00 E+00 E-01 E+00 E-01 E-01 E-pl E+01 E-01 E+00 E+00 E+00'+02 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 2.08 4.16 2.15 2.22 4.69 2.35 4.71 4.64 2.28 2.31 2.28 9.27 3.84 4.01 3.43 1.76 3.42 1.87 1~88 3.82 1.91 4.08 3.84 1.91 1.99 2.02 6.89 2.61 3.66 3.1 1 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E 00 E+00 E+00 E+00 E+00 E+00 E+oo E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. MMA TABLE A-7.1 (Cont.)PE TR METRY F<WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE~Discher e RESULT OVERALL UNCERTAINTY 27 11/03/98-12/01/98 12/01/98-01/05/99 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-l40 Ra-226 Th-228": 1.61 x 94'7 v.320"-1 40" 0.00"-6 50 x 1.26+7.56 x g 08~8.87 x 3/4"-4.18 x 1+5"-1.02*-3.99*-4.79'7 96" 8.38'":-6.56" 3.61"'-1.07" 3.86"" o06 3')": 1.70"'.58'-" 4.86'":-1.09"-4.91': 6.79 E+01 E+01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+02 E+00 E-01 E+01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+01 E-01 1.98 5.03 2.06 2.05 4.38 2.20 4.74 4.33 2.17 2.32 2.38 6.85 2.58 4.23 3.58 2.03 5.35 2.19 2.17 4.61 2.22 5.02 4.39 2.26 2.45 2.46 7.22 2.43 4.36 3.73 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. vA MA TABLE A-7.1 (Cont.)PE TR METRY F WATFR Results in pCi/liter" LOCATION COLLECTION PERIOD NUCLIDE~rottnd RESULT GVERALL UNCERTAINTY 31 03/03/98 06/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-l37 B;t-l40 La-I 40 R;t-226 Th-228"-1.21":-3.06" 1.57 x-2 01"-9.70*1.15'.49*1.87*9.50"-1.53 4 Q1"-1.12" 1.95":-1.18": 1.38"'.57*3.84" 6.49"'.66 2 2P": 1.15*-1.32": 395'.2.53~2.1 1'"-6.20 x'797"ppp"-6.87":-1.04 E+01 E+01 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+01 E+00 E+00 E-01 E-02 E+00 E+00 E+00 E+00 E+00 E-01 E-02 E+00 E+00 E+01 E-Ol 1.61 2.59 1.71 1.75 3.59 1.82 4.14 3.59 2.01 1.91 1.97 5.52 2 24 3 29 3.31 1.83 2.69 1.88 1.90 3.76 2.07 4.12 3.79 1.93 2.01 2.06 6.84 2.61 4.90 3.96 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. CvAMMA TABLE A-7.1 (Cont.)PE TR METRY OF WATER Results in pCi/liter COLLECTION LOCATION PERIOD NUCLIDE C ground RESULT OVERALL UNCERTAINTY 31 09/02/98 12/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 CH-134 Cs-I 37 Ba-I 40 La-l40 Rtt-226 Th-228":-2.15":-2.35"000": 1.38"ppp":-1.66"101": 3.69" 1.50*1.44":-3.80":-I 70":-1.69 A 759": 2.82"-2.65":-2.11"-1.13"-I I I x 443": 143~-3.31":.I.24 4 49 x gp5'7 Q7": I.69": 8.08":.-3 49"'.68 E+00 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E-pl E+01 E+00 E+00 E+01 E-pl E+00 E-Ol E+00 E+00 E+00 E+00 E-0 I E+00 E+00 E-02 E+0 I E+00 2.02 2.81 1.92 2.04 3.92 2.05 4.38 4.26 2.09 2.19 2.23 7.90 3.21 5.14 4.21 1.32 1.88 1.38 1.37 2.80 1.49 2.95 2.68 1.51 1.51 1.60 4.62 2.10 3.57 3.08 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc detection limit. MM TABLE A-7.1 (Cont.)PE TR E RY FW Results in pCi/liter TER LOCATION COLLECTION PERIOD NUCLIDE haroun d RESULT OVERALL~UNCERTAINTY 32 03/03/98 06/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'-1.25'-3.96"'.51~-4.03"-1.45":-7 64":-4.28"ppp x 197 3')"-6.10"-3.81 1 9')" 1.05 x"7.79"-1.99" 1.63":-1 39":-3.91"-2.05 x/59": 1.18" 3.92224" 2.61": 2.67 x'7 17"-3.12": 8.86 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-02 E-01 E+00 E+01 E+00 E+00 E+01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+01 E+00 1.89 2.86 1.88 2.08 4.02 2.15 4.27 4.12 2.15 2.07 2.10 7.47 3.61 4.52 3.85 1.59 2.22 1.58 1.70 3.35 1.64 3.36 3.36 1.87 1.79 1.87 6.12 2 52 4.30 3.72 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. AM A TABLE A-7.1 (Cont.)PI>>'.T M>>RY F W Results in pCi/liter T>>R LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 32 09/02/98 12/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BA-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 B't-140 LQ-140 R't-226 Th-228"-5 14"-3.31"-5 01" 3.46 A 5.42": 1.69~1.26":-1.22" 3.83*7.83*5.34"ppp*-2.63"-6 10":-5.71" 9.93"-I 50": 6.91":-1.00 x'))9":477 7')49 ()q v,'>q9 7$"'-I.61" 2.I I"" IA"'.66 E+00 E+00 E-pl E-01 E-pl E+00 E+00 E+00 E+00 E-pl E-01 E+00 E+00 E+00 E+00 E+00 E+01 E-01 E-Ol E+00 E-01 E+00 E+00 E+00 E-01 E+00 E-OI E-0 I E+01 E+00 1.70 2.38 1.65 1.79 3.53 1.85 3.36 3.32 1.94 1.86 1.87 6.53 2.78 4.30 3.67 1.67 3.71 1.82 1.86 3.92 1.89 4.09 3.72 1.94 2.04 2.05 5.86 2.40 3.53 3.19 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE A-7.1 (Cont.)PF.TR METRY F&ATE Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE<<round RESULT OVERALL UNCERTAINTY 52 03/04/97 06/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 130":-1 09": 1.09*-5.43":334":-1.36 x 160"3.33" 1.29":-9.80" 1.53": 157~-1.48":-1.25 x 229":-9.00 x 247":473":.6.82 x 68+x g p5": 475":-9.34": 6.48": 1.03": 9.13'7 99"-1 PP'4.18": 5.98 E+00 E+02 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+02 E+00 E+00 E+01 E-02 E-01 E-01 E-01 E-pl E-02 E-01 E-pl E-02 E+00 E+00 E+01 E+00 1.38 2.74 1.47 1.46 3.02 1.48 3 29 2.97 1.50 1.65 1.61 4.83 1.82 2.91 2.52 1.97 4.31 2.14 2.16 4.39 2.15 4.77 4.41 2.21 2.37 2.36 7.27 2.89 3.95 3.63 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. AMMA TABLE A-7.1 (Cont.)PE TR METRY F W Results in pCi/liter TER LOCATION COLLECTION PERIOD NUCLIDE round RESULT OVERALL UNCERTAINTY 52 09/02/98 12/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-l40 Ra-226 Th-228"-6.43*-1.38 A 2.20" 6.06 x+38" 2.83": 7.36"-1 46 49"-7.39"'-1.86 A 2.40"-2.20":-2.37 x 9'55":-6.25'-3 73":-8.01"-8.78'7 0'7": 4.61 x'739": 343": 1.73'.49": 1.05'7 04":-6.20 v.4 4'7 E+00 E+01 E+00 E-01 E-01 E-pl E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+01 E-pl E+00 E+01 E-01 E-pl E+00 E-01 E-01 E+00 E+00 E-Ol E+00 E+00 E-Ol E+01 E+00 1 72 2.45 1.81 1.74 3.63 1.85 4.10~3.60 1.84 1.90 2.20 6.73 2.99 4.10 3.42 1.46 2.53 1.60 1.65 3.26 1.70 3.59 3.34 1.70 1.78 1.87 5.17 2.20 3.07 2.73 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE A-7.2 CAMMA PE TROMETRY F WATER-

SUMMARY

Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE K-40 (I)K-40 (C)-3.12E+01-3.73E+01 River Drinkin-2.23E+02-1.31E+02 1.58E+01 4.44E+00 24 12 Mn-54 (I)Mn-54 (C)2.26E-01 4.02E-01-1.06E+00-6.51E-01 1.94E+00 1.47E+00 24 12 Co-60 (I)Co-60 (C)8.35E-02 1.12E-O I-3.07E+00-2.18E+00 1.40E+00 2.19E+00 24 12 Co-58 (I)Co-58 (C)-1.14E-O I-8.75E-02-2.34E+00-7.79E-O I 1.06E+00 1.29E+00 24 12 Cs-134 (I)Cs-134 (C)5.23E-02 1.38E-O I-2.29E+00-I.62E+0()2.57E+00 1.37E+00 24 12 Cs-137 (I)Cs-137 (C)6.85E-O I 9.98E-()I-3.19E+()()-2.82E+()() 3.31E+00 2.03E+00 24 12 Nb-95 (I)Nb-95 (C)1.27E+00 8.43 E-()I 4.86E-()2-3.4()I:-()I 3.18E+00 2.08E+00 24 12 0 Zr-95 (I)Zr-95 (C)1.2 I E-()2 2.28E-()I-2.28E+()() -2.82 E+()()4.96E+00 2.61E+00 24 12 (I)Indicator Stations (C)Control Station TABLE A-7.2 (Cont.)AMMA PL<TR ETRY F W TER-MVfARY Results in pCi/liter'NUCLIDE" AVERAGE"OW" HIGH NUMBER NUMBER SAMPLES POSITIVE Zn-65 (I)Zn-65 (C)8.65E-OI 1.92E+00 River/Drinkin -2.68E+00-1.21E+00 5.03E+00 5.37E+00 24 12 Fe-59 (I)Fe-59 (C)1.63E+00 6.16E-01-2.03E+00-2.07E+00 5.96E+00 3.42E+00 24 12 Ba-140 (I)Ba-140 (C)4.56E-01 9.45E-01-3.35E+00-3.19E+00 8.72E+00 6.73E+00 12 La-140 (I)La-140 (C)-1.45E-01-l.12E-01-3.34E+00-'1.89E+00 2.62E+00 2.26E+00 12 (I)Indicator Stations (C)Control Station TABLE A-7.2 (Cont.)AMMA SPI.TROMI:TRY I WATER-

SUMMARY

Rcsuits in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER'UMBER SAMPLES POSITIVE~Discher e K-40 (I)Mn-54 (I)Co-60 (I)Co-58 (I)Cs-134 (I)Cs-137 (I)Nb-95 (I)Zr-95 (I)Zn-65 (I)Fe-59 (I)BQ-140 (I)La-140 (I)-4.72E+01 6.87E-01 6.50E-01-2.56E-01 5.45E-01 1.46E+00 1.01E+00 4.39E-OI 3.60E-01 1.48E+00-9.31E-01-5.13E-01-1.20E+02-1.17E+00-6.50E+00-1.40E+00-1.12E+00-1.42E-01-3.05E-01-3.29E+00-2.64E+00-1.31E+00-1.11E+01-2.19E+00-9.34E+00 2.68E+00 6.21E+00 2.68E+00 1.90E+00 3.24E+00 2.09E+00 3.07E+00 3.86E+00 4.67E+00 4.86E+00 3.67E+00 12 12 12 12 12 12 12 12 12 12 12 0 g)Indicator Stations TABLE A-7.2 (Cont.)GAMMA PE TR METRY F WATER-S MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE~round K-40 (I)Mn-54 (I)Co-60 (I)Co-58 (I)Cs-134 (I)Cs-137 (I)Nb-95 (I)Zr-95 (I)Zn-65 (I)Fe-59 (I)BG-140 (I)La-140 (I)-2.78E+01 4.54E-01 1.86E-01-3.83E-01 2.13E-01 5.02E-01 3.24E+00 I 8.69E-01 1.03E+00 2.34E-01 4.58E-03-4.74E-01-1.09E+02-8.01E-01-2.05E+00-2.01E+00-1.53E+00-2.73E+00 6.48E-01-2.49E+00-4.28E+00-2.20E+00-2.99E+00-2.63E+00 3.84E+00 2.20E+00 1.69E+00 6.82E-01 2.24E+00 4.21E+00 9.50E+00 12 12 12 12 12 12 9.49E+00 3.34E+00 2.67E+00 l.95E+00 12 12 12 3.95E+00 12 g)Indicator Stations TABLE B-8.1 AM A PE TR ETRY F II Results in pCi/kilogram LOCATION 01 07 09 21 23 COLLECTION PERIOD 05/13/98 05/13/98 05/13/98 05/13/98 05/13/98 NUCLIDE K-40 Cs-134 Cs-137 Ra-226 Th-228 K-40 Cs-134 Cs-137 Ra-226 Th-228 K-40 Cs-134 Cs-137 Ra-226 Th-228 K-40 Cs-134 Cs-137 Ra-226 Th-228 K-40 Cs-134 Cs-137 Ra-226 Th-228 RESULT 1.34 E+04~3.71 E+01 3.92 E+01 8.99 E+02 6.24 E+02 1.37 E+04"2.93 E+01 1.66 E+02 9.25 E+02 5.98 E+02 1.25 E+04" 1.92 E+01 7.88 E+01 9.51 E+02 6.18 E+02 1.34 E+04*3.09 E+01 2.30 E+01 6.37 E+02 4.57 E+02 1.67 E+04": 3.34 E+01 9.42 E+01 9.88 E+02 8.67 E+02 OVERALL UNCERTAINTY 2.74 E+02 7.43 E+00 7.09 E+00 1.64 E+02 1.90 E+01 2.79 E+02 6.90 E+00 1.16 E+01 1.63 E+02 1.62 E+01 2.67 E+02 6.52 E+00 1.00 E+01 1.48 E+02 1.65 E+01 2.73 E+02 6.33 E+00 5.89 E+00 1.42 E+02 1.39 E+01 3.40 E+02 8.24 E+00 9.88 E+00 1.73 E+02 2.52 E+01 Denotes a result less than the detection limit. vA TABLE A-8.2 PE TR VIE<TRY F OIL-8 MMAR Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER SAMPLES NUMBER POSITIVE K-40 (I)K-40 (C)1.43E+04 1.25E+04 1.34E+04 1.25E+04 1.67E+04 1.25E+04 Cs-134 (I)Cs-134 (C)3.27E+01 1.92E+01 2.93E+01 1.92E+01 3.71E+01 1.92E+01 Cs-137 (I)Cs-137 (C)8.06E+01 7.88E+01 2.30E+01 7.88E+01 1.66E+02 7.88E+01 Ra-226 (I)Ra-226 (C)8.62E+02 9.51E+02 6.37E+02 9.51E+02 9.88E+02 9.51E+02 Th-228 (I)Th-228 (C)6.37E+02 6.18E+02 4.57E+02 6.18E+02 8.67E+02 6.18E+02 (I)Indicator Station (C)Control Stations TABLE A-9.1 AMMA SPI: TROMI:TRY OF SEDIMENT Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 33 (Upstream) 34 (Downstream) 33 (Upstream) 34.(Downstream) 04/08/98 04/08/98 10/21/98 10/21/98 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 EU-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 1.43"-6.29" 5.31 g 88 4.10 6.60" 6.31 5.23 1.44": 349 2.16*3.89 3.37 9.86 1.58 7.54 1.46":-1.53": 5.32 x 7'74 5.96 1.90 x 775 1.55 1.72": 1.62 2.03": 2.61 1.94 1.13" 1.12 7.22 E+04 E+00 E-01 E+01 E+01 E+02 E+00 E+02 E+04 E+01 E+01 E+01 E+02 E+02 E+02 E+02 E+04 E+01 E+00 E+01 E+01 E+03 E+01 E+03 E+04 E+01 E+01 E+01 E+02 E+03 E+02 E+02 2.80 5.65 6.61 6.81 9.59 1.33 2.86 1.45 3.19 7.20 8.95 8.36 1.59 1.64 2.39 2.44 3.19 8.78 8.50 1.03 1.28 2.37 4.48 2.59 2.97 6.47 7.38 6.98 1.03 1.74 3.24 1.77 E+02 E+00 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+01 E+02 E+01 E+01 E+02 E+00 E+00 E+01 E+01 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+01 E+02 E+01 E+01 Denotes a result less than thc detection limit. TABLE A-9.2 GAMMA SPE TR METRY F EDIMENT-S MMARY Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER SAMPLES NUMBER POSITIVE K-40 K-40 Co-57 Co-57 Co-60 Co-60 Cs-134 Cs-134 (I)1.58E+04 (C)1.45E+04 (I)2.56E+01 (C)-1.08E+01 (I)2.10E+01 (C)2.93E+00 (I)3.25E+01 (C)5.06E+01 1.44E+04 1.43E+04 1.62E+01-1.53E+01 2.03E+01 5.31E-01 2.61E+01 2.88E+01 1.72E+04 I 46E+04 3.49E+01-6.29E+00 2.16E+01 5.32E+00 3.89E+01 7.24E+01 Cs-137 Cs-137 (I)2.66E+02 (C)5.03E+01 1.94E+02 4.10E+01 3.37E+02 5.96E+01 Ra-226 Ra-226 (I)1.06E+03 (C)1.2 8E+03 9.86E+02 6.60E+02 1.13E+03 1.90E+03 Eu-152 Eu-152 1.35E+02 (C)4.19E+0 I I.I 2E+02 6.3 I E+00 I.58E+02 7.75E+01 Th-228 Th-228 (C)7.38E+02 1.04E+03 7.22E+02 5.23E+02 7.54E+02 1.55E+03 (I)Indicator Stations (C)Control Station GRAMMA TABLE A-10.1 Pr.Ta MFVRV F Fr H Results in pCilkilogram (wet)LOCATION COLLECTION DATE NUCLIDE RESULT OVERALL UNCERTAINTY 30 Carp 09/25/98 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-137 Ra-226 Th-228 2.91":-6.93 x 27'7 x 788 6 3g":-4 43"-6 66 4 37 x 2pg":-8.95 E+03 E-01 E+00 E-pl E+00 E+00 E+00 E+00 E+02 E+00 1.71 7.32 8.39 1.94 6.88 1.62 7.63 7.86 1.31 1.15 E+02 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+02 E+00 30 Sucker 09/25/98 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-137 Ra-226 Th-228 3.56" 2.94" 4.22":-1.62": 2.08"'-9 79" 6.44 x I 3'7 x 489" 9.89 E+03 E+00 E-OI E+00 E+00 E+00 E+00 E+01 E+01 E+00 2.06 6.42 7.41 1.82 6.65 1.59 6.99 7.34 1.44 1.23 E+02 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+02 E+01 30 Steelhead 10/06/98 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-l37 Ra-226 Th-228 3.62" 2.51 4 Q5 7')0 x 457" I.14"-3.97 x 86+":-3.42":-9.12 E+03 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+02 E-01 2.07 8.15 8.63 1.83 8.66 1.91 8.76 8.80 1.38 1.25 E+02 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+02 E+01 Denotes a result less than the detection limit. TABLE A-10.1 (Cont.)Vf PE TR VIE<TRY F FI Results in pCi/kilogram (wet)LOCATION 38 Carp COLLECTION DATE 09/24/98 NUCLIDE K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-137 Ra-226 Th-228 3.22": 3.90"-5.02 x 186"'-1.04": 3.20"-4.57" 3.34*-2.13"-6.97 E+03 E+00 E+00 E+01 E+00 E-01 E+00 E+00 E+02 E-01 RESULT 1.75 7.38 8.28 1.93 7.00 1.65 8.11 7.84 1.27 1.14 E+02 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+02 E+01 OVERALL UNCERTAINTY 38 Sucker 09/24/98 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-137 Ra-226 Th-228 3.56"446": 2.98" 1.25 x 269"405" 1.69"" 115":-1.91": 1.36 E+03 E+00 E+00 E+01 E+00 E-01 E-01 E+01 E+01 E+01 1.92 6.03 7.25 1.67 6.40 1.49 6.66 6.45 1.33 1.13 E+02 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+02 E+01 38 Steelhead 10/07/98 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Cs-134 Cs-137 Ra-226 Th-228 4.46": 1.88.": 539": 1.77 5 4'7 x 1 4'7":-4.88": 1.82"'-3.71": 8.82 E+03 E+00 E+00 E+01 E+00 E+00 E+00 E+01 E+02 E+00 2.42 8.99 1.05 2.26 1.02 2.20 1.09 1.06 1.65 1.51 E+02 E+00 E+01 E+01 E+01 E+01 E+01 E+01 E+02 E+01 Denotes a result less than the detection limit. TABLE A-10.2 vA MA PF TR MET F FI H-MMARY Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES'OSITIVE K-40 (I)K-40 (C)3.36E+03 3.75E+03 2.91E+03 3.22E+03 3.62E+03 4.46E+03 Co-60 (I)Co-60 (C)1.10E-01-1.26E+00-6.32E+00-5.42E+00 4.57E+00 2.69E+00 Fe-59 (I)Fe-59.(C)1.60E+00 1.63E+01-1.62E+00 1.25E+01 7.20E+00 1.86E+01 Zn-65 (I)Zn-65 (C)-9.40E-01-2.32E-01-9.79E+00-1.42E+00 1.14E+01 4.05E-01 3 Co-58 (I)Co-58 (C)2.46E+00 1.12E+00 4.22E-01-5.02E+00 4.25E+00 5.39E+00 Cs-134 (I)Cs-134 (C)-1.40E+00-3.09E+00-6.66E+00-4.88E+00 6 44E+00 1.69E-01 Cs-137 (I)Cs-137 (C)8.73E+00 1.10E+01 4.37E+00 3.34E+00 1.32E+01 1.82E+01 Mn-54 (I)Mn-54 (C)1.59E+00 3.41E+00-6.93E-O l 1.88E+00 2.94E+00 4.46E+00 (I)Indicator Station (C)Control Stations TABLE A-1 l.1 I-131 IN MII.K Results in pCi/liter LOCATION COLLECTION DATE RESULT OVERALL UNCERTAINTY 9B 01/13/98 02/10/98 03/10/98 04/14/87 04/28/98 05/05/98 05/19/98 06/02/98 06/16/98 07/14/98 07/28/98 08/04/98 08/25/98 09/01/98 09/22/98 10/13/98 11/10/98 12/08/98 x 1 7 7*-2.5 p x 38 7 p"-1.1 x 2 7"-1.6 2 7~1.5 4*0.0 4 2 3 0" 3.8 x61 4 4 E-02 E-01 E-02 E-pl E-02 E-01 E-pl E-01 E-01 E-02 E-01 E-02 E+00 E-02 E-01 E-02 E-02 E-02 9 21 1.18 7.93 1.53 1.08 2.73 1.29 1.77 1.30 1.94 2.14 1.82 3.06 2.68 3.23 1.84 1.51 4.31 E-02 E-01 E-02 E-pl E-pl E-pl E-pl E-01 E-01 E-01 E-01 E-01 E-01 E-pl E-01 E-pl E-01 E-01 36 01/13/98 02/10/98 03/10/98 04/14/98 04/28/98 05/05/98 05/19/98 06/02/98 06/16/98 07/14/98 07/28/98 08/04/98 08/25/98 09/01/98 09/22/98 10/13/98 11/10/98 12/08/98 A Q 3 x 5 3 g p x'7 x+9 x4S"-1.6":-1.6 x 5 7"74 7)h<5.S~-3.5'7'": 0.0 v.-S 8 E-02 E-02 E-02 E-02 E-02 E-02 E-Ol E-Ol E-02 E-02 E-0 l E-0 l E-02 E-02 E-02 E-Ol E+00 E-02 9.51 1.08 7.86 1.43 1.50 1.55 1.46 1.75 1.43 1.74 3.09 1.66 3.42 1.93 2.36 2.22 1.37 2.78 E-02 E-pl E-02 E-pl E-pl E-01 E-01 E-p 1 E-01 E-pl E-pl E-01 E-01 E-01 E-01 E-pl E-p 1 E-01 Denotes a result less than the dctcction limit. TABLE A-11.1 (Cont.)3 INMI K Results in pCi/liter LOCATION 64 96 COLLECTION DATE 01/13/98 02/10/98 03/10/98 04/14/98 04/28/98 05/05/98 05/19/98 06/02/98 06/16/98 07/14/98 07/28/98 08/04/98 08/25/98 09/01/98 09/22/98 10/13/98 11/10/98 (a)12/08/98 01/13/98 02/10/98 03/10/98 04/14/98 (b)RESULT": 2.7 E-02"'-3.6 E-01"'-2.0 E-02"'.6 E-01" 2.4 E-01"-1.9 E-01":-1.7 E-OI"5.8.E-02"'-1.9 E-02"'.4 E-01"-8.4 E-02":-5.3 E-02":-5.2 E-02 A 9.5 E-02":-3.3 E-02 x 27 E-01 6.4 E-01" 3.2 E-01":-6.8 E-02"'-4.7 E-01": 3.3 E-02 OVERALL UNCERTAINTY 9.68 E-02 1.14 E-01 6.18 E-02 1.74 E-01 1.57 E-01 1.54 E-01 1.64 E-01 2.05 E-01 1.41 E-01 1.96 E-01 2.85 E-OI 1.92 E-OI 1.53 E-OI 2.29 E-OI 2.26 E-01 2.73 E-01 1.4 E-OI 2.67 E-01 1.08 E-OI 1.31 E-01 7.99 E-02 (a)Postive 1-131 result confirmed hy a reanalysis.(b)Farmer withdrew from the program.Denotes a result less than the dctcction limit. TABLE A-11.2 I-131 IW MII.K-8 MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER, NUMBER SAMPLES POSITIVE I-131 (I)-5.06E-03 I-131 (C)(a)-1.68E-01-3.6E-01-4.70E-01 6.4E-01 3.30E-02 54 (a)Farmer withdrew from program.(I)Indicator Stations (C)Control Station I I I I TABLE A-12.1 PE R METRY FMI K Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9B 01/13/98 02/10/98 03/10/98 04/14/98 04/28/98 05/05/98 05/19/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 1.42":430"'.57": 2.11 x g 51 1.30"'.54"'-3.29~-2.03"-4.05 1.31 x 921"-2.04 x-I 31" 6.63 1.29": 1.48"4.21 x 15$"-6 55 1.20": 8.32"'.78":-3.38"-4.87 1.41":-1.06"'-I.01 x'785":-7.60 1.32'.5.30"'-1.41'7":-9.83 E+03 E-01 E+00 E+00 E+00 E+03 E+00 E-01 E+00 E-01 E+03 E-01 E+00 E+00 E-01 E+03 E+00 E-01 E+00 E-OI E+03 E-01 E+00 E-OI E-01 E+03 E+00 E+00 E+00 E-01 E+03 E-01 E-OI E+00 E-01 6.94 2.60 2.59 8.49 3.29 6.32 1.86 1.88 7.41 2.72 6.27 2.01 2.37 5.31 2 25 6.68 1.95 1.87 5.23 2.15 5.87 1.78 1.81 5.17 2.02 5.95 1.92 2.07 6.12 2.52 6.50 1.86 1.90 5.40 1.95 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 2+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)A A PE TR Vl i YRY F NIL Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9B 06/02/98 06/16/98 07/14/98 07/28/98 08/04/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 1.37"'.50*1.77":-2.10"-9.36 1 42*-1.69*6.47"'.79 1 50 1.32" 5.80 3 6'7"-4.51" 1.1 1 1.31"2.99" 1.54"'.76 g 74 1.26"'-6.00 g 2 8')"-3.82*-8.24 E+03 E+00 E+00 E+00 E-01 E+03 E-01 E-01 E+00 E-01 E+03 E-01 E-01 E+00 E+00 E+03 E-01 E+00 E-01 E-01 E+03 E-01 E+00 E+00 E-01 5.85 2.46 2.45 7.17 2.50 5.88 2.17 2.13 5.86 2.10 5.95 2.19 2.22 5.97 2.16 6.66 1.87 1.99 6.31 2.36 6.63 1.87 2.03 6.59 2.55 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 08/25/98 K-40 Cs-134 Cs-137 Ba-140 La-140 1.31 E+03"'-1.31 E+00~1.76 E+00":-3.99 E-01"-5.56 E-01 7.91 2.26 2.26 7.36 3.00 E+01 E+00 E+00 E+00 E+00 09/01/98 K-40 Cs-134 Cs-137 Ba-140 La-140 1.20 x 338>221*-8.73*2.14 E+03 E+00 E+00 E+00 E+00 6.28 2.53 2.56 6.70 2.52 E+Ol E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)AMMA I'I>>.TR METRY I>>I K Results in pCilliter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9B 09/22/98 10/13/98 11/10/98 12/08/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 1.20 E+03": 1.10 E+00": 3.34 E+00" 3.12 E-01":-8.97 E-02 1.18 E+03" 6.02 E-01~2.16 E+00" 2.16 E+00*-1.90 E+00 ,1.12 E+03"-'5.19 E-01": 8 07 E-01"'-6.88 E-01":-5.09 E-01 1,16 E+03": 6.93 E-01"1.01 E+00": 2.16 E+00":-2.33 E-01 5.71 E+01 1.69 E+00 1.75 E+00 4.85 E+00 1.88 E+00 7.16 E+01 2.34 E+00 2.31 E+00 7.88 E+00 3.25 E+00 5.34 E+01 1.62 E+00 1.68 E+00 4.90 E+00 1.88 E+00 6.75 E+01 2.11 E+00 2.06 E+00 5.69 E+00 2.11 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)A MA PE TR METR Y F Results in pCi/liter ILK , LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 36 01/13/98 02/10/98 03/10/98 04/14/98 04/28/98 05/05/98 05/19/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-l.:4 Ci-l.:7 B;t-11()L;t-I 4()K-At)Ci-137 B;t-I40 La-l40 148 x 1 9'7"'.04"-5.05"'-1.93 2.00 A 46'7 A 5.06~-8.87~-6.79 1.35":509": 8.81": 175"-1.31 1.21" 1.62": 199":-3.87":-1.87 1.25":-1.29'" 7.74":-1.20 4 77 1.50':-1.99":399":799'73 1.37'"-4.86 g 64"'457 x E+03 E+00 E-01 E-01 E+00 E+03 E-01 E+00 E-01 E-01 E+03 E-01 E-02 E+00 E+00 E+03 E+00 E+00 E+00 E+00 E+03 E+00 E-01 E+00 E-01 E+03 E-01 E-01 E-01 E+00 E+03 E-01 E+00 E+00 E-01 7.75 2.31 2.29 7.53 3.39 9.07 2.52 2.54 7.92 3.11 6.46 2.43 2.38 6.72 2.44 7.34 2.38 2.43 6.08 2.60 6.73 2.17 2.15 6.11 2.46 6.66 2.31 2.22 7.46 2.93 5.96 1.86 1.83 4.60 2.00 E+01 E+00 E+00 E+00,.E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. AMM TABLE A-12.1 (Cont.)PE TR<RY FMI K Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 36 06/02/98 06/16/98 07/14/98 07/28/98 08/04/98 08/25/98 09/01/98 K-40 Cs-134 Cs-137 Ba-140 LG-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 LG-140 K-40 Cs-134 Cs-137 Ba-140 LB-140 K-40 Cs-134 Cs-137 Ba-140'a-l40 K-40 Cs-134 Cs-137 Ba-140 La-140 1.44": 1.98'.87"'.21~1.74 1.22"'-7.76" 4.09+-3.40*-7.53 1 22 19" 1.60": 1.97"-4.34 1 22'.86 9 44 P,.37$":-2.17 1.35 Q Q9 x":-3.19" l 18 1.33": 2.69':.l.80.": 1.06':--1.35 1.40" 9.06 1.99"-5.31":-6.71 E+03 E+00 E+00 E+00 E+00 E+03 E-01 E-01 E+00 E-01 E+03 E-01 E+00 E+00 E-01 E+03 E+00 E-01 E-01 E+00 E+03 E+00 E+00 E+00 E+00 E+03 E+00 E+00 E+00 E+00 E+03 E-01 E+00 E+00 E-01 5.78 2.17 2.13 5.99 2.39 7.63 2.12 2.18 5.75 2.59 7.45 2.39 2.40 6.42 ,2.57 7.14 2.48 2.31 8.02 2.78 7.81 2.31 2.35 7.55 2.90 7.69 2.38 2.42 7.80 2.94 6.89 2.00 2.01 5.36 2.08 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00, E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. A TABLE A-12.1 (Cont.)PE R<RY F II K Results in pCi/liter LOCATION 36 COLLECTION PERIOD 09/22/98 10/13/98 11/10/98 12/08/98 NUCLIDE K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 RESULT 1.34 E+03":-3.36 E+00"'-3.63 E-01 8 5.37 E+00"'-1.64 E-01 1.31 E+03*2.77 E+00*4.19 E+00~-3.63 E+00"4.95 E-01 1.32 E+03*-1.13 E+00"0.00 E+00*-5.79 E-01"'-9.33 E-01 1.22 E+03*6.01 E-01"'.20 E+00*-6.36 E-01~-L71 E+00 OVERALL UNCERTAINTY 7.76 E+01 2.37 E+00 2.30 E+00 7.31 E+00 2.95 E+00 7.68 E+01 2.36 E+00 2.36 E+00 7.45 E+00 3.24 E+00 6.50 E+01 1.98 E+00 1.95 E+00 5.70 E+00 2.24 E+00 7.53 E+01 2.54 E+00 2.39 E+00 6.56 E+00 2.39 E+00 Denotes a result less than the detection limit. TABLE A-]2.1 (Cont.)AMMA SPE<YR METRY F Results in pCi/liter II.K LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 64 01/13/98 02/10/98 03/10/98 04/14/98 04/28/98 05/05/98 05/19/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 BQ-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-]40 La-]40 K-40 Cs-134 Cs-137 BG-140 La-140 1.34": 8.88": 195" 1.72":-3.54 1.43"-1.10": 2.45": 7.78 x 24/1.27"-1.69"-5 64"'-9.18":-3.06 1.32 ok 4]'7 x'7'75":.-1 99":-4.74 1.42 v.342 xQ'7]":-7 9~" 8.49 1.38 x 649 x 174':.4.83"-8.72].41":.-4.98'"'.66"" 564]0'7 E+03 E-01 E+00 E+00 E-01 E+03 E+00 E+00 E-01 E+00 E+03 E+00 E-01 E-O]E-01 E+03 E-01 E+00 E+00 E-01 E+03 E-01 E+00 E-01 E-01 E+03 E+00 E+00 E-01 E-01 E+03 E-01 E+00 E+00 E+00 7.91 2.23 2.18 7.09 2.70 7.99 2.32 2.42 8.52 3.91 5.77 1.86 2.03 4.91 2.07 6.53 2.42 2.45 6.67 2.57 6.15 2.25 2.25 6.59 2.41 7.52 3.13 3.05 1.02 3.88 6.56 2.40 2.47 6.84 2.41 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)AM A PF TR ETRY I~Results in pCi/liter LOCATION-64 COLLECTION PERIOD 06/02/98 NUCLIDE K-40 Cs-134 Cs-137 Ba-140 La-140 1.61 x 728"106"'.69"'-2.50 E+03 E+00 E+00 E+00 E+00 RESULT 5.16 1.75 1.74 4.99 1.89 E+01 E+00 E+00 E+00 E+00 OVERALL UNCERTAINTY 06/16/98 07/14/98 07/28/98 08/04/98 08/25/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-14O La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 1.14 E+03*0.00 E+00*1.66 E+00"'-3.00 E+00": 1.46 E-01 1.25 E+03": 0.00 E+00*5.62 E-01": 8.17 E+00":-6.18 E-01 1.33 E+03*3.67 E-01"-1.11 E+00"-1.53 E+00":-3.73 E+00 1.34 E+03 1.89 E+00": 3.35 E+00": 5.71 E+00"-6.12 E+00 1.45 E+03" 1.88 E+00": 9.89 E-01"-1.94 E-01~5.40 E-01 7.38 2.42'.43 6.37 2.63 8.03 2.67 2.50 6.77 2.76 6.38 2.03 2.36 6.64 2.81 6.61 2.49 2.57 8.22 3.17 8.17 2.48 2.56 7.63 3.36 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 09/01/98 K-40 Cs-134 Cs-137 Ba-140 La-14O 1.38" 1.13":-1.06" 6.68*2.33 E+03 E+00 E+00 E-01 E+00 6.55 2 34 2.28 5.89 2.35 E+01 E+00 E+00 E+00 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)AMMA SPE TR ETRY F II K Results in pCi/liter LOCATION COLLECTION 'ERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 9/22/98 10/13/98 11/10/98 12/08/98 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 I a-140 1.42 E+03":-3.87 E+00": 1.10 E+00":-3.73 E+00"-2.34 E-01 1.48 E+03~3.41 E-01":-4.48 E+00"'.23 E+00": 2.66 E-01 1.40 E+03": 1.17 E+00~5.37 E-01":4.30 E-ol"-3.69 E-o 1 1.40 E+03"-2.09 E+00":-4.54 E+00":-3.54 E-01" 1.01 E-01 5.93 E+01 2.26 E+00 2.16 E+00 6.25 E+00 2.41 E+00 7.52 E+01 3.07 E+00 3.03 E+00 1.02 E+01 3.66 E+00 5.78 E+01 2.22 E+00 2.15 E+00 6.17 E+00 2.38 E+00 7.01 E+01 2.58 E+00 2.61 E+00 6.89 E+00 2.60 E+00 Denotes a result less than the detection limit. TABLE A-12.1 (Cont.)vA M PF TR ETRY F MIL Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 96 01/13/98 02/10/98'3/10/98 K-40 Cs-13'4 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 K-40 Cs-134 Cs-137 Ba-140 La-140 1.49 E+03"'9.99 E-01" 1.76 E+00"'-9.28 E+00"-2.98 E+00 1.18 E+03"-1.35 E+00": 2.12 E+00"'.47 E+00*1.79 E+00 1.48 E+03":-1.69 E+00"'.51 E+00": 1.40 E+00"-5.40 E-01 7.39 E+01 3.04 E+00 2.99 E+00 9.93 E+00 3.76 E+00 6.21 E+01 2.47 E+00 2.49 E+00 9.22 E+00 3.32 E+00 6.64 E+01 2.22 E+00 2.21 E+00 5.89 E+00 2.07 E+00 Denotes a result less than the detection limit. TABLE A-12.2 AMM PE TR METRY F MII K-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE K-40 (I)K-40 (C)1.34E+03 1.38E+03 1.12E+03 1.18E+03 2.00E+03 1.49E+03 54 Cs-134 (I)Cs-134 (C)9.31E-02-6.80E-01-6.49E+00-1.69E+00 3.38E+00 54 9.99E-01 Cs-137 (I)Cs-137 (C)1.07E+00 2.46E+00-4.54E+00 1.76E+00 5.06E+00 54 3.51E+00 3 Ba-140 (I)Ba-140 (C)8.92E-02-1.37E-01-8.73E+00-9.28E+00 8.21E+00 54 7.47E+00 La-140 (I)La-140 (C)-4.06E-01-5.77E-01-6.12E+00-2.98E+00 2.51E+00 54 1.79E+00 (I)Indicator Stations (C)Control Station I I I I I I TABLE A-13.1 XAAM PF.TR MKTRY F BR AD E F I I IE F MII Results in pCi/kilogram (Net)LOCATION COLLECTION DATE NUCLIDE RESULT OVERALL UNCERTAINTY 9G Grass-Meeker 08/26/98 K-40 Cs-134 Cs-137 Ba-140 La-140 7.37 E+03":-2.23 E+00"'.54 E+00":-1.40 E+00"'.72 E+00 2.63 E+02 8.05 E+00 8.19 E+00 2.95 E+01 1.09 E+01 9G Grass-Meeker 09/22/98 K-40 Cs-134 Cs-137 Ba-140 La-140 5.97 E+03"'-6.97 E+00"-8.34 E-01"'.60 E+01":-1.23 E+01 3.00 E+02 1.23 E+01 1.24 E+01 4.29 E+01 1.56 E+01 9G Grass-Meeker 10/13/98 K-40 Cs-134 Cs-137 Ba-140 La-140 7.76 E+03"4 8~E-01"'.31 E+00": 3.29 E+01"-4.85 E+00 2.65 E+02 8.30 E+00 8.14 E+00 2.88 E+01 1.02 E+01 9G Feed/Corn Meeker 11/09/98 K-40 Cs-134 Cs-137 Ba-140 La-140 4.29 E+03": 2.57 E+00": 7 14 E-01" 3.68 E+00":-6.38 E-01 1.39 E+02 3.73 E+00 3.55 E+00 1.04 E+01 3.70 E+00 9G Corn-Meeker 12/08/98 K-40 Cs-134 Cs-137 Ba-140 La-140 3.72 E+03":-1.35 E+00" 6.30 E+00": 5.02 E+00":-3.71 E+00 1.73 E+02 6.07 E+00 5.90 E+00 1.58 E+01 5.62 E+00 Denotes a result less than thc detection limit. TABLE A-13.2 A PE TR ETRY F BR DI I'AF IN IE F I K-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE K-40 (C)5.82E+03 3.72E+03 7.76E+03 Cs-134 (C)-1.50E+00-6.97E+00 2.57E+00 Cs-137 (C)2.21E+00-8.34E-01 6.30E+00 Ba-140 (C)1.32E+01-1.40E+00 3.29E+01 La-140 (C)-3.16E+00-1.23E+01 5.72E+00 (I)Indicator Station TABLE A-14.1 AMMA PE T METRY F R T Results in pCi/kilogram (wet)LOCATION COLLECTION DATE NUCLIDE RESULT OVERALL UNCERTAINTY 9C Beets 37 Onions 06/16/98 06/16/98 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131~-8.53 E-01"3.10 E+00" 4.77 E+00":-1.38 E+00": 1.69 E+00"-1.14 E+00 3.85 E+00 3.67 E+00 4.23 E+00 3.77 E+00 3.81 E+00 4.31 E+00 9C Potatoes 07/28/98 Cs-134 Cs-137 I-131*5.52 E-01*3.65 E-01"-5.89 E+00 3.98 E+00 3.87 E+00 7.36 E+00 37 Potatoes 9C Potatoes 07/28/98 08/25/98 Cs-134 Cs-137 I-131 Cs-134 Cs-137 1-131" 1.49 E+00"'.60 E+00" 1.34 E+00"'.00 E+00" 1.58 E+00'9.22 E-01 3.26 E+00 3.01 E+00 5.94 E+00 2.75 E+00 2.69 E+00 4.53 E+00 37 Potatoes 9C Potatoes 08/25/98 09/22/98 Cs-134 Cs-l 37 1-131 Cs-l34 Cs-137 I-l 3 I" 9.35 E-01"'.40 E+00":-5.77 E-01": 9 55 E-01~3.15 E+00 x-'7'7'7 E+00 4.93 E+00 4.62 E+00 7.61 E+00 4.01 E+00 4.08 E+00 6.41 E+00 37 Potatoes 09/22/98 Ci-l34 Ci-1.~7 1-1;~I" 7.27 E-01":-2.15 E-o 1 A 2.67 E+00 2.33 E+00 2.20 E+00 3.01 E+00 Denotes a result less than the detection limit. TABLE A-14.2 GRAMMA PE TR METRY F R T-ttMARY Results in pCi/kilogram (Net)NUCLIDE AVERAGE LOKV HIGH NUMBER SAMPLES NUMBER POSITIVE Cs-134 (I)Cs-134 (C)4.43E-01 1.64E-01-1.38E+00-8.53E-01 1.49E+00 9.55E-01 Cs-137 (I)Cs-137 (C)1.37E+00 2.05E+00-2.15E-01 3.65E-01 2.40E+00 3.15E+00.0 I-131 (I)I-131 (C)5.73E-01-6.05E-01-1.14E+00-5.89E+00 2.67E+00 4.77E+00 (I)Indicator Stations M A TABLE A-15.1 PE T METRY F FR IT LOCA11ON COLLECTION DATE Results in pCi/kilogram (wet)I NUCLIDE RESULT OVERALL UNCERTAINTY 9C Cherries 06/16/98 Cs-134 Cs-137 I-131"-3.06 E-01"'.05 E+00":-1.25 E+00 2.33 E+00 2.34 E+00 2.98 E+00 37 Cherries 9C Peaches 37 Peaches 9C Nectarines 37 Nectarines 91 Apples 9C Apples 37 Apples 06/16/98 07/28/98 07/28/98 08/25/98 08/25/98 09/14/98 09/22/98 09/22/98 Cs-134 Cs-137 I-131 Cs-134 Cs-1-37 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 1-131 Cs-134 Cs-137 1-13 l" 4.31 E-01"'-1.65 E+00" 1.39 E+00"-4.80 E-01"'.42 E+00":-2.78 E+00": 3.64 E+00" 7.11 E-01": 3.03 E+00" 2.01 E+00.": 2.25 E+00" 8.38 E-01":-2.66 E+00" 1.20 E+00"406 E-01" 2.17 E+00" 2.01 E+00 x 5 g6 E+00 8 4.42 E+00" 4.16 E+00~-2.47 E+00": 2 41 E+00": 1.50 E+00":-1.44 E+00 3.79 E+00 3.75 E+00 4.35 E+00 2.06 E+00 2.09 E+00 3.98 E+00 3.58 E+00 3.49 E+00 7.57 E+00 2.67 E+00 2.65 E+00 4.38 E+00 2.78 E+00 2.79 E+00 4.58 E+00 5.15 E+00 4.95 E+00 1.06 E+01 4.18 E+00 4.14 E+00 6.34 E+00 3.67 E+00 3.52 E+00 5.29 E+00 Denotes a result less than thc detection limit. -TABLE A-15.2 A A PE TR METRY F FR IT-MMARY Results in pCi/kilogram (wet)NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Cs-134 (I)Cs-134 (C)1.20E+00 1.41E+00-2.66E+00-4.80E-01 3.64E+00 4.42E+00 Cs-137 (I)Cs-137 (C)7.54E-01 2.22E+00-1.65E+00 1.05E+00 2.01E+00 4.16E+00 I-131 (I)I-131 (C)-3.75E-01-1.42E+00-5.26E+00-2.78E+00 3.03E+00 8.38E-01 (I)Indicator Station (C)Control Stations v MMA P<TABLE A-16.1 TR METRY F VI: E AB E~Results in pCi/kilogram (wet)LOCATION 9C Asparagus COLLECTION DATE 05/19/98 NUCLIDE Cs-134 Cs-137 I-131 x 34/": 4.28"'.14 E+00 E+00 E+00 RESULT 4.61 4.S7 5.94 E+00 E+00 E+00 OVERALL UNCERTAINTY 37 Asparagus 9C Asparagus 37 Cucumber 9C Beans 37 Cabbage 9C Cucumber 37 Cabbage 9C Gree nbeans 37 Cabbage 05/1998 06/16/98 06/16/98 07/28/98 07/28/98 08/25/98 08/2S/98 09/22/98 09/22/98 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-137 I-131 Cs-134 Cs-l3 7 I-131 Cs-134 Cs-'37 I-l3l Cs-134 Cs-137 1-131":-1.36 A 2.05"'.51"-1.40" 0.00":-2.85" 1.88": 6.97 x-1.55~1.07~0.00"-4.69+8"115"-1 44~-4.23 x 491": 970": 3.19"" 2.16"114~-8.17" 6.96~2.45 x 344+1.66 x 438 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E-02 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E-OI E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 3.72 3.71 4.78 2 92 2.94 4.26 2.78 2.77 3.53 6.54 6.34 6.53 5.86 5.72 1.13 3.25 3.26 5.33 4.95 4.67 7.87 5.93 5.98 9.61 3.97 4.04 5.18 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 Denotes a result less than thc detection limit. TABLE A-16.2 iA A PE TR ENTRY FVE ETAHI--'VlM RV Results in pCi/kilogram (wet)NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Cs-134 (I)Cs-134 (C)-5.31E-01-2.47E+00-3.44E+00-8.17E+00 1.88E+00 1.07E+00 0 Cs-137 (I)Cs-137 (C)1.42E+00 2.35E+00 6.97E-02 0.00E+00 2.16E+00 6.96E+00 I-131 (I)I-131 (C)-4.85E-01-1.04E+00-4.38E+00-4.69E+00 2.51E+00 1.14E+00 (I)Indicator Statt'on (C)Control Stations +AMMA PE TR TABLE B-2.1 METRY F ST Results in pCi/liter RMD AIN WATER LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 12/29/97-01/07/98 01/16/98-01/26/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-8.93'"-1.57" 1.18'"-1.46~-1.75":-5.46~1.56'-3.33 14"-3.81": 1.62*9.85"-3.32":-3.19":-4.85~3.52"4.77"'-2.62 48" 3.10".-1.35" 0.00~-3.19 x'74Q"-6.53"" 1.03~229 x 4/8 x 4'70 E+00 E+02 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E-01 E+00 E+01 E+00 E-01 E+02 E-01 E+00 E+00 E-Ol E+OG E+00 E+00 E+00 E-OI E+00 E+00 E+01 E+00 1.95 E+01 3.88 E+01 1.97 E+00 2.11 E+00 4.38 E+00 1.94 E+00 4.26 E+00 4.23 E+00 2.15 E+00 2.19 E+00 2.09 E+00 1.03 E+01 3.84 E+00 3.74 E+01 3.31 E+00 2.52 E+01 5.87 E+01 2.56 E+00 2.72 E+00 5.90 E+00 2.58 E+00 5.95 E+00 5A4 F+00 2.77 E+00 2.76 E+00 2.84 E+00 1.13 E+01 4.26 E+00 5.06 E+01 4.30 E+00 Denotes a result less than thc detection limit. TABLE B-2.1 (Cont.)A PE TR METRY F<T RM DR IN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 01/29/98-02/10/98 02/10/98-02/16/98 Be-7 K-40 Mn-54 Co-58'e-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228'":-4.56":-5.66":.6.84'":-3.13" 3.99""1 5'" 5.21~0.00": 1.36 A-5.27": 9.67":753-2.37"-1.59~-8.36~1.61"-1.52 8-1.14":-5.61": 1.52": 1.09"-4.76":-1.47":-8.57":-1.56" 3.28'":-8.75":959":-4.79 v.46+E+00 E+01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E+00 E+02 E+00 E+01 E+01 E-01 E-01 E+00 E-01 E-01 E+00 E-Ol E+00 E-01 E-01 E-Ol E+01 E+00 1.57 E+01 2.47 E+01 1.58 E+00 1.69 E+00 3.79 E+00 1.69 E+00 3.33 E+00 3.44 E+00 1.81 E+00 1.76 E+00 1.78 E+00 7.64 E+00 3.07 E+00 2.85,E+01 2.61 E+00 1.39 E+01 1.91 E+01 1.47 E+00 1.53 E+00 3.21 E+00 1.58 E+00 3.29 E+00 3.09 E+00 1.59 E+00 1.54 E+00 1.61 E+00 6.05 E+00 2.52 E+00 2.80 E+01 2.43 E+00 Dcnotcs a result less than the dctcction limit. TABLE B-2.1 (Cont.)AM A PE TR ETRY F ST RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 02/19/98-02/26/98 03/02/98 (a)Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 x'724':.-~90":-5.50"-6 65 x 3'70": 7 10": 3.17":-2.78":701": 9.81" 1.74":-1.77": 9.78"'.-6.56":-2.08 x 149"-6 46": 1.78"451 x 244"" 1.38" 2.01" 0.00": 3.60'-3.48":-1.05":-9 41":-R 70":.-5 48'6.19 E+00 E+00 E-02 E-01 E+00 E-01 E+00 E-01 E-01 E-01 E+00 E+00 E-01 E+01 E+00 E+01 E+01 E-01 E-01 E+00 E+00 E+00 E+00 E-02 E-01 E-01 E-01 E-Ol E+O1 E+00 1.16 E+01 1.62 E+01 1.23 E+00 1.25 E+00 2.71 E+00 1.34 E+00 2.78 E+00 2.53 E+00 1.35 E+00 1.42 E+00 1.39 E+00 4.74 E+00 2.36 E+00 2.35 E+01 2.10 E+00 1.75 E+01 3.25 E+01 1.78 E+00 1.91 E+00 3.91 E+00 1.77 E+00 3.79 E+00 3.76 E+00 1.81 E+00 2.01 E+00 1.95 E+00 7.45 E+00 2.79 E+00 3.52 E+01 2.99 E+00 (n)Grab Sample Dcnotcs n result less than the detection limit. TABLE B-2.1 (Cont.)A P TR MET Y F<T RM DRAI WATCHER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 03/03/98 (a)03/05/98-03/10/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-I 40 La-140 Rtt-226 Th-228": 6.47"-3.47"140":-1.22":-5.16.": 1.93"-1.89":-4 30": 3.12" I 14"'.33~6.82"-1.79":-3.52":-1.97"'-3.52"-3.86"'.42": 2.85" 4.65~-5.10" 140 x 7 3'7"-6.08 v.')'7I": 1.74".-6.71":-1.70:.390 x I'79 E+00 E+01 E-01 E+00 E-01 E-OI E+00 E-OI E+00 E-01 E+00 E+00 E+00 E+01 E+00 E+00 E+O1 E-01 E-01 E+00 E-01 E+00 E+00 E-OI E-OI E+00 E+00 E+00 E+01 E+00 1.77 E+Ol 3.32 E+01.1.75 E+00 1.81 E+00 3.84 E+00 1.76 E+00 3.73 E+00 3.65 E+00 1.87 E+00 1.95 E+00 1.89 E+00 7.71 E+00 2.94 E+00 3.52 E+01 3.02 E+00 1.71 E+01 2.05 E+01 1.63 E+00 1.76 E+00 4.03 E+00 1.99 E+00 3.68 E+00 3.51 E+00 1.78 E+00 1.94 E+00 1.90 E+00 6.77 E+00 3.29 E+00 3.94 E+01 3.54 E+00 e (a)Grab Sample Denotes a result less than the detection limit. TABLE B-2.1 (Cont.)AMM PE R ETRY F T R DRAI WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 03/13/98-03/19/98 03/23/98-04/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 x3 12"-3.71 x 1 34": 4.82": 4.52".-3.96":-4.61": 1.30" 1.70":-2.00" 2.76": 3:11": 2.25 x-2 08*-1.73" 1.40~-L78 x 1.49": 2.76":-2.86": 1.61" 4.29":-1.33" 3.95'9.76"'-1.84": 4.76':"-2.03~-6.68>ac g 79 E-01 E+01 E+00 E-02 E-01 E-Ol E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+02 E+01 E+01 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E+00 E-Ol E+01 E+00 1.82 E+01 2.89 E+01 1.87 E+00 1.94 E+00 3.94 E+00 1.87 E+00 4.13 E+00 3.90 E+00 1.96 E+00 2.11 E+00 2.18 E+00 7.25 E+00 2.96 E+00 3.36 E+01 2.97 E+00 1.97 E+01 2.66 E+01 1.97 E+00 2.10 E+00 3.94 E+00 2.09 E+00 4.42 E+00 3.84 E+00 2.05 E+00 2.02 E+00 2.05 E+00 9.07 E+00 3.70 E+00 4.80 E+01 3.79 E+00 Denotes a result less than the detection limit. TABLE B-2.1 (Cont.)GAMMA SPECTR METRY F TORM DRAIN WATER Results in pCi/liter LOCATION=COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 04/09/98-04/17/98 04/21/98-04/23/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 I.a-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 CH-134 CN-137 Ba-l40 LD-l40 Ra-226 Th-228": 7.61":-5 70":-6.20"ppp": 2.30" 2.61" 5.63":-9.32"4pp": 2.01": 1.48 x 29'7":-1.48"-5 50"-2.70" 2.82"-4.66": 4.63~-L48":-2.24 x leap"-5 46"'-6.38"150"'-1.92" 1.51"-3.46 x')59":-1.50""-1 06 E+00 E+01 E-02 E+00 E+00 E+00 E+00 E-01 E-pl E-pl E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-pl E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+01 1.65 E+01 3.60 E+01 1.74 E+00 1.79 E+00 3.83 E+00 1.79 E+00 4.05 E+00 3.63 E+00 1.85 E+00 1.94 E+00 1.92 E+00 6.84 E+00 2.83 E+00 3.23 E+01 2.81 E+00 1.67 E+01 2.74 E+01 1.79 E+00 1.74 E+00 3.62 E+00 1.74 E+00 3.80 E+00 3.82 E+00 1.91 E+00 1.97 E+00 1.94 E+00 6.65 E+00 2.83 E+00 3.15 E+01 2.81 E+00 0 Denotes a result less than thc dctcction limni. TABLE B-2.1 (Cont.)AMMA PE TR METRY F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 04/23/98-04/24/98 04/24/98-05/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 3.12"-3.80"'.32"-1.65" 1.60"5.51" 1.31": 1.76~1.57"'-1.04" 1.70"-1 50"'-2.58"-5.48":-3.56" 1.70 x 830" 1.88 x-4 57~1.48": 3.02"-2.41 xg81"-7.57 x g 9]v.5 9":-1.78": 199"~89 E+00 E+01 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+O1 E+02 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 1.73 E+01 3.84 E+01 1.84 E+00 1.73 E+00 3.93 E+00 1.92 E+00 4.17 E+00 3.75 E+00 1.87 E+00 2.02 E+00 2.09 E+00 6.58 E+00 2.32 E+00 3.61 E+01 3.18 E+00 2.61 E+01 5.71 E+01 2.62 E+00 2.76 E+00 6.01 E+00 2.60 E+00 5.82 E+00 5.49 E+00 2.87 E+00 2.89 E+00 2.88 E+00 1.15 E+01 4.27 E+00 5.03 E+01 4.36 E+00 Denotes a result less than the detection limit. TABLE B-2.1 (Cont.)A M PE TR M<T Y FS RMDRAINWATFR Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 05/07/98-05/09/98 05/13/98-05/15/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 1 15": 6.24~-1.20":-2.35": 1.16~2.50": 1.16+6.62".2.15"'-6.51"7.57~7.34 1.44~-9.93~-1.10'"-2.13"-3.23"-1.10 A 0.00'.50~-1.64 A 57'7"'-5.44 v.1 17" 1.20 Q 09'.66":-7.41'.-1.49 x 914 E+01 E+00 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E+00 E+01 E+Ol E+00 E+01 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+02 E+00 1.84 E+01 3.07 E+01 1.92 E+00 1.92 E+00 4.27 E+00 1.97 E+00 3.89 E+00 4.13 E+00 2.05 E+00 2.16 E+00 2.06 E+00 8.51 E+00 3.32 E+00 3.47 E+01 3.02 E+00 1.73 E+01 2.84 E+Ol 1.79 E+00 1.93 E+00 3.95 E+00 1.82 E+00 4.09 E+00 3.81 E+00 1.88 E+00 2.07 E+00 2.22 E+00 6.47 E+00 2.82 E+00 3.39 E+01 2.97 E+00 Denotes a result less than thc detection limit. TABLE B-2.1 (Cont.)M A PE TR METRY F T RM DRAI WATER Results in pCi/liter'OCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 05/19/98-05/23/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 2.72"-1.12"-4.41+2.62"'-1.89" 7.01"-6.16" 3.03"'-3.00" 1.74" 1.91<231":-1.06":-4.68": 4.60 E+00 E+02 E-01 E-pl E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E+01 E+00 2.10 E+01 4.06 E+01 2.17 E+00 2.26 E+00 4.87 E+00 2.11 E+00 4.73 E+00 4.60 E+00 2.24 E+00 2.38 E+00 2.37 E+00 1.00 E+01 4.14 E+00 3.94 E+01 3.63 E+00 05/28/98-06/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 CH-137 Ba-140 La-140 R t-226 Th-228" 1.08'-8.33": 1.07'7'70 v.4 72" 8.45": 3.63":-9.79" 2.01 A 1 53": 1.08" 1.56"-1 43""-9 16":-7.89 E+01 E+00 E+00 E-01 E+00 E-pl E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+01 E-02 1.75 E+01 2.53 E+01 1.73 E+00 1.89 E+00 4.24 E+00 1.89 E+00 4.01 E+00 3.70 E+00 1.96 E+00 1.96 E+00 1.92 E+00 6.74 E+00 3.18 E+00 4.22 E+01 3.76 E+00 Dcnotcs a result less than thc detection limit. TABLE B-2.1 (Cont.)MM PE TR ETRY F RM DRAIN W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 06/05/98-06/10/98 06/15/98-06/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 B t-140 La-140 R t-226 Th-228 x/60 A-2.20 x 764 g Pg*-7.72~-3.30":-1.44" 0.00~4.62": 1.24" 1.53 x'7 9'7~1.42'.51 x 293""-5 6~":.-5.20" 2.69'"-1.98": 1.51":-6.20":-1.23"-1.89""406": 5.36 x 191'":-4.61": 3.96-3 37'"-1.61 E-pl E+01 E-02 E-01 E-01 E-01 E+00 E+00 E-pl E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E+00 E-p 1 E-01 E-01 E+00 E-01 E-01 E-01 E+00 E-01 E-p 1 E+01 E+00 1.41 E+01 1.83 E+01 1.29 E+00 1.38 E+00 2.58 E+00 1.38 E+00 2.73 E+00 2.80 E+00 1.46 E+00 1.45 E+00 1.51 E+00 5.85 E+00 2.50 E+00 3.41 E+01 2.82 E+00 1.55 E+01 3.47 E+01 1.78 E+00 1.75 E+00 3.64 E+00 1.78 E+00 3.74 E+00 3.30 E+00 1.66 E+00 1.91 E+00 2.01 E+00 5.21 E+00 2.12 E+00 3.26 E+Ol 2.91 E+00Denotes a result less than the detection limit. TABLE B-2.1 (Cont.)GRAMMA%PE TROMETRY F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 06/17/98 (a)06/17/98-06/18/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BG-140 La-l40 Ra-226 Th-228 oh+89":-6 99" 3.51 v.253"'.11 x291"-6.71"-2.21 x g 19" 2.13"-2.92"4.07"'-3.06*-3.13"'.18":-3 51*-2.75 x 329"-1.85~-3.51*-1.19" 1.78": 145" l 10<<'2 32" 7.47":-5.10": 6.59 A')75'.72 E+00 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+02 E+01 E+01 E+01 E-01 E+00 E+00 E+00 E+01 E+01 E+01 E+00 E+00 E+00 E+00 E+02 E+00 7.43 E+01 1.13 E+02 7.26 E+00 7.35 E+00 1.64 E+01 7.81 E+00 1.61 E+00 1.52 E+01 7.68 E+00 7.94 E+00 8.23 E+00 2.92 E+01 1.23 E+01 1.67 E+02 1.43 E+01 6.92 E+01 1.64 E+02 7.60 E+00 7.63 E+00 1.50 E+01 7.82 E+00 1.65 E+01 1.57 E+01 7.95 E+00 8.25 E+00 8.59 E+00 2.48 E+01 9.71 E+00 1.34 E+02 1.22 E+01 (a)Special composite sample.Denotes a result less than thc dc(ection limit. TABLE B-2.1 (Cont.)MMA PF.TR ME<TRY F T RM DRAIN WAT i R Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 06/18/98-06/24/98 06/25/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.2.08 x 775"664"-1.13": 3.84"'.60~1.28" 2.07~5.13"-1 10"-1.25"'-1.83 2.72":-7.43":-1.33"'.41""'-1.17":-5.87~-3.03": 2.95" 1.28" 3.95"-1.20" 1.28" 9.38"154": 1.66":.-3.02~-3.04"-5.22 E+00 E+01 E-01 E+00 E-01 E-01 E+00 E-01 E-01 E-01 E+00 E+00 E+00 E+01 E+00 E+00 E+02 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+01 E+00 2.07 E+01 4.13 E+01 2.22 E+00 2.37 E+00 4.94 E+00 2.23 E+00 4.38 E+00 4.62 E+00 2.26 E+00 2.40 E+00 2.47 E+00 9.18 E+00 3.72 E+00 4.06 E+01 3.65 E+00 1.65 E+01 3.05 E+01 1.65 E+00 1.72 E+00 3.70 E+00 1.66 E+00 3.56 E+00 3.48 E+00 1.76 E+00 1.87 E+00 1.90 E+00 7.13 E+00 2.72 E+00 3.34 E+01 2.84 E+00 Denotes a result less than thc detection limit. TABLE B-2.1 (Cont.)AMMA PE TR METRY F T RM DRAI WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 07/02/98-07/06/98 07/09/98-07/15/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40~Mn-54 Co-58 Fe-59 , Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BA-140 La-140 Ra-226 Th-228": 9.80":-4.58 w 349'-9.66"115 x 171 x g 51": 4.97"'.86"'.00": 0.00"-4.75"-6.13" 2.80" 6.75<<-6.18":-1.78 g"0.00"-I 16"-1.86":.2.36": 749": 2.85 9 7'7": 1.22":-4.32 8-6.35" 0.00""-~65'":-6.48 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E-01 E+01 E+00 E+00 E+02 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E-02 E-01 E+00 E+01 E-01 2.75 E+01 6.11 E+01 2.72 E+00 2.79 E+00 5.90 E+00 2.49 E+00 5.88 E+00 5.54 E+00 2.75 E+00 2.95 E+00 2.93 E+00 1.02 E+01 4.14 E+00 5.01 E+01 4.49 E+00 2.00 E+01 4.10 E+01 2.10 E+00 2.05 E+00 4.48 E+00 2.17 E+00 4.38 E+00 4.16 E+00 2.15 E+00 2.27 E+00 2.30 E+00 7.53 E+00 2.91 E+00 3.96 E+01 3.50 E+00 Denotes a result less than thc dctcction limit. TABLE B-2.1 (Cont.)vA A PE TR ETRY F T RM DR IN W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 07/17/98-07/22/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"0.00": 1.18" 4.73~-1.82~3.60 v.4'53" 2.23" 1.74": 1.95~-4.62" 1.49":370":-6.79<-I.70 v.157 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-02 E+00 E+00 E-01 E+01 E+00 1.54 E+01 2.18 E+01 1.54 E+00 1.60 E+00 3.68 E+00 1.58 E+00 3.29 E+00 3.26 E+00 1.66 E+00 1.72 E+00 1.79 E+00 7.14 E+00 3.16 E+00 3.27 E+01 2.96 E+00 07/23/98-07/26/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228":-8.72"I PP":-8.47.":-4.83"-2.50": 5.71'2.15" 2.25" 1.25":-2.10~1.48":.-3.91": 3.89"-2.06"-5.01 E-01 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+01 E+00 1.99 E+01 2.60 E+01 1.86 E+00 1.99 E+00 3.85 E+00 2.03 E+00 4.12 E+00 4.24 E+00 2.10 E+00 1.85 E+00 2.15 E+00 8.39 E+00 3.52 E+00 4.90 E+01 3.89 E+00 Dcnotcs a result less than thc detection limit. TABLE B-2.1 (Cont.), A MA PE TR METRY F T RM DR IN W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 07/31/98-08/04/98 08/05/98-08/1 1/98 Be-7 K-40 Mn-54.Co-58 Fe-59 Co-60 Zn-65 Zr-95 N13-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-4.78"'-4.38"'.89 v-1 50 x 1.18":-4.19"-8.48" 1.92":475" 1.67~4.62": 1.55"'.00":-8.07":-2.26" 9.81":-6.02"651"'.78": 2.56 v.129" 5.01'"-1 45'".2.08': 0.00 2 5Q$87"-I 61'7.45"-5.I 5 E+00 E+01 E-01 E-01 E+00 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+01 E+00 E+00 E+00 E-01 E-Ol E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+0 l E+00 1.63 E+01 2.33 E+01 1.56 E+00 1.53 E+00 3.30 E+00 1.57 E+00 3.27 E+00 3.36 E+00 1.58 E+00 1.72 E+00 1.77 E+00 6.03 E+00 2.39 E+00 3.86 E+01 3.27 E+00 1.98 E+01 2.65 E+01 2.07 E+00 2.10 E+00 4.26 E+00 2.17 E+00 4.37 E+00 3.97 E+00 2.09 E+00, 2.08 E+00 2.38 E+00 7.96 E+00 3.51 E+00 4.61 E+01 3.91 E+00 Denotes a result less than the dctcction limit. TABLE B-2.1 (Cont.)MA P<TR MET Y F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 08/11/98-08/16/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228" 1.31":-3.01":-1.22":-8.12 x'7 62""46~": 304": 1.07 x 204"'-1.32 x 436" 1.31 x 438"-5 44 x 4'97 E+01 E+01 E+00 E-01 E+00 E-01 E-01 E+00 E-01 E-01 E+00 E+00-E-01 E+00 E+00 1.59 E+01 2.21 E+01 1.58 E+00 1.61 E+00 3.28 E+00 1.73 E+00 3.31 E+00 3.27 E+00 1.74 E+00 1.84 E+00 2.01 E+00 6.61 E+00 2.87 E+00 3.80 E+01 3.10 E+00 08/17/98-08/21/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-l37 Ba-l40 La-l40 R t-226 Th-228"" 101"-8.27 K I 99":-1.02 8 7.85<<-5.72" 7.55":.1.25'" 1.70"-3.75":.-1.42": 9.58": 9.95'":-5.84"-7.95 E+01 E+00 E-01 E+00 E-01 E-01 E-pl E+00 E+00 E-OI E-01 E-01 E-pl E+01 E+00 1.73 E+01 2.50 E+01 1.69 E+00 1.61 E+00 3.63 E+00 1.61 E+00 3.30 E+00 3.43 E+00 1.79 E+00 1.77 E+00 1.83 E+00 8.47 E+00 3.35 E+00 4.01 E+01 3.31 E+00 Denotes a result less than the detection limit. TABLE B-2.1 (Cont.)AMMA PE-TR M TRY F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 08/24/98-08/31/98 09/03/98-09/10/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"156 x 289"146"ppp":-1 34":-5.73":-2.83": 5.86 x'728" 0.00 x 4'34":-7.36"-2.58" 9.07": 2.17": 2.08"-4.43":-1 97"155":-1.28"-1 14":-3.35": 193":~.36":355" 6.24": 8.73": 9.59":-4 74 x 1 75 E+01 E+01 E+00 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E-02 E+00 E+00 E+01 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E-01 E-01 E-01 E+01 E+00 1.6'4 E+01 2.25 E+01 1.66 E+00 1.60 E+00 3.54 E+00 1.66 E+00 3.26 E+00 3.34 E+00 1.74 E+00 1.81 E+00 2.04 E+00 7.71 E+00 3.04 E+00 3.80 E+01 3.23 E+00 1.83 E+01 2.71 E+01 1.90 E+00 1.88 E+00 4.05 E+00 2.02 E+00 3.64 E+00 3.85 E+00 1.89 E+00 2.14 E+00 2.14 E+00 6.67 E+00 2.75 E+00 4.54 E+01 3.79 E+00 Dcnotcs a result less than the detection limit. TABLE B-2.1 (Cont.)M PE TR ETRY F T R DRAIN&AT R Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 09/10/98-09/17/98 09/17/98-09/20/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-I 44"-4.30"'.63 9 34"'.42.":-9.16" 1.03~3.71"" 1.35~1.22"'-3.05~-1.48": 4.54":-9 57"-5.26":-7 75":-1.80"-1.47": 1.33 g 74": 0.00<<-2.51 x 4 09"7.09"-8 43"4.16~-1.88" 6.79~-1.00": 703 E+00 E+01 E+00 E-OI E-OI E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+02 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E-OI E-OI E+00 E-OI E+01 E+00 1.35 E+01 2.02 E+01 1.42 E+00 1.37 E+00 2.79 E+00 1.39 E+00 2.94 E+00 2.77 E+00 1.45 E+00 1.59 E+00 1.81 E+00 4.54 E+00 1.90 E+00 3.37 E+01 2.71 E+00 2.40 E+01 5.15 E+01 2.34 E+00 2.63 E+00 5.66 E+00 2.52 E+00 5.63 E+00 5.27 E+00 2.63 E+00 2.63 E+00 2.54 E+00 1.21 E+Ol 4.50 E+00 4.50 E+01 4.02 E+00 Dcnotcs a result less than thc detection limit. TABLE B-2.1 (Cont.)+AMMA PE<TR MFTRY F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 09/24/98-09/28/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 1.47":-2.69~-2.88~-L32'": 1.57 x1 33"-1.08 x 448"-2.22 x 2 09"648":-6.02" 2.64 1 49 x 344 E+Ol E+01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E-02 E+00 E+00 E+01 E+00 2.20 E+01 2.75 E+01 2.01 E+00 2.24 E+00 4.62 E+00 2.17 E+00 4.32 E+00 4.49 E+00 2.05 E+00 2.24 E+00 2.18 E+00 1.23 E+01 5.84 E+00 4.43 E+01 3.96 E+00 10/01/98-10/08/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"7.46": 4.40 3 94":403 x":-2.93"-3.35":-6.42": 1.14": 0.00.": 1.88 1.55":-1.73--1.40": 6.62 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+01 E+00 1.80 E+,01 2.91 E+01 1.81 E+00 1.87 E+00 3.81 E+00 2.21 E+00 3.94 E+00 3.90 E+00 2.02 E+00 2.10 E+00 2.02 E+00 6.67 E+00 2.90 E+00 4.59 E+01 3.87 E+00 Denotes a result less than the dctcction limit. TABLE B-2.1 (Cont.)A M PE TR ETRY F T RM RAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 10/09/98-10/18/98 10/19/98-10/20/98 Be-7 K-40 Mn-S4 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 LB-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95's-134 Cs-137 Ba-140 La-140 Ra-226 Th-228":-7.83":.130": 1.38+5.63":-2.61 145"'.39" 1.94~1.82" 3.61" 4.28*4.50"'-1.21"-8.89":-2.67": 7.10 x 426" 3.69-2.33":-1.32+7.63 x 591 2 22":-3 08": 3.50 xggP A 2.20"-5.10"'-4.58":-7.65 E+00 E+01 E+00 E-OZ E-01 E+00 E-Oi E+00 E+00 E-pl E-01 E+00 E-01 E+00 E+00 E+00 E+Ol E-01 E-pl E+00 E-01 E-01 E+00 E-01 E-01 E-01 E+00 E-p 1 E+01 E+00 1.50 E+01 2.22 E+01 1.48 E+00 1.61 E+00 2.92 E+00 1.70 E+00 3.03 E+00 3.22 E+00 1.58.E+00 1.81 E+00 1.74 E+00 5.62 E+00 2.42 E+00 4.10 E+01 3.42 E+00 1.S2 E+01 2.17 E+01 1.59 E+00 1.S9 E+00 3.16 E+00 1.69 E+00 3.19 E+00 3.16 E+00 1.S8 E+00 1.85 E+00 1.77 E+00 4.98 E+00 2.30 E+00 3.67 E+01 3.14 E+00 Denotes a result less than thc detection limit. TABLE B-2.1 (Cont.)MMA PE TR ETRY F T R DRAI W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 10/21/98-10/29/98 11/06/98-11/12/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 6.84 o'c g 61+-1.73": 3.62": 2.43": 1.75":-5.59": 1.30" 2.32":915" 6.84":-1.95":349'"-5.26":-1.86 r'c 4 g9":-1.85 0'c 1 3'7 x 569 0'c 4 Q4"'.43"000": 1.17"141":-1.36"" 1.23":-1.90": 9.97"'-3.36":-7.61 E+00 E+01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E-O I E-01 E+00 E+00 E+Ol E+00 E+00 E+02 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E-Ol E+01 E-01 1.97 E+01 4.47 E+01 2.03 E+00 2.16 E+00 4.66 E+00 2.13 E+00 4.79 E+00 4.43 E+00 2.20 E+00 2 40 E+00 2.38 E+00 7.17 E+00 2.76 E+00 3.97 E+01 3.58 E+00 1.68 E+01 3.21 E+01 1.77 E+00 1.86 E+00 3.88 E+00 1.77 E+00 3.86 E+00 3.73 E+00 1.90 E+00 2.05 E+00 2.05 E+00 6.63 E+00 2.64 E+00 3.61 E+01 3.18 E+00 Dcnotcs a result less than the dctcction limit. TABLE B-2.1 (Cont.)A A.PE TR METRY F T RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION -PERIOD NUCLIDE-RESULT OVERALL UNCERTAINTY 101 11/12/98-11/22/98 11/23/98-12/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228*-7.27"'.18" 2.02":-3.42":-7.09": 2.69": 7.06"'.24" 1.92*-1.35"'-1.42"-1.10~1.26"'-1.30 A 5'73~-7.81":-1.85"'.83 x 6')'7":-1.81": 2.20 x 50'7~1.31 x g 54":-7 34" 2.31 7 7'.95:<4 9'7 5 E+00 E+00 E-01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+00 E-01 E+01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+01 E+00 1.60 E+01 2.31 E+01 1.55 E+00 1.63 E+00 3.49 E+00 1.59 E+00 3.50 E+00 3.19 E+00 1.67 E+00 1.70 E+00 1.95 E+00 6.56 E+00 3.07 E+00 3.62 E+01 2.92 E+00 1.63 E+01 3.59 E+01 1.65 E+00 1.75 E+00 3.55 E+00 1.91 E+00 3.71 E+00 3.53 E+00 1.82 E+00 1.93 E+00 1.94 E+00 5.78 E+00 2.47 E+00 3.33 E+01 2.99 E+00 Denotes n result less than thc detection limit. TABLE B-2.1 (Cont.)AMMA SPECTR METRY E ST RM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 12/01/98-12/08/98 12/08/98-12/09/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 3.91"-6 56"-1.47"'.48 x 7 33" 1.39"-3.45~-3.42" 9.96":-6.26~242~1.46*5.44":-1.83": 1.83*1.00"-1.01*5.64 x 313" 4.05"-1.09 x]g7"-6.08 x 3'43 A')73" 1.03" 2.07 x')35"-1 14"-3.35 E+00 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E-02 E-01 E+00 E+00 E-01 E+01 E+00 E+01 E+02 E-01 E-01 E+00 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+00 1.95 E+01 4.26 E+01 2.12 E+00 2.10 E+00 4.53 E+00 2.38 E+00 4.99 E+00 4.43 E+00 2.17 E+00 2.44 E+00 2.40 E+00 6.61 E+00 2.55 E+00 4.16 E+01 3.61 E+00 2.71 E+01 7.33 E+01 2.99 E+00 2.94 E+00 6.24 E+00 3.03 E+00 6.64 E+00 6.03 E+00 3.06 E+00 2.28 E+00 3.38 E+00 9.00 E+00 3.31 E+00 5.99 E+01 5.06 E+00 Denotes a result less than thc detection limit. TABLE B-2.1 (Cont.)AMMA SPE TR METRY OF STORM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101 12/09/98-12/19/98 12/21/98-12/29/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 x 121" 8.74":-8.51 x-I 03" 2.61 x 121 151"'-4.25 x 205"'.72": 3.06":-1.64":-2.09" 1.01":-3.80*-5.88*-2.15~1.87" 1.94"ppp"-6.08": 1.06" 1.86"'-4.60": 5.58'74'7')9~5.76 x I')4".6.24 E+Ol E-01 E-pl E+00 E-01 E+00 E+00 E+00 E-pl E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-Ol E-OI E+00 E-pl E+00 E+00 E-02 E-01 E+00 E+00 E-O I E+01 E+00 1.86 E+01 2.64 E+01 1.94 E+00 1.99 E+00 4.11 E+00 2.13 E+00 4.28 E+00 3.85 E+00 2.10 E+00 2.18 E+00 2.18 E+00 6.64 E+00 2.96 E+00 4.12 E+01 3.60 E+00 2.02 E+01 4.34 E+01 2.22 E+00 2.17 E+00 4.56 E+00 2.14 E+00 4.32 E+00 4.40 E+00 2.23 E+00 2.43 E+00 2.36 E+00 7.89 E+00 3.10 E+00 3.94 E+01 3.58 E+00 Denotes a result less than the dctcctinn lhnit. TABLE B-2.2 GAMMA PE TROMETRY OF ST RM DRAIN WATER'UMMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Station 101-utfall Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I), Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)2.56E+00-5.37E+01 1.84E-01-3.39E-01 7.94E-01 3.53E-01 1.04E+00 4.00E-01 1.20E+00 1.24E-01 7.78E-O I 3.72E-O I 1.33E-03-5.84E+0 I-1.81E+00-3.51E+01-2.26E+02-2.88E+00-3.03E+00-3.51E+00-1.09E+01-6.71E+00-6.38E+00-3.19E+00-7.57E+00-4.36E+00-6.7IE+00-3.32E+00-3.l 3 2+02-1.73 2+01 1.70E+01 1.30E+01 3.51E+00 2.53E+00 4.72E+00 2.91E+00 1.78E+01 1.45E+01 1.10E+01 2.73E+00 7.47E+00 7.53E+00 6.59E+00 3.90E+01 1.18E+01 48 48 48 48 48 48 48 48 48 48 48 48 48 48 (I)Indicator Stations I I I TABLE B-3.'R BE AI T R DR Results in pCi/liter IN WATER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 12/29/97-01/07/98 01/16/98-01/26/98 01/29/98-02/10/98 02/10/98-02/16/98 02/19/98-02/26/98 03/02/98 03/03/98 03/05/98-03/10/98 03/13/98-03/19/98 03/23/98-04/03/98 04/09/98-04/17/98 04/21/98-04/23/98 04/23/98-04/24/98 04/24/98-05/03/98 05/07/98-05/09/98 05/13/98-05/15/98 05/19/98-05/23/98 05/28/98-06/03/98 06/05/98-06/10/98 06/15/98-06/17/98 06/17/98-06/18/98 06/17/98 (a)06/18/98-06/24/98 06/25/98-07/01/98 07/02/98-07/06/98 07/09/98-07/I 5/98 07/17/98-07/22/98 07/23/98-07/26/98 07/31/98-08/04/98 08/05/98-08/11/98 08/I I/98-08/16/98 08/17/98-08/21/98 08/24/98-08/31/98 09/03/98-09/10/98 09/10/98-09/17/98 09/I 7/98-09/20/98 09/24/98-09/28/98 10/01/98-10/08/98 10/09/98-10/18/98 10/19/98-10/20/98 -10/21/98-10/29/98 11/06/98-11/12/98 11/12/98-11/72/98 ": 2.8 x I 8 x I 8": 1.9 9.3 7.3 3.6"'.0 2.6 3.7 7 5.2 x I 9 3.1 x 2 3 x 29 3.2 34" 2.8 x 4 2 3.8 9":30 3.0 4.7 4 2 7 8": 1.6 3.0 7 5 7": 2.6 3 4": 3.2 5.6 3 4 4.8 3.5": 1.7 4.6 5.8 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 2.08 E+00 2.01 E+00 2.05 E+00 2.06 E+00 1.70 E+00 2.8 E+00 2.5 E+00 1.9 E+00 1.96 E+00 1.7 E+00 2.2 E+00 1.68 E+00 2.2 E+00 2.02 E+00 2.1 E+00 2.00 E+00 2.07 E+00 1.9 E+00 2.1 E+00 2.05 E+00 5.42 E+00 1.9 E+00 1.98 E+00 1.73 E+00 2.1 E+00 2.0 E+00 1.9 E+00 2.47 E+00 1.89 E+00 2.0 E+00 2.01 E+00 1.89 E+00 2.06 E+00 2.42 E+00 2 41 E+00 2.5 E+00 2.41 E+00 2.1 E+00 2.0 E+00 2.05 E+00 2.3 E+00 2.3 E+00 (a)Grab sample;gross beta analysis not performed. Denotes a result less than thc dctcction limit. TABLE B-3.1 (Cont.)R S BETA IN TORM DRAIN WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 11/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/18/98 12/21/98-12/29/98 3.9 E+00"'.1 E+00 4.1 E+00 4.7 E+00" 5.8 E-01 2.1 E+00 1.88 E+00 2.0 E+00 2.0 E+00 5.61 E-01 Denotes a result less than thc dctcction limit. TABLE B-3.2+ROSS BETA IN ST RM DRA'IN WATER-

SUMMARY

Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Station 101-Outfall Gross Beta (I)3.27E+00 3.0E-01 9.3E+00 47 22 g)Indicator Stations I I TRI I TABLE B-4.1 IN T RM DRAI Results in pCi/liter WATER LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 12/29/97-01/07/98 Ol/16/98-01/26/98 01/29/98-02/10/98 02/10/98-02/16/98 02/19/98-02/26/98 03/02/98 03/03/98 03/05/98-03/10/98 03/13/98-03/19/98 03/23/98-04/03/98 04/09/98-04/17/98 04/21/98-04/23/98 04/23/98-04/24/98 04/24/98-05/03/98 05/07/98-05/09/98 05/13/98-05/15/98 05/19/98-05/23/98 05/28/98-06/03/98 06/05/98-06/10/98 06/15/98-06/17/98 06/17/98 06/17/98-06/18/98 06/18/98-06/24/98 06/25/98-07/01/98 07/02/98-07/06/98 07/09/98-07/15/98 07/17/98-07/22/98 07/23/98-07/26/98 07/31/98-08/04/98 08/05/98-08/l I/98 08/11/98-08/16/98 08/17/98-08/21/98 08/24/98-08/3 l/98 09/03/98-09/10/98 09/10/98-09/17/98 09/17/98-09/70/98 09/24/98-09/28/98 10/01/98-10/08/98 10/09/98-10/18/98 10/19/98-10/70/98 10/21/98-10/79/98 (a)(a)(b)(c)1.2 1.5 9.5 1.1 3.8 X+59 7*-2.3 2.9" 2.8*2.6 1.7*-7.1*7.0" 2.8*-2.8 3 8" 2.4 x 4 7'7 5 5'7 x 55" 7.3 2 5"40 3" 5.8 l.6"').0" 8.5" 1.0 3.0 3.7" 4.1 2.7'" 8.8 E+03 E+03 E+02 E+03 E+02 E+02 E+01 E+00 E+00 E+02 E+01 E+OI~E+02 E+02 E+00 E+01 E+01 E+01 E+01 E+00 E+01 E+00 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+01 E+02 E+01 E+01 E+02 E+02 E+02 E+O1 E+02 E+Ol 2.0 2.0 2.3 2.0 1.0 9.1 8.8 8.5 5.9 1.0 9.6 9.21 1.0 9.65 8.36 9.26 8.48 9.S6 9.51 9.38 8.92 9.61 8.82 9.16 8.65 8.59 1.0 9.11 9.02 8.97 9.0 9.95 1.70 1.71 1.8 1.8 1.05 1.1 1.76 E+02 E+02 E+02 E+02 E+02 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+02 E+01 E+Ol E+01 E+01 E+01 E+01 E+01 E+01 E+00 E+01 E+01 E+01 E+01 E+02 E+01 E+01 E+01 E+01 E+01 E+02 E+02 E+02 E+02 E+02 E+02 E+02 (a)Grab sample (b)Grab sample;tritium analysis not pcrformcd.(c)Tritium analysis not pcrformcd. Dcnotcs a result less than thc dctcction limit. TABLE B-4.1 (Cont.), TRITIUM IN ST RM DRAIN WATFR Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 101 11/06/98-11/12/98 11/12/98-11/22/98 11/23/98-12/01/98 12/01/98-12/08/98 12/08/98-12/09/98 12/09/98-12/19/98 12/21/98-12/29/98 6.0 E+02 4.5 E+02 5.9 E+02 5.4 E+02 2.1 E+02 1.0 E+03 3.7 E+03 1.3 E+02 1.8 E+02 1.8 E+02 1.3 E+02 1.1 E+02 1.0 E+02 2.0 E+02 TABLE B-4.2 TRITIUM IN T RM DRAIN WATER-8 MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE tation 101-utfall H-3 (I)3.25E+02-5.2E+01 3.7E+03 46 19 0)Indicator Stations I l I I I STORM DRAIN VEGETATION RESULTS I TABLE B-7.1 AMMA PE TR METRY F T RM DRAIN VE vETATI N Results in pCi/kilogram LOCATION 101 COLLECTION PERIOD 08/17/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 RESULT*1.23 E+02 3.02 E+03*2.24 E+00" 1.05 E+00*2.43 E+00 A-3.78 E+00*2.68 E+01*6.59 E+00*1.75 E+01*-1.48 E+01*-1.21 E+00*-4.97 E+00*-5.87 E+00,*-3.21 E+01+4.44 E+01 OVERALL UNCERTAINTY 1.25 E+02 2.60 E+02 1.28 E+01 1.32 E+01 2.83 E+01 1.26 E+01 2.85 E+01 2.59 E+01 1.34 E+01 1.38 E+01 1.42 E+01 5.28 E+01 1.94 E+01 2.38 E+02 2.08 E+01 Dcnotcs a result less than the detection limit. TABLE B-7.2+AMMA P<TR ME<TRY I T RM DRAI VE ETA I Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Co-60 (I)Co-58 (I)Cs-134 (I)Cs-137 (I)Nb-95 (I)Zr-95 (I)Zn-65 (I)Fe-59 (I)Ba-140 (I)La-140 (I)1.23E+02'.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01.6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 1.23E+02 3.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01 6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 1.23E+02 3.02E+03 2.24E+00-3.78E+00 1.05E+00-1.48E+01-1.21E+00 1.75E+01 6.59E+00 2.68E+01 2.43E+00-4.97E+00-5.87E+00 0 (I)Indicator Stations TABLE B-5.1 CAMMA SPECTR METRY F T RM DRAIN SEDIMENT Results in pCi/kilogram LOCATION 101 COLLECTION PERIOD 03/25/98 06/18/98 NUCLIDE K-40 Co-57 Co-60 Zn-65 Co-58 Mn-54 Cs-134 Cs-137 CG-141 Ra-226 EU-152 Th-228 K-40 Co-57 Co-60 Zn-65 Co-58 Mn-54 Cs-134 Cs-137 Ce-141 Ra-226 Eu-152 Th-228 RESULT 4.49 E+03":-4.27 E+00 2.07 E+02" 9.05 E+00"-7.10 E+00"'.06 E+00" 5.17 E+00 3.80 E+01~1.51 E+00 8.10 E+02"3.64 E+01 3.63 E+02 5.22 E+03":-2.07 E+00 1.40 E+02" 5.63 E-O I"'-8.68 E+00"'.12 E-01": 1.92 E+01 4.44 E+01": 6.72 E+00 8.41 E+02*2.23 E+01 4.34 E+02 OVERALL UNCERTAINTY 1.79 E+02 5.32 E+00 1.36 E+01 1.50 E+01 5.68 E+00 5.78 E+00 6.44 E+00 8.55 E+00 1.00 E+01 1.55 E+02 2.66 E+01 1.41 E+01 1.89 E+02 5.26 E+00 1.18 E+01 1.31 E+01 5.23 E+00 5.73 E+00 6.39 E+00 8.54 E+00 9.30 E+00 1.50 E+02 2.67 E+01 1.85 E+01 Denotes a result less than thc detection limit. TABLE B-5.2 A MA PE TR METRY F T RM DRAIN EDIME<NT-Results in pCi/kilogram ARY NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE tation 101-tttfa)1 K-40 (I)Mn-54 (I)Co-57 (I)Co-58 (I)Co-60{I)Zn-65 (I)Cs-134{I)Cs-137{I)Ce-141{I)RR-226 (I)Eu-152{I)Th-228 (I)4.86E+03 1.59E+00-3.17E+00-7.89E+00 1.74E+02 4.81E+00 1.22E+01 4.12E+01 4.12E+00 8.26E+02 2.94E+01 3.99E+02 4.49E+03 1.12E-01-4.27E+00-8.68E+00 1.40E+02 5.63E-01 5.17E+00 3.80E+01 1.51E+00 8.10E+02 2.23E+01 3.63E+02'.22E+03 3.06E+00-2.07E+00-7.10E+00 2.07E+02 9.05E+00 1.92E+01 444E+01 6.72E+00 8.41E+02 3.64E+01 4.34E+02 2 (I).Indicator Stations TABLE B-6.1 A MA PE TR METRY F 7 RM DRAIN II Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 101A 101B 101A 101B 101A 03/25/98 03/25/98 06/30/98 06/30/98 09/17/98 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 1.10 1.55": 8.35" 2.68 3.64 7.96 5.48 1.04 149*4.18+2.78 3.67 6.89 4.94 1.01 1.54*2.75+2.92 3.02 8.35 5.25 1.85 1.46" 3.36*2.47 3.08 6.77 5.04 1.34 1.47*6.42"'.31 3.30 7.82 1.68 E+02 E+04 E-02 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 E+02 E+04 E+00 E+Ol E+01 E+02 E+02 E+02 E+04 E+00 E+01 E+01 E+02 E+02 5.83 2.75 5.45 6.48 6.95 1.53 1.47 5.76 2.92 5.74 6.49 7.46 1.58 1.49 5.86 3.08 6.06 7.09 6.32 1,51 1.59 7.26 3.27 6.86 7.64 8.63 1.73 1.63 6.97 2.95 6.32 7.31 7.27 1.55 2.10 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+01 E+02 E+00 E+00 E+00 E+02 E+01 E+Ol E+02 E+00 E+00 E+00 E+02 E+01 Denotes a result less than the detection limit. TABLE B-6.1 AM A PE TR ME<TRY F T RM DRAI II Results in pCi/kilogram LOCATION 101B COLLECTION PERIOD 09/17/98 NUCLIDE Be-7 K-40 Mn-54 Cs-134 Cs-137 Ra-226 Th-228 RESULT 1.81 E+02 1.62 E+04"4.44 E+00*1.65 E+01 2.99 E+01 8.85 E+02 5.61 E+02 OVERALL UNCERTAINTY 7.55 E+01 3.10 E+02 6.09 E+00 7.13 E+00 7.78 E+00 1.64 E+02 1.62 E+01 Dcnotcs a result less than thc dctcction limit. vA TABLE B-6.2 PK TR METRY F T RM DRAIN II-Results in pCi/kilogram ARY NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Cs-134 (I)Cs-137 (I)1.36E+02 1.52E+04 3.54E+00 2.47E+01 3.28E+01 Th-228 (I)4.67E+02 Ra-226 (I)'.77E+02 1.01E+02 1.46E+04 8.35E-02.1.65E+01 2.99E+01 6.77E+02 1.68E+02 1.85E+02 1.62E+04 6.42E+00 2.92E+01 3.67E+01 8.85E+02 5.61E+02 (I)Indicator Stations TABLE B-8.1 R ALPHA IN ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 102A 102C Prior to Discharge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/98 05/20/98 10/21/98 10/21/98*1.5 E+00*2.5 E-01*2.2 E-01*1.4 E+00*-8.5 E-01*1.0 E+00*0.0 E+00*4.9 E-01*2.0 E-01+1.9 E+00*6.4 E-01*0.0 E+00*6.8 E-01*2.4 E+00 A 6.4 E-01*0.0 E+00 1.61 E+00 1.79 E+00 1.58 E+00 2.02 E+00 1.04 E+00 1.43 E+00 1.71'E+00 1.54 E+00 1.23 E+00 1.74 E+00 1.55 E+00 2.86 E+00 1.36 E+00 2.45 E+00 1.13 E+00 9.54 E-01 Dcnotcs a result less than thc.dctcction limit. TABLE B-8.2 PRO S Al PHA IN ANITARY WA TE TREATMENT WATER-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW 102A HIGH NUMBER NUMBER SAMPLES POSITIVE Gr-Alpha (I)5.63E-01-8.5E-01 1.9E+00 12 Gr-Alpha (I)5.90E-01 102-Prior to Disehar e-6.8E-01 2.4E+00 g)Indicator Stations TABLE B-9.1 R S BETA I S NITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD RESULT OVERALL UNCERTAINTY 102A 102C Prior to Discharge 01/16/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/01/98-10/06/98 10/06/98-11/03/98 11/03/98-12/01/98 12/01/98-01/05/99 05/20/98 05/20/98 10/21/98 10/21/98 3.2 E+01 3.1 E+01 2.1 E+01 2.9 E+01 2.4 E+01 4.1 E+01 3.6 E+01 3.5 E+01 1.7 E+01 2.9 E+01 2.5 E+01 3.3 E+01 3.2 E+01 3.3 E+01 4.1 E+01 4.1 E+01 2.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 3.0 E+00 3.0 E+00 3.0 E+00 2.0 E+00 2.0 E+00 2.0 E+00 4.0 E+00 4.0 E+00 4.0 E+00 3.0 E+00 3.0 E+00 TABLE B-9.2 R BETA N ANITARYWA TET E T ENTWATER-ARY NUCLIDE AVERAGE Results in pCi/liter LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 102A Gr-Beta (I)2.94E+01 1.7E+01 4.1E+01 12 12 2-Prior to Di char e Gr-Beta (I)3.65E+01 3.2E+01 4.1E+01 (I)Indicator Stations AMM PE TR METR Y TABLE B-1 p.I F ANITARY W TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD'UCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 01/21/98 02/25/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228*-7.54 5.68*1.03 A-6.05" 1.73" 1.69*2.07"-2.26*6.50*-4.40" 8.65" 2.93*-2.47+-4.64"-5.88 x ppp*2.00*-1.80 1 99*2.07*7.23 14"-1.91 x 724 3 59 3'71"-9.35 35"-4.25'7 19 E-01 E+01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E-01 E-pl E+00 E-01 E+Ol E-01 E+00 E+01 E+00 E-01 E+00 E-01 E-01 E-01 E-01 E-02 E+00 E-01 E-01 E+01 E-01 1.70 2.84 1.83 1.86 3.90 1.81 3.89 3.61 1.86 2.03 1.99 6.47 2.47 3.65 3.09 1.31 2.20 1.39 1.40 2.93 1.57 3.18 2.70 1.44 1.59 1.83 4.31 1.89 3.34 2.73 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE B-10.1 (Cont.)A MA PE TR METRY F A ITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B MontMy Head works 03/18/98 04/15/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140, Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 370¹-L68": 5.38¹-6.21*'7.60*-9.79*-1.20"-1.49*2.29*1.68*1.06¹-3.63 8-6.54*-2.17*-3.93" 1.09"-5.19" 5.57*-7.82" 1.32": 5.09"'.2.19¹3.34¹1.86¹-1.22 x 124"-6.58"-1.97¹-1.35 E+00 E+01 E-01 E-01 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+01 E-01 E+01 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E+00 E+01 E-02 1.31 2.75 1.46 1.43 3.03 1.48 2.99 2.89 1.47 1.64 1.63 4.46 1.75 2.98 2.61 1.38 2.88 1.48 1.48 3.01 1.47 3.19 2.90 1.46 1.64 1.66 4.59 1.74 3.08 2.56 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00¹Denotes a result less than the detection limit. TABLE B-1 p.1 (Cont.)AMMA PECTR METRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102D North Stabilization Pond 05/12/98 11/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"ppp":-3.98"-2.73"-5.02"ppp": 8.67" 2.06": 2.44": 8.63": 979 4995*3.18":-1.28":-5.27"-6.03*1.72 x 193"'-6.54":-1.21": 2.94": 2.00"-1 05"41P"'.95"'-1.77"'.39": 4.38"-2.18":-1.48"-2.96 E+00 E+00 E+00 E-pl E+00 E-01 E+00 E+00 E-02 E-02 E-01 E+00 E+00 E+00 E-01 E+01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+02 E+00 1.50 E+01 2.27 E+01 1.44 E+00 1.56 E+00 3.27 E+00 1.65 E+00 3.24 E+00 3.05 E+00 1.51 E+00 1.71 E+00 1.74 E+00 5.23 E+00 2.05 E+00 4.01 E+01 3.11 E+00 1.85 E+01 3.26 E+01 1.97 E+00 1.96 E+00 4.30 E+00 1.91 E+00 4.29 E+00 4.00 E+00 2.08 E+00 2.17 E+00 2.28 E+00 7.35 E+00 2.80 E+00 3.49 E+01 3.20 E+00 Denotes a result less than the dctcction limit. TABLE B-10.1 (Cont.)A A PE TR ME<TRY F ANITARY%TE<TR A MENT&AT Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102E South Stabilization Pond 05/12/98 11/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-l40 Ra-226 Th-228*-3.61*1.15*1.39"3.82*1.41"-2.70*1.89*-7.31~1.48*1.31*1.31*2.14*-2.09*-5.33+-6.29 4 931*-9.06*-7.19"-1.25*5.37*9.46" 1.83'-1.89"'.27*-7.75" 1.60": 1.26"-7.19":-1.16'6.57 E+00 E+01 E+00 E-02 E+00 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+00 E+01 E-02 E+00 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E+00 E-01 E+02 E-01 1.25 E+01 1.94 E+01 1.26 E+00 1.30 E+00 2.56 E+00 1.26 E+00 2.66 E+00 2.70 E+00 1.35 E+00 1.39 E+00 1.54 E+00 4.31 E+00 1.72 E+00 3.34 E+01 2.80 E+00 2.06 E+01 5.01 E+01 2.14 E+00 2.23 E+00 4.81 E+00 2.11 E+00 4.93 E+00 4.45 E+00 2.31 E+00 2.29 E+00 2.37 E+00 9.22 E+00 3.50 E+00 4.18 E+01 3.55 E+00 Denotes a result less than thc dctcction limit. vAMMA TABLE B-10.1 (Cont.)TR METRY F ANIT RY WA TE TREAT E T W TER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 01/06/98-02/03/98 02/03/98-03/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228~-3.51" 6.84*-6.26*-8.01~1.21*9.05*1.16~7.94+2.46*-1.18*1.16"-1.44*7.59+-7.28*-8.49*6.56*1.28*1.14*5.09*2.96~5.26*-4.51+-2.61*3.32*1.82~195*1.96"-6.36*-7.53*8.08 E-01 E+00 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+01 E-02 E+00 E+01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E-01 E-01 E+00 E-01 E+01 E+00 1.10 E+01 1.69 E+01 1.22 E+00 1.23 E+00 2.65 E+00 1.39 E+00 2.66 E+00 2.40 E+00 1.27 E+00 1.35 E+00 1.34 E+00 3.92 E+00 1.77 E+00 2.34 E+01 2.04 E+00 1.76 E+01 3.94 E+01 1.90 E+00 1.97 E+00 4.27 E+00 1.94 E+00 4.30 E+00 3.77 E+00 2.01 E+00 2.22 E+00 2.12 E+00 6.23 E+00 2.50 E+00 3.50 E+01 3.19 E+00 Denotes a result less than the dctcction limit. TABLE B-10.1 (Cont.)v MMA PE TR METRY F'NIT RY WA TE TREAT EN Results in pCi/liter WATER COLLECTION ~LOCATION..PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 03/03/98-04/01/98 04/01/98-05/06/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-4.48 A 6.00*-9.00"'.79*7.38"'.66*1.94~1.64":-7.28*9.78": 8.65*1.47"-4.71+1.10~-6.64+-6.72 A 2.58" 9.20 27*1.65*5.18 x 544":-1 90" 1.63" 1.20~4.67*7.16"-1.17*1.62 A 39'7 E+00 E+00 E-02 E-01 E-01 E-01 E+00 E+00 E-01 E-02 E-01 E+00 E-01 E+00 E+00 E+00 E+01 E-01 E-01 E+00 E-01 E-01 E+00 E+00 E-OI E-01 E+00 E+00 E+01 E+00 1.51 E+01 2.35 E+01 1.52 E+00 1.57 E+00 3.14 E+00 1.71 E+00 3.18 E+00 3.21 E+00 1.58 E+00 1.70 E+00 1.73 E+00 4.88 E+00 2.06 E+00 4.10 E+01 3.29 E+00 1.62 E+01 3.40 E+01 1.77 E+00 1.79 E+00 3.64 E+00 1.74 E+00 3.72 E+00 3.63 E+00 1.83 E+00 1.96 E+00 1.92 E+00 6.38 E+00 2.36 E+00 3.54 E+01 3.06 E+00 Denotes a result less than the detection limit. TABLE B-10.1 (Cont.)AMMA PE R METRY F ANITARY WA TE TREATME T WATER Results in pCi/liter LOCATION 102C Prior to Discharge COLLECTION PERIOD 05/20/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 7 97"'.74" 1.20*-2.98" 1.65*-7.83~-1.52" 8.69*1.72*0.00*1.79+-2.68*4.63*-5.76*-2.33 E+00 E+01 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E-01 E+01 E+00 RESULT OVERALL UNCERTAINTY 1.69 E+01 2.04 E+01 1.36 E+00 1.54 E+00 3.56 E+00 1.44 E+00 3.09 E+00 3.29 E+00 1.67 E+00 1.51 E+00 1.55 E+00 1.19 E+01 4.58 E+00 3.46 E+01 2.96 E+00 05/20/98 Be-7 K-40 Mn-54 Co-58 FG-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BQ-140 La-140 Ra-226 Th-228*5.52*-8.19*4.49"-1 04"'.76"-7.86" 2.84*1.69~2.34"-3.97"3.48*-3.75*-7.04*-5.59": 6.03 E+00 E+01 E-01 E+00 E+00 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+01 E-01'.00 E+01 3.60 E+01 1.86 E+00 2.1,4 E+00 4.79 E+00 1.85 E+00 3.97 E+00 4.39 E+00 2.19 E+00 1.98 E+00 2.04 E+00 1.51 E+01 6.10 E+00 3.38 E+01 3.08 E+00 Denotes a result less than the detection limit. TABLE B-10.1 (Cont.)AMMA PE TR METRY F<A IT RV WASTE TRE<.ATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102C Prior to Discharge 10/21/98 10/21/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 LB-140 Ra-226 Th-228'-9.71":-9.82" 8.15" 1.64 x 249"-1.05*-3.77*-3.06*9.10*3.85"-4.18"'-7.45" 0.00~-1.19"-6.59*1.35"-2.60"'-1.28"-4.91*3.15*6.53 A 4.10*0.00" 1.60*2.80": 9.33"-1.56"'.03"'-6.66": 3.46 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E-02 E+00 E-01 E+00 E+01 E+00 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 1.90 E+01 5.27 E+01 2.08 E+00 2.12 E+00 4.23 E+00 2.07 E+00 4.69 E+00 4.14 E+00 2.15 E+00 2.41 E+00 2.31 E+00 6.58 E+00 2.56 E+00 4.24 E+01 3.59 E+00 1.32 E+01 2.85 E+01 1.44 E+00 1.45 E+00 2.94 E+00 1.47 E+00 3.11 E+00 2.90 E+00 1.49 E+00 1.63 E+00 1.64 E+00 4.55 E+00 1.72 E+00 2.96 E+01 2.61 E+00 Denotes a result less than the dctcction limit. TABLE B-10.1 (Cont.)GRAMMA PE TR METRY F ANITARY WA TE TREATMFNT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 09/23/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.03"-6.47"-8.54*2.00"'-1.17" 0.00" 2.33" 1.13"-1.08"'-2.70"-7.29 E+00 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+01 E-02 x 101 E+01"'.15 E+00": 1.56 E+00<<-1.39 E+00 1.53 2.34 1.63 1.63 3 44 1.93 3.82 3.46 1.69 1.84 1.89 5.33 2.27 3.48 3.11 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 10/21/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"'.41"-5.29*4.46'72 000" 1.57": 1.65 91": 1.67*-8.21"'.61 441":-2.15 x 234"'-2.48 E-01 E+01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E-01 E-01 E+00 E-01 E+01 E-01 1.62 3.52 1.82 1.78 3.64 1.85 3.62 3.59 1.76 1.99 1.97 5.31 2.15 3.37 2.92 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit. TABLE B-10.1 (Cont.)AMMA PE TR ETRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 11/18/98 12/16/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228+6.34~3.05" 6.58"-1.00*3.63+6.21*2.47"'.92 A 1.23*4.29*-4.06*6.58" 3.53*2.58" 1.04*-4.05*-6.54~4.89~3.03*1.57+4.39*-1.89*-2.17" 2.05 A-3.28"'.68~-1.43"615"-7.48 x 524 E+00 E+00 E-01 E+00 E+00 E-01 E-01 E-01 E+00 E-01 E+00 E-01 E-01 E+01 E+01 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+00 1.66 3.63 1.79 1.80 3.68 1.86 4.04 3.49 1.75 1.94 2.03 5.71 2.35 3.28 3.01 1.23 1.95 1.22 1.27 2.49 1.41 2.54 2.45 1.39 1.44 1.51 4.15 1.92 3.47 2.89 E+01 E+Ol E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the detection limit. TABLE B-10.1 (Cont.)+AMMA PE TR METRY F ANIT RY WA TE TREAT ENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Head works 05/20/98 06/17/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-9S.Cs-134 Cs-137 Ba-140 La-140 Ra-226 TH-228"'.49":-4.14 x59p":-5.43 3.23"-1.93": 2.50"-1.30" 1.48 x 220*1.06"-4.1 1"-1 PP~-3.76"-1 40": 5.86" 5.58"-4.50%-4.52" 1.16"-9.33*-4.56":-8.62" 1.20":-9.78 x-1 12*2.08":-5.10"-4.03" 1.99 E+00 E+01 E-01 E-01 E+00 E-01 E+00 E-01 E+00 E+00 E+00 E+00 E+00 E+01 E+01 E+00 E+01 E-02 E-02 E+00 E-01 E-01 E-02 E+00 E-02 E+00 E-01 E+00 E+01 E+00 1.89 2.72 1.79 1.89 4.08 1.99 4.08 3.99 1.92 2.26 1.99 7.31 3.08 4.91 3.87 1.51 2.44 1.54 1.49 3.22 1.72 3.46 3.06 1.59 1.60 1.66 4.90 2,18 4.05 3.25 E+01'+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than the dctcction limit. TABLE B-10.1 (Cont.)AMMA PE TR M TRY F ANITARY WA TE TREATME T WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102B Monthly Headworks 07/15/98 08/19/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"-2.01*1.71"'-1.36~-7.33"'-3.21" 1.67~-1.84*-1.90" 6.30*2.52": 2.08"-6.00*1.15+-4.46*1.67"-1 47" 3.77" 3.79"-5.16*0.00" 9.80": 3.98*1.47" 6.08*1.32~1.16"-7.25"-3.46 4 Q7'7 74 E+00 E+01 E+00 E-01 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+00 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+Ol E+00 1.83 2.71 1.89 2.10 4.36 2.35 4.36 3.98 1.97 2.16 2.21 6.75 3.74 4.00 3.63 1.73 2.69 2.03 2.02 3.97 2.05 3.94 3.66 1.93 2.13 2.24 5.59 2.59 4.08 3.50 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 E+01 E+01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 Denotes a result less than thc dctcction limit. TABLE B-10.1 (Cont.)MMA PE TR METRY F ANITARY W TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 05/06/98-06/03/98 06/03/98-07/01/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 350":-7.60 3 47-1 61 x 783"'-9.88"-2.74"-1.97"'.64" 1.28*2.02"-9.24"'-2.02*-4.29"4.78+-3.59" 3.19~1.30+-8.52"114" 1.20": 5.68'-6.84~1.10":-4.88" 1.51"559"-8.94"-5.15":-1.59 E+00 E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01'-01 E+00 E+01 E+00 E-01 E+00 E+00 E-01 E-01 E+00 E-01 E+00 E+00 E-02 E+01 E-02 2.20 E+01 4.45 E+01 2.21 E+00 2.42 E+00 5.10 E+00 2.23 E+00 4.90 E+00 4.64 E+00 2.49 E+00 2.53 E+00 2.42 E+00 1.07 E+01 4.45 E+00 4.05 E+01 3.66 E+00 1.45 E+01 2.39 E+01 1.58 E+00 1.48 E+00 2.94 E+00 1.70 E+00 3.31 E+00 3.24 E+00 1.43 E+00 1.69 E+00 1.77 E+00 4.63 E+00 2.09 E+00 4.07 E+01 3.26 E+00 Denotes a result less than the dete<<tion limit. TABLE B-10.1 (Cont.)AMMA PE TR METRY F ANITARY WA TE.TREATM<NT WATER Results in pCi/liter LOCATION 102A COLLECTION PERIOD 07/01/98-08/05/98 NUCLIDE Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228"2.83": 9.92"166" 1.36"155" 1.91"118"'-5.60" 1.35"-1.36"661"-1.17"-1.36 E-01 E-02 E+00 E-01 E+00 E-01 E+00 E-01 E-01 E+00 E-01 E+02 E+00 RESULT": 1.14, E+01":-7.96 E+01 OVERALL UNCERTAINTY 2.10 E+01 4.41 E+01 2.18 E+00 2.17 E+00 4.81 E+00 2.17 E+00 4.67 E+00 4.57 E+00 2.22 E+00 2.37 E+00 2.31 E+00 8.94 E+00 3.41 E+00 3.97 E+01 3.55 E+00 08/05/98-09/02/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 8.26":-1.24"'.52~-9.62" 1.49": 1.34"-1 05": 1.11" 2.10"'.84" 3.52": 3.38": 2.94"-7.96 x 423 E+00 E+01 E+00 E-02 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+00 E+01 E+00 2.05 E+01 4.41 E+01 2.16 E+00 2.13 E+00 4.69 E+00 2.13 E+00 4.61 E+00 4.33 E+00 2.17 E+00 2.31 E+00 2.36 E+00 8.42 E+00 3.38 E+00 4.04 E+01 3.50 E+00 Denotes a result less than thc dctcction limit. TABLE B-10.1 (Cont.)+AMMA PE TR METRY F ANITARY WA TE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 09/02/98-10/06/98 10/06/98-11/03/98 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228": 1.63":-2.92"-2.46"-9.91"'.38" 5.96"7.21"-1.36": 9.42"0.00" 3.59":-1.17" 6.13" 5.50*-3.00" 4.24": 6.42*4.64~1.56":-4.78":-3.76": 1.16~0.00 x I 18": 1.24"5.50"'-1.05"'-6.12+7.00 E+01 E+01 E+00 E-01 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+01 E-01 E+00 E+00 E+00 E+00 E-01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E+00 E+01 E-01 2.01 E+01 2.66 E+01 1.94 E+00 1.87 E+00 4.46 E+00 2.01 E+00 4.26 E+00 4.14 E+00 2.06 E+00 2.07 E+00 2.30 E+00 8.41 E+00 4.29 E+00 4.33 E+01 3.85 E+00 1.53 E+01 2.46 E+01 1.50 E+00 1.51 E+00, 3.10 E+00 1.55 E+00 3.30 E+00 3.12 E+00 1.62 E+00 1.77 E+00 1.66 E+00 4.82 E+00 2.02 E+00 4.05 E+01 3.47 E+00 Denotes a result less than the detection limit. TABLE B-10.1 (Cont.)AMMA PE TR METRY F ANITARY W TE TREATMENT WATER Results in pCifli ter LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102A 11/03/98-12/01/98 12/01/98-01/05/99 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 Ba-140 La-140 Ra-226 Th-228 Be-7 K-40 Mn-54 Co-58 Fe-59 Co-60 Zn-65 Zr-95 Nb-95 Cs-134 Cs-137 BB-140 La-l40 Ra-226 Th-228":-3 34"-1.31" 9.14" 5.96 x 384":-3.21":-2.13"140~1.92*3.55~1.29"4.89": 7.06":133":-2.05":509": 9.18":-6.93":-1.48": 2.88": 1.53 5 0'7 x+63" 1.16"-5.90" 1.70 4 8'7"ppp":-1.68 x'746 E+00 E+01 E-01 E-01 E-01 E+00 E+00 E+00 E+00 E-01 E+00 E-01 E-02 E+Ol E-01 E+00 E+01 E-01 E+00 E+00 E+00 E-01 E+00 E+00 E-01 E+00 E+00 E+00 E+O1 E+00 1.27 E+01 1.96 E+01 1.29 E+00 1.33 E+00 2.55 E+00 1.30 E+00 2.54 E+00 2.52 E+00 1.36 E+00 1.42 E+00 1.41 E+00 4.29 E+00 1.74 E+00 3.29 E+01 2.70 E+00 1.97 E+01 3.11 E+01 2.21 E+00 2.28 E+00 4.78 E+00 2.41 E+00 4.83 E+00 4.48 E+00 2.29 E+00 2.42 E+00 2.36 E+00 7.80 E+00 3.03 E+00 4.05 E+01 3.61 E+00 Denotes a result less than thc detection limit. TABLE B-10.2 AMMA PE TR METRY F ANIT RY WA TE TREATMENT WAT.R-~MM R Results in pCilliter NUCLIDE AVERAGE LOW HIGH NUMBER.NUMBER SAMPLES POSITIVE 1028-Monthly Headworks Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)2.04E+00-5.73E-01 5.38E-01-5.30E-01 1.35E+00 4.54E-01 5.68E-01 1.69E-01 1.10E+00 3.14E-01 3.12E-01-1.50E+00-9.56E-O 1-2.29E+Ol-7.82E-O I-1.47E+01-5.29E+01-1.80E+00-1.39E+00-3.21E-01-9.79E-01-1.89E+00-2.26E+00-1.17E+00-1.22E+00-4.06E+00'6.00E+00-5.10E+00-4.64E+01-l 40E+Ol 1.09E+01 5.68E+01 3.79E+00 3.03E-01 3.63E+00 1.69E+00 3.98E+00 3.34E+00 2.29E+00 2.52E+00 2.33E+00 2.93E+00 1~15E+00 2.58E+01 1.04E+01 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 0 (I)Indicator Stations TABLE B-10.2 (" AMMA%PE TR METRY F ANITARY WASTE TREATMENT WATER-*.Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 102-Prior to Disehnr e Be-7 K-40 Mn-54 (I)-2.70E+00 (I)-2.51E+01 (I)5.84E-01 Co-58 (I)-4.73E-02 Fe-59 (I)2.08E+00 Co-60 (I)-4.92E-01 Zn-65 (I)4.13E-01 Zr-95 (I)-5.06E-01 Nb-95 (I)1.64E+00 Cs-134 (I)-1.96E-02 Cs-137 (I)5.06E-01 Ba-140 (I)'2.18E+00 La-140 (I)-1.49E+00 Ra-226 (I)-3.30E+0 l Tjl-228 (I)-1.21E+00-9.71E+00-8.19E+01-1.28E-01-1.04E+00-2.49E-01-1.05E+00-3.77E+00-3.06E+00 9.10E-01-3.97E-01-4.18E+00-3.75E+00-7.04E+00-5.76E+0 I-6.59E+00 5.52E+00 1.74E+01 1.20E+00 1.64E+00 3.76E+00 6.53E-01 4.10E+00 8.69E-OI 2.34E+00 2.80E-01 3 48E+00-7.45E-01 6.03E-OI-6.66E+00 3 46E+00 g)Indicator Stations TABLE B-10.2 AMMA PF.TR METRY F ANITARY WA TE TREATMENT WATER-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE 1020-North tabilization Pond Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)8.60E+00-2.96E+00-1.69E+00-8.56E-01 1.47E+00 5.34E-01 5.05E-01 3.27E+00 1.52E+00-8.36E-01 1.69E+00 3.78E+00-1.73E+00-7.66E+01-1.78E+00 0.00E+00-3.98E+00-2.73E+00-1.21E+00 0.00E+00 2.00E-01-1.05E+00 2.44E+00 8.63E-02-1.77E+00 9.95E-01 3.18E+00-2.18E+00-1.48E+02-2.96E+00 1.72E+01-1.93E+00-6.54E-01-5.02E-01 2.94E+00 8.67E-01 2.06E+00 4.10E+00 2.95E+00 9.79E-02 2.39E+00 4.38E+00-1.28E+00-5.27E+00-6.03E-01 2 0 e g)Indicator Stations TABLE B-10.2 AMMA PE TR TRY F ANITARY WA TE TREAT ENT WATER-" NUCLIDE Results in pCi/liter AVERAGE LOW HIGH 102K-outh tabilization Pond NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)-6.46E+00-3.96E+01 6.59E-01-6.06E-01 3.39E+00-8.77E-01 1.01E+00-1.31E+00 1.15E+00 2.68E-01 1.46E+00 1.70E+00-1.40E+00-8.47E+01-2.82E+00-9.31E+00-9.06E+01-7.19E-02-1.25E+00 1.41E+00-2.70E+00 1.89E-01-1.89E+00 8.27E-01-7.75E-01 1.31E+00 1.26E+00-2.09E+00-l.16E+02-6.29E+00-3.61E+00 1.15E+01 1.39E+00 3.82E-02 5.37E+00 9.46E-01 1.83E+00-7.31E-01 1.48E+00 1.31E+00 1.60E+00 2.14E+00-7.19E-01-5.33E+01 6.57E-01 (I)Indicator Stations TABLE B-10.2 AMMA, PF.TR METRY F ANITARY WA TE TREATMENT WATER-

SUMMARY

Results in pCi/liter NUCLIDE Be-7 (I)K-40 (I)Mn-54 (I)Co-58 (I)Fe-59 (I)Co-60 (I)Zn-65 (I)Zr-95 (I)Nb-95 (I)Cs-134 (I)Cs-137 (I)Ba-140 (I)La-140 (I)Ra-226 (I)Th-228 (I)AVERAGE 3.07E+00 3.31E+00 2.52E-OI-2.14E-O I" 1.12E+00 2.37E-OI 3.50E-OI-3.06E-O I 1.49E+00 2.80E-OI 1.42E+00 2.56E-OI-3.27E-02-4.01E+01 8.52E-03 LOW 102A-6.72E+00-7.96E+01-2.46E+00-1.48E+00-7.83E-O I-3.21E+00-4.51E+00-2.63E+00-7.28E-O I-5.90E-O I 1.35E-OI-1.17E+01-2.02E+00-I.17E+02-6.64E+00 1.63E+01 9.18E+01 1.52E+00 6.79E-OI 2.96E+00 1.53E+00 7.21E+00 1.64E+00 3.32E+00 1.84E+00 3.59E+00 7.16E+00 2.94E+00 1.62E+01 8.08E+00 NUMBER NUMBER SAMPLES POSITIVE 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 g)Indicator Stations I I I I I I TRITI TABLE B-11.1 M IN ANITARY WASTE TREATMENT WATER Results in pCi/liter LOCATION COLLECTION DATE RESULT EFTF Kf<<OVERALL UNCERTAINTY H-3 102A 01/06/98-02/03/98 02/03/98-03/03/98 03/03/98-04/01/98 04/01/98-05/06/98 05/06/98-06/03/98 06/03/98-07/01/98 07/01/98-08/05/98 08/05/98-09/02/98 09/02/98-10/06/98 10/06/98-1 1/03/98 11/03/98-12/01/98 12/01/98-01/05/99 5.3 3.9 3.8 4.2 1.6 2.0 1.1 1.3 5.0 4.7 4.2 54 E+03 E+03 E+03 E+03 E+04 E+04 E+04 E+04 E+03 E+03 E+03 E+03 3.0 2.0 2.0 2.0 1.0 1.0 1.0 1.0 3.0 3.0 2.0 2.0 E+02 E+02 E+02 E+02 E+03 E+03 E+03 E+03 E+02 E+02 E+02 E+02 H-3 102B 01/21/98 02/25/98 03/18/98 04/15/98 05/20/98 06/17/98 07/15/98 08/19/98 09/23/98 10/21/98 11/18/98 12/16/98 onthl Headwot ks 5.1"'.3 6.6 1.0 7.1 1.8"'.9 4.7 1.2 4.0 20 7.8 E+02 E+02 E+02 E+03 E+03 E+03 E+01 E+02 E+03 E+02 E+03 E+02 2.0 1.9 8.0 1.0 3.0 2.0 9.2 1.0 2.0 1.2 2.0 1.3 E+02 E+02 E+01 E+02 E+02 E+02 E+01 E+02 E+02 E+02 E+02 E+02 H-3 102C 05/10/98 05/20/98 10/21/98 10/2 l/98 4.8 5.3 1.1 1.1 E+02 E+02 E+03 E+03 1.2 1.2 1.0 1.0 E+02 E+02 E+02 E+02 Dcnotcs a result less than thc detection limit. TABLE B-11.1 (cont.)ITI IN NITARY W E TRKA ENT W TER Results in pCi/liter LOCATION COLLECTION DATE RESULT OVERALL UNCERTAINTY H-3 102D 05/12/98 11/17/98 orth tahilizati n Ponds 6.7 E+02 1.2 E+03 1.2 E+02 1.0 E+02 H-3 102E 05/12/98 11/17/98 outh tabilizati n Ponds 5.5 E+02 1.3 E+03 1.2 E+02 2.0 E+02 TABLE B-11.2 (Cont.)TRITI M IN ANITARY WA TK TRKATMFNT W TKR-MMARY Results in pCi/liter NUCLIDE AVERAGE LOW HIGH NUMBER NUMBER SAMPLES POSITIVE H-3 (I)3.74E+03 ll am les 5.9E+01 2.0E+04 32 30 H-3 (I)102-A 8.04E+03 FFTF Effluen 3.8E+03 2.0E+04 12 12 H-3 (I)102-B 1.34E+03 onthl Head works 5.9E+01 7.1E+03 12 10 H-3 (I)102-C 8.03E+02 Prior t Dischar e 4.8E+02 1.1E+03 North tabilization Ponds H-3 (I)102-D 9.35E+02 6.7E+02 1.2E+03 H-3 (I)102-E 9.25E+02 South tahilization Ponds 5.5E+02 1.3E+03 (I)Indicator Stations I I TABLE B-12.1 AMMA PE TR M RY F ANITARY WA TE TRFATMF T EDIMEN Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 102D 102D 102D 04/21/98 10/27/98 11/17/98 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 Eu-152 Th-228 K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 EU-152 Th-228 1.04 E+04"'-3.32 E+00 1.64 E+02*3.23 E+01 1.32 E+02 1.19 E+03*3.40 E+01 5.46 E+02 8.98 E+03*-2.51 E-01 2.11 E+03"'.57 E+01 7.20 E+01 1.51 E+03*8.79 E+01 4.48 E+02 1.32 E+04*-7.47 E+00*4.85 E+00" 4.58 E+01*1.59 E+01 1.54 E+03*6.31 E+01 9.67 E+02 7 01 E+02 1.85 E+01 3.97 E+01 2.58 E+01 4.08 E+01 5.49 E+02 1.16 E+02 4.67 E+01 6.58 E+02 1.99 E+01 1.00 E+02 3.10 E+01 4.01 E+01 6.58 E+02 1.04 E+02 4.87 E+01 3.27 E+02 8.88 E+00 9.23 E+00 1.06 E+01 9.91 E+00 2.70 E+02 4.95 E+01 2.43 E+01 Denotes a result less than the detection limit. TABLE B-12.2 AMMA PE TR METRY F ANITARY WA TE TREATMENT EDIME T-SIIMMARV Results in pCi/kilogram NUCLIDE AVERAGE LOW HIGH NUMBER SAMPLES NUMBER POSITIVE K-40 Co-57 Co-60 Cs-134 Cs-137 Ra-226 EU-152 Th-228 (I).1.09E+04 (I)-3.68E+00 (I)7.60E+02 (I)3.46E+01 (I)7.33E+01 (I)1.41E+03 (I)6.17E+01 (I)6.54E+02 8.98E+03-7.47E+00 4.85E+00 2.57E+01 1.59E+01 1.19E+03 3.40E+01 4.48E+02 1.32E+04-2.51E-01 2.11E+03 4.58E+01 1.32E+02 1.54E+03 8.79E+01 9.67E+02 g)Indicator Stations STATION 118 SOIL RESULTS I I I TABLE B-13.1 AMMA PE TR METRY F STATI N 118 S II.Results in pCi/kilogram LOCATION COLLECTION PERIOD NUCLIDE RESULT OVERALL UNCERTAINTY 118 06/09/98 Be-7 K-40 Cs-134 Cs-137 Ra-226 Th-228 1.71 E+02 1.31 E+04*2.18 E+01*1.37 E+01 6.40 E+02 5.21 E+02 6.27 E+01 2.59 E+02 6.00 E+00 5.76 E+00 1.44 E+02 1.42 E+01 Denotes a result less than the detection limit. TABLE B-13.2 AMMA PE TR METRY F ATI N 118 8 IL-MM RY Results in pCi/kilogram NUCLIDE AVERAGE'OW HIGH NUMBER NUMBER SAMPLES POSITIVE Be-7 (I)K-40 (I)Cs-134 (I)Cs-137 (I)'a-226 (I)Tjl-228 (I)1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 1.71E+02 1.31E+04 2.18E+01 1.37E+01 6.40E+02 5.21E+02 (I)Indicator Stations WASHINGTON PUIILIC POWER 4N SUPPLY SYSTEM WASHINGTON PUBLIC POWER SUPPLY SYSIKM NVCLKAR PLANT 2 1997 AN1'AJAL RADIOLOGICAL ENVIRON1UIENTAL OPERATING REPORT JANUARY 1 to DECEMBER 31, 1997 RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM Prepared by J.E.McDonald and L,S.Schleder Washington Public Power Supply System Richland, WA and C.A.Mendola Teledyne Brown Engineering Environmental Services Westwood, NJ TABLE OF CONTENTS 1.0 EXECUTIVE

SUMMARY

2.0 DEFINITIONS

3.0 INTRODUCTION

3.1 Site Description 3.2 Program Background 3.3 Program Objectives 4.0 PROGRAM DESCRIPTION 4.1 Sample Locations 4.2 Land Use Census 4.3 Sampling Methods 4.3.1 Direct Radiation 4.3.2 Airborne Particulate/Iodine 4.3.3 Water 4.3.4 Soil 4.3.5 Sediment 4.3.6 Fish 4.3.7 Milk 4.3.8 Garden Produce 4.3.9 Vegetation

4.4 Analytical

Procedures 4.4.1 Gross Beta Activity on Particulate Filters 4.4.2 Measurement of Gamma Emitters 4.4.3 Gross Beta Activity in Water 4.4.4 Iodine-131 in Water 4;4.5 Tritium in Water 4.4.6 Strontium-89 and 90 in Water, Milk and Soil 4.4.7 Iodine-131 in Milk 4.5 Data Analysis Methods 2-1 3-1 3-1 3-1 3-2 4-1 4-1 4-1 4-2 4-2 4-3 4-3 4-4 4-5 4-5 4-5 4-6 4-6 4-6 4-6 4-6 4-7 4-7 4-8 4-8 4-8 4-9 TABLE F CONTENTS 5.0 RESULTS AND DISCUSSION 5.1 Direct Radiation 5.2 Airborne Particulate/Iodine 5.3 Water 5.4 Soil 5.5 River Sediment 5.6 Fish 5.7 Milk 5.8 Garden Produce 5-1 5-4 5-5 5-6 5-6 5-7 5-7 5-7 6.0 5.9 Special Interest Sampling Locations 5.9.1 Storm Drain Pond (Station 101)5.9.2 Sanitary Waste Treatment Facility (Station 102)5.9.3 Containerized Storage Area (Station 118)5.9.4 Cooling Tower Sediment Disposal Area (Station 119)5.9.5 Spray Pond Drain Field 5.10 1997 Sample Deviations QUALITY ASSURANCE AND QUALITY CONTROL 6.1 Quality Control For the Supply System Environmental TLD Program 6.2 Quality Control For the Analytical Program 6.2.1 Supply System Quality Control Activities 6.2.2 Teledyne Brown Engineering Quality Control Program 5-7 5-7 5-9 5-9 s~~5-10 5-11 6-1 6.1 6-2 6-2 6-2

7.0 REFERENCES

8.0 1996 REMP REPORT ERRATA 7-1 8-1 LIST OF TABLES 4-1 4-2 4-3 4-4 5-1 5-2 5-3 5-4 5-5 5-6 6-3 6-4 6-5 6-6 6-7 Radiological Environmental Monitoring Program Plan REMP Sample Locations By Sector 1997 Five Mile Land Use Census Results Comparison of Teledyne Nominal Lower Limits of Detection With Offsite Dose Calculation Manual Requirements Radiological Environmental Monitoring Program Comparative Summary 1997 Sample Deviations Radiological Environmental Monitoring Program Summary Mean Quarterly TLD Data Summary For The Preoperational and Operational Periods Annual TLD Data Summary For the Preoperational and Operational Periods 1997 Mean Quarterly Versus Annual TLD Data 1997 Environmental Spiked Dosimeter Results 1997 Environmental Measurements Laboratory (EML)Quality Assessment Program Results 1997 Teledyne Brown Quality Control Data-Blanks 1997 Teledyne Brown Quality Control Data-Spikes 1997 EPA Intercomparison Program Results 1997 Analytics, Inc.Cross Check Comparison Program 1996 Quality Assurance Task Force Intercomparison Study Hanford 100 Area Soil Sample 4-10 4-14 4-17 4-18 5-12 5-17 5-18 5-28 5-30 5-32 6-5 6-6 6-7 6-8 6-9 6-12 6-14 LIST OF FIGURES 3-1 4-1 4-2 4-3 4-4 5-1 5-2 5-3 5-4 5-5 5-6 5-7 Average Wind Direction During 1997 REMP Sampling Locations Within the 10-Mile Radius REMP Sampling Locations Outside the 10-Mile Radius REMP Sampling Locations Sunnyside/Grandview Area REMP Near Plant Sampling Locations Site Boundary Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Near-Plant Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Remote Quarterly TLDs-1984-96 Hi/Low/Mean vs.1997 Annual Mean by Sector Frequency Distribution for 1997 Quarterly TLDs Frequency Distribution for 1984-96 Quarterly TLDs 1985-96 Weekly Hi/Low/Mean vs.1997 Weekly Mean Gross Beta in Air-Near Plant Stations 1985-96 Weekly Hi/Low/Mean vs.1997 Weekly Mean Gross Beta in Air-Remote Stations 3-1 4-19 4-20 4-21 4-22 5-2 5-2 5-3 5-3 5-3 5-4 5-8 Gross Beta in River/Drinking Water-1997 5-5 5-9'-10 5-11 Gross Beta in Plant Discharge Water-1997 Tritium in Discharge Water and Gallons Effluent Discharged -1989-97 Tritium in Discharge Water-1997 5-5 5-6 5-6 5-12 Average Monthly Tritium at Storm Drain Outfall-1992-97 5-8 1.0 EXECUTIVE

SUMMARY

The Washington Public Power Supply System Radiological Environmental Monitoring Program (REMP)evaluates the radiological impact of Plant 2 operations on the environment in the Airborne, Direct Radiation, Waterborne, and Ingestion pathways as specified in the Offsite Dose Calculation Manual (ODCM).The Supply System's Plant 2 is a 1200 MW commercial nuclear power plant that achieved initial criticality on January 19, 1984.Samples of air, water, milk, soil, sediment, fish and garden produce were collected throughout the year and analyzed for radionuclides specific to plant operations. Radiation levels were also monitored continuously during 1997 with thermoluminescent dosimeters (TLDs).The samples were collected in established areas near the plant and at other locations which could be affected by Plant 2 effluents. This information was compared to samples taken in areas that were unlikely to be affected by plant operations. The 1997 REMP data was also compared to data collected during previous years of plant operation and to the data collected prior to initial plant operation. Most of the results of samples collected by the REMP during 1997 were below detection levels.Some analyses, such as gross beta in air and water, were above the detection level for nearly all samples.This is due to the low detection limit for the gross beta analysis and also to the abundance of naturally occurring beta-emitting radionuclides in the environment. Other results above detection levels, such as cesium-137 in soil and sediment, reflect the effect of past Hanford activities or fallout from Chernobyl and past nuclear weapons testing.Tritium concentration in discharge water continued to be lower than the mean levels observed from the 1992 through 1996 periods.This reduction is due to an ongoing reduction in the volume of the radwaste discharges to the Columbia River.The REMP analytical results and TLD results were demonstrated to be accurate through intercomparison programs which are provided as part of the quality assurance activities conducted during 1997.Such intercomparisons tested the performance of the Supply System monitoring program to other monitoring programs using known radioactive standards. The Supply System REMP analytical contractor performed well in the Environmental Measurements Laboratory (EML)Quality Assessment Program, Environmental Protection Agency Intercomparison Studies, and the Analytics, Inc.Cross Check Comparison Program conducted during 1997.In 1996, the Supply System also participated in the Quality Assurance Task Force (QATF)intercomparison for soil samples.The results for this intercomparison were received in the spring of 1997.The QATF is chaired by the Washington Department of Health and has as its members the various environmental programs on the Hanford Site.The Supply System results for this intercomparison were also favorable. The analytical data collected by the REMP in 1997 remained consistent with the environmental data collected during the preoperational period and prior operational years.Based on the data, no significant new trends or changes in the environmental radiological levels around the plant were observed.l997 REMP ANNUAL REPORT \I

2.0 DEFINITIONS

Airborne Activity Sampling: Continuous sampling of air through the collection of particulates and radionuclides on filter media.Periodic soil samples are collected for gamma isotopic analysis to provide information on deposition to the soil from airborne releases.Alpha Particle (a): A charged particle emitted from the nucleus of an atom having a mass and charge equal in magnitude of a helium nucleus.EFSEC: Energy Facility Site Evaluation Council FFTF: U.S Department of Energy's Fast Flux Test Facility near Plant 2.Also known as the 400 Area.Flow Proportional Sampling: Sample collection volume or frequency determined as a function of the flow rate of the water being sampled.Grab Sample: A single discrete sample drawn at.one point in time.Becquerel (Bq): One disintegration per second.One picocurie (pCi)equals 0.037 becquerel. Beta Particle (P): Charged particle emitted from the nucleus of an atom, with a mass and charge equal in magnitude to that of an electron.Blank Sample: A sample of the same media as the field sample being analyzed but without the radionuclide(s) being measured.It enables correction for the inherent sample background. Composite Sample: A series of single collected portions (aliquots) analyzed as one sample.The aliquots making up the sample are collected at time intervals that are very short compared to the composite period.Control Station: A background sampling location, i.e., a location not likely to be affected by plant effluents due to its distance and/or direction from Plant 2.Counting Error: An estimate of the two-sigma uncertainty associated with the sample results based , respective count times.+/-2 f(SumplcCPM/CouuQTmc+BkgCpm/Countlt mc)Curie (Ci): 3.7 x 10'isintegrations per second, or 2.22 x 10'isintegrations per minute.Direct Radiation Monitoring: The measurement of radiation dose at various distances from the plant is assessed through the use of thermoluminescent dosimeters and pressurized ionization chambers.DOH: Washington State Department of Health.Indicator Station: A sampling location that could be affected by plant effluents due to its proximity and/or direction from Plant 2.Ingestion Pathway Monitoring: The ingestion pathway includes milk, soil, fish, garden produce.Also sampled (under special circumstances) are other media such as vegetation and animal products such as eggs and meat when additional information about particular radionuclides is needed.Lower Limit of Detection (LLD): The smallest concentration of radioactive material in a sample that will yield a net count (above system background) that will be detected with 95%probability with a 5%probability of a false conclusion that a blank observation represents"real" signal.LLD>>4.66$b/(222>>Vol>>Eg>>Yield>>ct "")Where LLD is the"a priori" or'before-the-fact'easurement and not"a posreriori" or'after-the-fact'easurement. Mean: The average, i.e., the sum of results divided by the number of results.Microcurie: 3.7 x 10'isintegrations per second, or 2.22 x10c disintegrations per minute.Milliroentgen (mR): 1/1000 Roentgen;a unit of exposure to X or gamma radiation. NIST: National Institute of Standards and Technology. NRC: U.S.Nuclear Regulatory Commission. 2-1 1997 REMP ANNUAL REPORT ODCM: Offsite Dose Calculation Manual, which contains the program requirements formerly contained in the Technical Specifications. SWTF: Sanitary Waste Treatment Facility;sanitary waste processing facility for Plant 2 and WNP-1 and WNP-4 sites.Picocurie (pCi): 1 x 10" Curie or 2.22 disintegrations per minute;one millionth of a microcurie. REMP: Radiological Environmental Monitoring Program.TEDA: triethylene diamine TLD: Thermoluminescent dosimeter. ATLD contains a phosphor which stores energy from exposure to radiation and emits that energy in the form of light when heated.Range: The difference between the smallest and largest results.Restricted Area: Any area to which access is controlled for purposes of protection of individuals from exposure to radiation and radioactive materials. Results: The results of sample collection are discussed and interpreted by comparing them to similar measurements made during the preoperational and previous operational periods and to the detection capabilities associated with the current methods of analysis.Roentgen: Unit of exposure to X or gamma (v)radiation in air.Site Certification Agreement (SCA): The Plant 2 licensing agreement with the State of Washington. Spike Sample: A sample containing a known concentration of the radionuclide(s) being measured.Standard Deviation: A measure of the scatter of a set of observations (or samples)around their mean value.Indicated by (t7).Standard Error of the Mean: An estimate of the uncertainty associated with the mean of observation (or sample)averages.where S~, the variance is S I 1(n-1)+(Xl-X)~1997 REMP ANNUAL REPORT 2-2

3.0 INTRODUCTION

3.1 Site Description The Washington Public Power Supply System's Nuclear Plant 2 is located in a sparsely populated shrub-steppe region within the Department of Energy's Hanford Site in southeastern Washington. The plant is approximately three miles west of the Columbia River and is surrounded on all sides by uninhabited desert land.The nearest population centers are Richland, Pasco and Kennewick, which are 12 miles south, 18 miles southeast, and 21 miles southeast, respectively. The nearest privately-owned lands are located approximately four miles ENE of the plant, across the Columbia River.Given the prevailing wind directions, shown in the 1997'ind frequency distribution in Figure 3-1, the focus of REMP sampling is the farming region east of the plant site.Because Plant 2 is located on the Hanford Site, other potential sources of radioactive materials are in close proximity to Plant 2.For this reason, sampling locations near the plant provide useful information for separating the potential effects of Plant 2 from those of the other sources on the Hanford Site.3.2 Program Background The REMP is designed to conform to the regulatory guidance of the Nuclear Regulatory Commission (NRC)as provided by Regulatory Guides 4.1tu and 4.8"', including the Radiological Assessment Branch Technical Position"'. lilac': 1!i NW le%WNW 4,7%~SO>i~"':- ,.;.C ,.C~'8%N I.D%$.7%I.t<x NE l.7%2~7%Q3.;.C M%The quality assurance aspects of the program and tS%'.:C;:;.:.'l% the thermoluminescent dosimetry are conducted Figure 3-1 Average Wind Direction During 1997 in accordance with Regulatory Guides 4.15"'nd 4.13"'.The REMP also must adhere to the requirements of the Washington Energy Facility Site Evaluation Council (EFSEC)'", the Plant 2 Technical Specifications"'nd the Offsite Dose Calculation Manual (ODCM)'".These requirements cover not only the environmental sampling and sample analysis aspects of the program, but also the reporting and quality assurance requirements of the program.The preoperational phase of the program, which lasted from March 1978 until initial criticality in January 1984, provided a baseline of background environmental data.The variability in the background levels of radioactivity is due to differences in geologic composition, Chernobyl and nuclear weapons test fallout, meteorological conditions and seasonal changes.3-1 t 997 REMP ANNUAL REPORT REMP environmental samples are analyzed by a contract analytical laboratory. Teledyne Brown Engineering Environmental Services in Westwood, New Jersey has performed the analysis of REMP samples since June 1986.The thermoluminescent dosimeters used in the REMP to assess the direct radiation were processed in the past by the Supply System.In 1996, the Supply System contracted with ThermoNUtech, to process the TLDs in their West Richland laboratory. In 1997, ThermoNUtech moved their laboratory to Albequerque, New Mexico.Any radiological effect of Plant 2 on the environment must be distinguished from the normal variation in background radiation levels and from the effects of other sources of radioactive effluents in the area.The monitoring results obtained during each year of the plant's operation are compared to the preoperational data and to data from previous operating years to determine whether a significant accumulation of plant-produced radionuclides has occurred in the environment. Quarterly averages of the results are also compared to the NRC non-routine reporting levels listed in the ODCM.In addition to evaluating the environmental concentrations against federal standards or limits, the REMP also compares the results to state standards."""""" The results are discussed and interpreted by comparing them to similar measurements made during the preoperational and previous operational periods and to the detection capabilities associated with the current methods of analysis.The quality assurance and quality control aspects of the program are also discussed in this report.t 3.3 Program Objectives The REMP provides a mechanism for determining whether the levels of radioactivity in the plant environs are within established limits and to ensure that the accumulation of radionuclides in the environment will not become significant as a result of plant operations. While in-plant monitoring programs are used to ensure that 10CFR20"'nd 10CFR50"" criteria for releases of radioactive effluents are met, the REMP provides supplemental verification that the concentrations of radionuclides in the environment are not greater than anticipated. 1997 REMP ANNUAL REPORT 3-2 4.0 PROGRAM DESCRIPTION The requirement for the Radiological Environmental Monitoring Program (REMP)is defined by the WNP-2 Offsite Dose Calculation Manual (ODCM).The sampling plan presented in Table 4-1 in this report shows which samples are required by the ODCM and provides a summary of the sample locations, collection frequency, and types of analyses performed. The methods of sampling and sampling frequencies utilized in the program have been determined by such factors as the half-lives and major exposure pathways for the radionuclides potentially released from the plant to the surrounding environment. 4.1 Sample Locations Eighty-three sample locations were included in the 1997 monitoring program.Seventy-five indicator and three control (i.e.background) stations were located within 10 miles (16 kilometers) of Plant 2.Three additional control stations and two indicator stations were outside the 10-mile radius from the plant.Sample stations are listed in Table 4-2 by meteorological sector, sample media and approximate distance from the plant.The numbers and locations of sample stations are based primarily on factors such as population distribution and meteorological conditions and also'on station accessibility, security throughout the year and the requirements of applicable regulations. Other factors, such as the need to monitor locations which potentially could be impacted by Plant 2 operations, influence the location of REMP sampling sites.The REMP sampling locations listed in Tables 4-1 and 4-2 are shown in Figures 4-1 and 4-2.Figure 4-3 provides a more detailed map of sampling locations in the Sunnyside/Grandview area.Figure 4-4 shows the locations of the storm drain (Station 101)and the Sanitary Waste Treatment Facility (Station 102), which are NPDES sites.Also shown are the containerized storage area (Station 118), the cooling tower landfill (Station 119)and the spray pond drainfield (Station 120)which are special interest stations.4.2 Land Use Census The land use census for areas within 5 miles of Plant 2 was performed in August.The objectives of the land use census are to identify the locations of the nearest milk animal, residence, and garden greater than 50 m~(500 ft')producing broadleaf vegetation and to determine whether any site located during the census has a calculated dose or dose commitment /greater than the sites currently monitored for the same exposure pathway.If a new location with a higher dose commitment is found, routine sampling of that dose pathway would be initiated at that new site.The results of the 1997 land use census within 5 miles of Plant 2 are given in Table 4-3.No changes from the 1996 land use census were observed.No milk animals are located within the 5-mile radius.The nearest milk location is located 7.2 miles east-southeast of Plant 2.4-1 1997 REMP ANNUAL REPORT 4.3 Sampling Methods Environmental samples were collected according to the program plan in Table 4-1.All samples were collected by Supply System personnel. Documented procedures for sample collection and TLD analyses are contained in the Supply System's Environmental and Analytical Laboratory Instruction (EALI)manual.The sample analyses procedures are prepared and maintained by the analytical contractor and reviewed by the Supply System prior to implementation. The following sections describe the sampling and preparation methods..4.3.1 Direct Radiation During 1997, thermoluminescent dosimeters (TLDs)were used to determine the direct radiation levels at sixty (60)monitoring locations listed in Table 4-1.In January 1997, TLD Station 65 was added.This station is 7.3 miles south of Plant 2 and is located near a new housing development. Also, TLD stations ST120-West and ST120-Control were removed.The remaining station, ST120-East, is located midway down the bank of the spray pond drainfield trench near the area of greatest sediment deposition. The VLDs at ST119-Control will serve at the control station for ST120.The control station TLD (background) is located at Station 9A in Sunnyside. The remaining TLDs served as indicator TLDs throughout the year.Two sets of TLDs placed three feet above ground were employed at each location.One set of TLDs were exchanged on a quarterly basis (Quarterly TLDs)and the other exchanged on an annual basis'(Annual TLDs).Exposure received by the field TLDs during transport to the TLD sites was monitored by a set of trip control dosimeters that accompanied the field dosimeters to and from the field locations. Another set of TLDs were used as building controls which were used to determine the exposure of the TLDs at the controlled storage location.The TLD exposure during transport to and from the field was determined by subtracting the difference between the building control results and the trip control results.Since 1995, the REMP has used Harshaw TLDs and since 1996, the environmental dosimeters have been processed by a vendor, ThermoNUtech. The environmental dosimeters were processed on either a Harshaw Model 8800 or a Harshaw Model 6600 TLD Reader.The file generated when the Harshaw TLD reader processes the environmental TLDs was stored in the host computer and used as input for the Harshaw algorithm that calculates environmental doses.The TLD reader was typically calibrated within 7 days prior to processing field TLDs.The TLD reader was calibrated in generic units using calibration cards irradiated on a ThermoNUtech Sr-90 source."Relative response" factors (gU/R)were used by the dose algorithm to convert an element reading in gU from the reader to the Roentgen equivalent reading.The exposure values determined for calibration exposures, as well as the exposures of some QA dosimeters (processing control dosimeters), were based on a National Institute of Standards and Technology (NIST)traceable Sr-90 source.The exposure values for the audit dosimeters (spiked dosimeters) were based on the calculated field strength of a Supply System Cs-137 source.Ionization chamber measurements-made during TLD exposure were used to confirm the calculated exposure.If the calculated exposure and the ionization chamber reading differed by 5%or more, an investigation was performed to resolve the difference. 1997 REMP ANNUAL REPORT 4-2 Two Reuter Stokes pressurized ionization chambers (PICs)provided additional capability for measuring direct radiation exposure.These units are no longer part of the routine monitoring program, but they are used in special monitoring situations and maintained as back-up monitoring systems.4.3.2 Airborne Particulate/Iodine Air particulate and air iodine (1-131)samples were obtained through the use of portable, low volume (1.5 cfm)constant flow-rate sampling units at each of twelve locations. The samples drawn at Station 9A (Figure 4-3)were considered control samples;the ones drawn at the other locations (Figure 43)were indicator samples..Air particulates were collected by drawing.air through a 47mm diameter glass fiber filter.Air iodine was collected by drawing air through a 57mm diameter TEDA impregnated charcoal cartridge. The particulate air filter and charcoal cartridge were placed in tandem, particulate filter first, in a holder that attached to the air inlet of the sampler unit.The sampler units were placed in ventilated metal weatherproof housings mounted on elevated platforms at each air sample location.The filter media are'changed weekly and shipped to the analytical contractor for analysis within, one or two days of collection. New air sampler units were purchased in 1997, and were placed in service beginning in May.By the first week in October, all of the sampler units had been replaced.4.3.3 Water There were nine locations for water sampling in 1997: three for the evaluation of river/drinking water, one for plant discharge water, three for groundwater, one for the storm drain water, and one for sanitary waste water.One river/drinking water location, Station 26, was used for evaluation of the plant intake water, i.e., the river water taken upstream of the plant discharge point.This sample location is also used for a drinking water sample since Plant 2 draws its drinking water from the intake water.It is considered the river/drinking water control sample because of its upstream location.Two additional locations, Stations 28 and 29, were used to evaluate the water at the two nearest drinking water locations, the Department of Energy 300 Area and the Richland Water Treatment Plant.These two stations were considered indicator stations.The ODCM requirement for a downstream water sample"near but beyond the mixing zone" was met by sampling water from Station 27, the plant discharge line to the Columbia River.This sample reflects the radioactivity present in the plant discharge prior to any river dilution, rather than the concentrations that.would be found after dilution in the mixing zone.Water is drawn at this location because it was not feasible to perform flow-proportional composite sampling in the mixing zone area of the river downstream from the plant discharge point.The Station 27 sample is also considered an indicator sample.Composite samplers are installed at the Columbia River pumphouse to monitor the plant intake water (Control Station 26), and the cooling tower discharge line (Station 27).There are composite samplers at the two drinking water locations (Stations 28 and 29).The samplers collect 25-ml aliquots of water at regular intervals of time or flow.Non-routine analyses on the drinking water samples include strontium-90 and iodine-131 analysis.Strontium-90 analysis is required when the gross beta activity exceeds either 8 pCi/liter or ten times the mean of the 4-3 1997 REMP ANNUAL REPORT previous three months'ctivity for a specific location.Iodine-131 analysis is required when the dose calculated for the consumption of water exceeds one millirem per year.Neither of these analyses were required during 1997.There are three wells within the vicinity of Plant 2 that are used as groundwater sampling locations. These are a deep well on the Plant 2 site (0.1 mile north of the Reactor Building)and two wells on the WNP-1 site (1.2 miles downgradient from Plant 2).Water from the Plant 2 well can be used as a backup source for drinking and fire protection'. Water from the WNP-1 wells supplies the drinking and fire protection water for the WNP-1 site.Although none of these wells draw from the unconfined aquifer, they are considered indicator samples.Quarterly grab samples were, taken from each.of these.wells.One.gallon (3.8 liters)was collected from each well for gamma analysis and one liter was drawn for tritium analysis.Water samples were collected from the storm drain outfall (Station 101)using a flow proportional composite sampler.These samples were analyzed for gross beta, gamma and tritium.EFSEC Resolution No.259 for the Sanitary Waste Treatment Facility (SWTF;Station 102)requires a monthly sample to be taken at the headworks (102B)which was analyzed for gamma and tritium and two samples prior to discharge (102C)which were taken at the discharge weir of the south pond.Those samples were analyzed for gross alpha, gross beta, gamma and tritium.In addition, one sample was taken from the west end of each pond and analyzed for gross beta, gamma and tritium.Beginning in April of 1997, the SWTF began reiving sanitary waste from the U.S.Department of Energy's 400 Area.The Supply System installed a flow meter an'd composite sampler on the 400 Area sewer line just above where the 400 Area/Plant Support Facility (PSF)intertie is-located.This sampler takes a flow-proportional composite sample which was collected at least monthly.Gross alpha and beta analyses, tritium analysis, and gamma analysis were performed on each sample.4.3.4 Soil As required by the Site Certification Agreement (EFSEC Resolution No.260"'), annual soil samples were taken at the indicator stations, Stations 1, 7, 21 and 23.One sample was taken at the control.location, Station 9A (Figure 4-3).Quarterly soil samples were collected at two special interest locations, Station 101 and Station 118, as shown in Figures 4-4.Each sample was collected from an area of approximately one square foot to a depth of approximately one inch.Approximately two kilograms of soil were collected in each sample.Soil samples were shipped to the analytical contractor after collection and analyzed for gamma activity.If the gamma isotopic analysis indicates that cesium levels in any of the indicator samples exceeds ten (10)times the level in the control sample, a strontium analysis is performed on the sample(s). 'o strontium analysis was required during 1997.1997 REMP ANN VAL REPORT 4-4 4.3.5 Sediment For the second year, only the fall collection of the semiannual sediment could be taken.High water levels in the Columbia River covered the two sample sites well into the early summer.The fall sample was collected at the end of October.The upstream sediment sample (Station 33)was collected from a location approximately two miles upriver from the plant discharge. The downstream sample (Station 34)was collected approximately'one mile downstream of the plant discharge. Each sample consisted of approximately two kilograms of the shallow surface sediment scooped from below the waterline. The samples were shipped to the analytical contractor. Sediment samples were also taken from the storm drain (Station 101)outfall and pond and the SWTF.(Station 102)north stabilization pond.Sediment sampling in these locations was performed in a manner similar to river sediment sampling.Special care was taken to prevent loss of the fine particulates in the sediment.In addition, formalin was added to the sanitary pond sediment prior to shipping, to inhibit gas formation within the sample container. A 2-kilogram sample of dried cooling tower sediment was collected from the sediment disposal ell (Station 119)within thirty days of the completion of cleaning the cooling towers.In 1997 the cooling towers were cleaned once, hence, only one sample was collected for gamma spectrometry analysis.4.3.6 Hsh The annual fish sampling was performed in late September and early October.Fish samples collected from the Columbia River (Station 30 in Figure 4-1)were indicator samples, whereas the fish collected on the Snake River (Stations 38 and 38A in Figure 4-2), were control samples.Three separate fish samples, consisting of an anadromous species and two other species generally considered edible or potentially edible (such as carp, catfish and whitefish) were collected at each location.All the fish were collected using electro-shocking except the samples of the anadromous species which were collected from the Ringold hatchery on the Columbia River and at the Lyons Ferry Fish Hatchery on the Snake River.The fish were filleted to obtain approximately one kilogram of edible flesh per sample.The fillets were placed in clean plastic bags and frozen until shipment to the analytical contractor. Fish are sampled annually unless elevated radiation levels related to plant operations are observed, in which case sampling is conducted semiannually. 4.3.7 Milk Milk samples were collected monthly January through March and October through December and semimonthly during the spring and summer months when the cows were likely to be grazing or on fresh feed.Enough raw milk was collected from each sampling location to obtain a one gallon sample after the cream had been skimmed off.The samples were refrigerated overnight and the cream skimmed off the next morning., The milk samples were chilled.and shipped to the analytical contractor within a day of collection. 4-5 1997 REMP ANNUAL REPORT the tion Routine samples were collected from two indicator locations (Stations 36 and 64)across Columbia River in Franklin County.Milk samples were also collected at one indicator sta (Station 9B)and one control location (Station 96)in the Sunnyside/Grandview area (in Figure 4-3).Station 9B in Sunnyside serves as an'indicator station because a portion of the feed for the cows at that location is hay from Fraiiklin County north of Pasco.That factor makes it unsuitable for use as a control location.4.3.8 Garden Produce Samples of local garden produce were collected monthly from April to September when the produce was.readily, available. When possible,.three. types of.produce samples (a root crop, fruit, and a leafy vegetable) were collected at each location.The indicator samples were collected from a region in a predominant downwind direction (Station 37 in Figure 4-2)where crops are irrigated with Columbia River water.The control samples were obtained from produce stands in the Sunnyside area (Station 9C in Figure 4-3), the direction least likely to be affected by plant effluents. Apples were collected in September from Station 91, the Rio Vista Farms orchard, which is irrigated with Columbia River water.t 4.3.9 Vegetation The annual sample of vegetation growing in the storm drain pond was collected in June.Cattails and grasses were the principal types of vegetation collected. Approximately two kilograms of sample were collected each time.Care was taken to avoid including the roots or soil from around the roots in the samples.4.4 Analytical Procedures The analytical procedures used for the 1997 REIVIP samples are described below.Teledyne Brown Engineering Environmental Services performed all routine analyses of REMP samples during 1997.4.4.1 Gross Beta Activity.on Particulate Filters The particulate filters were counted in a gas flow-proportional counter after a delay of five or more days to allow for the radon-222 and radon-220 (thoron)daughter products to decay.An unused air particulate filter was counted as the blank with each weekly set of filters.4.4.2 Measurement of Gamma Emitters A shielded Ge(Li)detector system was coupled to a computer-based data acquisition system which performed pulse height and gamma energy analysis.The information collected about each peak was compared to a library of known peaks.Isotopic identification was performed as was the radioactivity calculation which used the appropriate fractional gamma ray abundance, half-life, detector efficiency, and net counts in the peak region.1997 REMP ANNVAL REPORT 4-6 Milk and Water A 1-liter Marinelli beaker was filled with a representative aliquot of the sample.The sample was then counted for at least 1000 minutes (16.7 hours).Foodstuff As much of the edible portion of the sample as possible was loaded into a tared Marinelli beaker and weighed.The sample was then counted for at least 1000 minutes (16.7 hours).~Ve etat ion As much sample..as.possible is placed in a 1-liter Marinelli beaker and counted for approximately 1000 minutes (16.7 hours).The sample is not dried prior to counting, so the results are given in terms of wet weight.Soils and Sediments A large quantity of the sample was dried at a temperature below 100'C.As much sample as possible was loaded into a tared 1-liter Marinelli beaker and weighed.The sample was then counted for at least 360 minutes (6 hours).Charcoal Cartrid es Air Iodine Charcoal filters were counted up to five at a time, with one positioned on the face and up to four on the side of the calibrated Ge(Li)detector.The detection limit for a charcoal cartridge was uniquely determined for each filter and by using its position.In the event that iodine-131 would have been observed in the initial counting of a set, each charcoal cartridge in the set was then positioned separately on the face of the detector and counted.Air Particulate Filters Four air particulate filters for a quarterly composite from each field station were aligned one in front of another and counted for at least 360 minutes (6 hours).4.4.3 Gross Beta Activity in Water A o'e-liter aliquot of each sample was evaporated to a small volume and transferred to a stainless steel planchet.The sample was dried under heat lamps, cooled, then counted on an automatic beta proportional counter.The results were calculated using empirical self-absorption curves which enabled the correction of effective counting efficiency based on the sample residue mass.4.4.4 Iodine-131 in Water Two liters of sample were first equilibrated with a stable iodide carrier.A batch treatment with anion exchange resin was used to remove iodine from the sample.The iodine was then stripped from the resin with sodium hypochlorite solution, reduced with hydroxylamine hydrochloride, and extracted into carbon tetrachloride as free iodine.It was then back-extracted as iodide into a sodium bisulfite solution and precipitated as palladium iodide.The precipitate was weighed for chemical yield and mounted on a nylon planchet for low-level beta counting.The chemical 4-7 1997 REMP ANNUAL REPORT yield was corrected by measuring the stable iodide content of the water with a specific ion electrode. During 1997, this procedure was used only on intercomparison samples, since the doses calculated via ODCM methodology for the consumption of drinking water did not exceed one millirem per year.4.4.5 Tritium in Water The analysis of tritium in water was performed utilizing liquid scintillation. Liquid scintillation requires 10 milliliters of.water mixed with 10 milliliters of liquid scintillation"cocktail." The mixture is then counted in an automatic liquid scintillation detector.4.4.6 Strontium-89 and 90 in Water, Milk and Soil During 1997, strontium analyses were not required for any routine REMP water, milk or soil samples.It was used for intercomparison water and sediment analyses.The techniques used to analyze for strontium in the various media are described below.Water Stable strontium carrier was added to one liter of sample and the volume is reduced by evaporation. Strontium was precipitated as Sr(NO,), using fuming (90%)nitric acid.Milk Stable strontium carrier was added to one liter of sample.The sample is then evaporated and ashed in a muffle furnace.The ash is dissolved and strontium precipitated as a phosphate. The sample is then redissolved and strontium precipitated as Sr(NO,), using fuming (90%)nitric acid.Soil and Sediment The sample is first dried under heat lamps and a 10-gram aliquot is taken.Stable strontium carrier is added and the sample is leached in hydrochloric acid.After the mixture is filtered, phosphates are then precipitated, collected by filtration, and dissolved.in nitric acid.Strontium is precipitated as Sr(NO,), using fuming (90%)nitric acid.A barium chromate scavenge and an iron (ferric hydroxide) scavenge are then performed. Stable yttrium carrier is added and the sample is allowed to stand for five days or more for yttrium ingrowth.Yttrium is then precipitated as hydroxide, dissolved and reprecipitated as oxalate.The yttrium oxalate is mounted on a nylon planchet and counted in a low-level beta counter to infer strontium-90 activity.Strontium-89 activity is determined by precipitating SrCO, from the sample after yttrium separation. This precipitate is mounted on a nylon planchet and covered with an 80 mg/cm'luminum .absorber for low-level beta counting.4.4.7 Iodine-131 in Milk Two liters of sample are first equilibrated with stable iodide carrier.A batch treatment with anion exchange resin is used to remove iodine from the sample.The iodine is then stripped from the resin with sodium hypochlorite solution, reduced with hydroxylamine hydrochloride, and extracted into carbon tetrachloride as free iodine.It was then back-extracted as iodide into sodium bisulfite solution and precipitated as palladium iodide.The precipitate was weighed for l997 REMP ANN VAL REPORT 4-8 chemical yield and mounted on a nylon planchet for low-level beta counting.The chemical yield is corrected by measuring the stable iodide content of the milk with a specific ion electrode. 4.5 Data Analysis Methods Since mid-1984, the results of the REMP analyses have been presented as net results calculated from the gross or total counts determined for each radionuclide minus the background counts of the counting or detection instrument. Consequently, for several sample types, the results range from negative to positive numbers.This manner of presenting environmental data prevents the bias and loss of individual results inherent in the use of"less than" (()values, where the"less than"'numbers can have a variety of meanings, such as."ass than the lower limit of detection (LLD)." A listing of the LLDs determined for each analysis is provided in Table 4-4 as a reference when reviewing the sample results.Plots of the sample results versus time are used to represent the results for analyses such as gross beta on air particulate filters, where the results are normally above the lower.limits of detection. In such cases, the indicator station results are plotted with the control station results for easy comparison. Other data analysis techniques, such as frequency dist'ributions, are also used to represent the data and to determine whether trends that could be attributed to Plant 2 operations are evident.Thermoluminescent dosimeter (TLD)data is presented in terms of the net mR/day exposure rate.These results are determined from the total exposure (in mR)calculated for each TLD from its total thermoluminescent output minus the TLD background, minus any transit (or trip)exposure received during distribution and retrieval, and divided by the number of days the TLD was in the field.Frequency distributions and graphs of TLD data by meteorological sector and distance from the plant are used to interpret trends in the results.TLD data summaries include the term"standard error." The standard error, which is the estimate of the precision of the mean, is used for the means of quarterly and annual data and is an indicator of the uncertainty associated with the results.The mean results of the quarterly TLDs are compared with the results of annual TLDs and expressed as a ratio by dividing the quarterly results by the annual result.4-9 1997 REMP ANNUAL REPORT TABLE 4-1 P RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM PLAN SAMPLE TYPE" 1.'IRBORNE SAMPLE STATION+'UMBER SAMPLING AND COLLECTION FREQUENCY"'YPE AND FREQUENCY OF ANALYSIS Particulates and radioiodine 1, 4-8, 9A, 21, 23, 40, 48, and 57 Continuous sampling;weekly collection (6/12)'+Paiticulate: Weekly gross beta'>;gamma isotopic@of quarterly composite (by location)Iodine: Weekly gamma analysis.Soil+'(0/7) 2.DIRECT RADIATION 9A, 1,7, 21 and 23, 101, 11.8 Annually Quarterly or more often as needed.Gamma isotopicto; strontium-90"'amma isotopic TLD@(34/6 1)PIC 3.WATERBORNE 1-8, 9A, 10-25, 4047, 49-51, 53-.56, 71-86 (1S-16S)9, 119B, 119-Control, 120-East Various locations, as needed"'uarterly, annually Continuous recording, as needed Thermoluminescent output;quarterly and annual processing. Exposure rate accumulated on mag card and in internal memory River/Drinking Water+(3/4)26, 27, 28 and 29 Composite aliquots'; monthly collection Gamma isotopic<a, gross beta, quarterly; tritium composite; strontium-90", 1-131'~Storm Drain Water (1/1)Sanitary Waste Treatment Facility Water (1/1)Ground Water (2/3)'~'iver Sediment (I/2)'<'anitary Waste Treatment Facility Sediment (1/I)101 102 31, 32,.and 52 33 and 34 102 Composite aliquots', weekly collection; grab samples Monthly, annually, pre-discharge and as needed.Quarterly Semiannually Monthly or more often as needed Gamma isotopic+, tritium, gross beta Gamma isotopic+, gross beta, gross alpha, tritium Gamma isotopic+; tritium Gamma isotopic+Gamma Isotopic+ TABLE 4-1 (Cont.)RADIOLOGICAL ENVIRONMENTAL MONITORING PROGRAM PLAN SAMPLE TYPE" Cooling Tower Sediment Disposal Area (0/1)4.INGESTION 119 SAMPLE STATION+NUMBER SAMPLING AND COLLECTION FREQUENCY'i Within 30 days following Cooling Tower cleaning event TYPE AND FREQUENCY OF ANALYSIS Gamma Isotopic'" Milk'4/4)9B, 36, 64 and 96" Semi-monthly during grazing season, monthly at other times Gamma isotopic+; iodine-131; strontium-90"'ish'i (2/2)30, 38 AnnuaHy'" Gamma isotopicto Garden Produce'(1/3) ~9C, 91co and 37 Monthly during growing season in the Riverview area of Pasco and a control near Grandview; annual collection at Station 91.Gamma isotopic@Vegetation (1/1)101 annually Gamma isotopic@(a)The fraction in parentheses for each sample type indicates the ratio of ODCM-required sample locations to the total number of sample locations currently being monitored in the surveillance program.The SCA also requires certain numbers of sampling stations for each type of media.(b)The underlined sample location designates a control station.(c)Deviations are permitted if samples are unobtainable due fo hazardous conditions, seasonal availability, malfunction of automatic sampling equipment, or other legitimate reasons.Such deviations are documented in Section 5 (d)(e)The SCA requires nine or more air sampling stations.Particulate sample filters will be analyzed for gross beta aAer at least 24 to 48 hours to allow for the decay of radon daughter products.If gross beta activity is greater than 10 times the mean of the result for the control, Station 9A, gamma isotopic analysis shall be performed on the individual sample.(f)Gamma isotopic means identification and quantification of gamma-emitting radionuclides that may be attributable to the eNuents of Plant 2. TABLE 4-1 (Cont.)Soil samples are collected to satisfy the requirements of the Site Certification Agreement (SCA)"'or Plant 2.The SCA requires that soil samples be collected at five air sampling locations. Strontium-90 analysis shall be performed on any indicator soil sample having cesium results greater than ten times the results for the control location.TLD refers to thermoluminescent dosimeter. For purposes of the REMP, a TLD is a phosphor card (31.75mm x 44.75mm x 0.4mm)with eight individual read-out areas (four main dosimeter. areas and four back-up dosimeter areas)in each badge case.TLDs used in the REMP meet the requirements of Reg Guide 4.13+and ANSI N545-1975, except for specified energy-dependence response.Correlation factors are available for energy ranges with response outside of specified tolerances. TLD Stations 71-86 are special interest stations and are not included among the 34 routine TLD stations required by the ODCM Table 6.3.1.1-1 (3.12-1).Their alternate designations are 1S-16S.The SCA requires that 25 or more TLD stations are located within a 10-mile radius of the plant.Pressurized ion chambers (PICs)are not required as part of the routine monitoring program, but they are required by the SCA to be maintained as a supplemental or backup system.PICs were used routinely at various locations during 1997 to provide supplemental information. The term"river/drinking water," instead of"surface/drinking water," is'used throughout this report because the surface water is taken from the Columbia River.Station 26, Plant 2 makeup water intake from the Columbia River is both an upstream surface, or river, water sample and the drinking water control sample location.Station 28 (300 Area)and Station 29 samples are drinking water samples.The Station 27 sample, which is drawn from the plant discharge line, is taken in place of a"downstream" water sample near but beyond the mixing zone.It reflects the radioactivity present in the plant discharge prior to any river dilution.The SCA requires'two drinking water locations downstream from the plant discharge and requires sampling from the plant intake and discharge water.Station 101, the storm drain pond, and Station 102, the Sanitary Waste Treatment Facility, are represented individually because they are unique sampling locations requiring special attention.(m)(n)Composite (integrated grab)samples are collected with equipment which collects an aliquot at time intervals that are short relative to the compositing period.A When the gross beta activity in drinking water exceeds 8 pCi/liter, a strontium-90 analysis is performed.(o)When the dose calculated via ODCM methodology for consumption of water exceeds 1 mrem per year, iodine-131 analyses are performed on the drinking water samples.The SCA requires sampling from wells used for fire protection and as backup drinking water sources.The SCA requires sediment sample collection upstream and downstream of the plant discharge. Milk samples will be obtained from farms or individual milk animals which are located in the most prevalent wind directions from Plant 2.Routine milk samples are collected in areas of high dose potential instead of within 5 kilometers, due to the locations of milk animals.The SCA requires at least three milk locations within the 10-mile radius of the plant and one in a control location.(s)Station 96 is the control station for milk samples because it was determined that the cows at Station 9B in Sunnyside were given feed grown in the Franklin County area across the Columbia River from Plant 2. TABLE 4-1 (Cont.)(t)If cesium-134 or cesium-137 is measured in an individual milk sample in excess of 30 pCi/1, then the strontium-90 analysis will be performed.(u)There are no commercially important species in the Hanford Reach of the Columbia River.Most recreationally important species in the area are anadromous (primarily salmonids), which ascend rivers from the sea for breeding.Four fish species will normally be collected by the electroshock technique in the vicinity of the plant discharge (Station 30)and from the Snake River (Station 38).If electro-shocking produces insufficient anadromous fish samples from the Snake River, samples may be obtained from the fish trap at Ice Harbor Dam, Lyons Ferry Fish Hatchery, or other similar facility.If insufficient anadromous fish samples are produced through electro-shocking on the Columbia River, samples may be obtained at the Ringold Fish Hatchery.(v)If an impact is indicated, sampling will be conducted semiannually.(w)Garden produce will routinely be obtained from farms or gardens.using Columbia River water for irrigation. One sample of a root crop, leafy vegetable, and a fruit is collected each sample period, if available. The variety of the produce obtained will be dependent on seasonal availability.(x)Station 91 is an apple orchard irrigated with Columbia River water.The apple crop from Station 91 is sampled annually. TABLE 4-2 REMP SAMPLE LOCATIONS BY SECTOR SECTOR" N (1)STATION+~NUMBER 52 71(1S)47 57 18 53 0.1 0.3 0.5 0.8 1.1 7.5 161 483 805 1201 1770 12068 GW TLD TLD AP/AI TLD TLD ESTIMATED DISTANCE('i MILES METERS SAMPLE TYPE(+NNE (2)NE (3)ENE (4)E (5)ESE (6)72(2S)2 54 73(3S)19 48 39 46 101 74(4S)21 20 11 33 45 44 75(SS)22 10 26 27(')30 43 76(6S)31 32 51 23 34 91 8 42 36(e)5 64 38 0.4 1.8 6.5 0.5 1.8 4.5 4.4 5.0 0.3 0.4 1.5 1.9 3.1 3.6 4.3 5.8 0.4 2.1 3.1 3.2 3.2 3.3 5.8 0.4 1.1 1.2 2.1 3.0 3.5 4,4 4.5 5.6 7.2 7.7 9.7'6.5 644 2896 10459 805 2896 7241 7084 8045 483 644 2414 3057 4988 5792 6919 9332 3379 4988 5149 5149 5311 9332 644 1770 1931 3379 4827 5632 7079 7241 9010 11585 12389 15610 42639 TLD TLD TLD TLD TLD AP/AI FI TLD SDW/SE/SO/VE TLD AP/AI/SO/TLD TLD TLD SE TLD TLD TLD TLD TLD PW DW FI TLD TLD GW GW TLD AP/AI/SO/TLD SE FR AP/AI/TLD TLD MI AP/AI/TLD MI FI 1997 REMP ANNUAL REPORT 4-14 TABLE 4-2 (Cont.)REMP SAMPLE LOCATIONS BY SECTOR SECTOR(')SE (7)STATION+)NUMBER 118 77(7S)24 3 41 40 0.3 0.5 1.9 2.0 5.8 6.4 483'05 3057 3218 9332 10298 ESTIMATED DISTANCE" MILES METERS SAMPLE TYPE(4'O TLD.TLD TLD AP/AI/TLD S (9)SSW (10)SW (11)WSW (12)W (13)WNW (14)NW (15)NIAV (16)102 119-Control 120 78(8S)25 55 28 4 29 37 119 119B 79(9S)1 65 6 80(10S)50 56 81(11S)13 96 82(12S)14 9A, 9B, 9C 83(13S)15 84(14S)16 7 85(15S)49 86(16S)17.12 0.4 0.2 0.3 0.7 1.6 6.2 7.4 9.3 11.0 16.0 0.2 0.2 0.7 1.3 7.3 7.7 0.8 1.2 7.0 0.7 1.4 36.0 0.5 1.4 30.0 0.5 1.4 0.5 1.4 2.7 0.5 1.2 0.4 1.2 3.1 644 335 483 1126 2574 9976 11907 14964 17699 25744 366 381 1126 2092 11748 12389 1287 1931 11263 1126 2253 49250 805 2253 48270 805 2253 805 2253 4344 805 1931 644 1931 4988 SWW/SE TLD SO/TLD TLD'LD TLD PW AI/AP/TLD PW GP SO TLD TLD AP/AI/SO/TLD TLD AP/AI/TLD TLD TLD TLD TLD TLD MI TLD TLD AP/AI/MI/GP/TLD/SO TLD TLD TLD TLD AP/AI/SO/TLD TLD TLD TLD TLD'LD 4-15 1997 REMP ANNUAL REPORT (a)TABLE 4-2 (Cont.)The area in the v'icinity of Plant 2 is separated into 16 separate sectors for reporting purposes.The 16 sectors cover 360 degrees in equal 22.5 degree sections, beginning with Sector 1 (N)at 348.75 to 11.25 degrees and continuing clockwise through Sector 16 (NNW).(b)The alternate designations for TLD Stations 71-86 are given in parentheses, i.e., 1S-16S.(c)Distances are estimated from map positions for each location as a radial distance from Plant 2 containment.(d)Sample Type Key:.AI-'Air Iodine DW-Discharge Water FR-Fruit GW-Ground Water PW-Surface (River)/Drinking SE-Sediment SWW-Sanitary Waste Water VE-Vegetation AP-Air Particulate .Fl-Fish GP-Garden Produce MI-Milk Water SDW-Storm Drain Water SO-Soil TLD-'11iermoluminescent Dosimeter Station 9 designates the Sunnyside-Grandview control area.It is actually three separate stations (Stations 9A for TLD, Al/AP and SO, 9B for milk, and 9C for GP)within a few miles of each other and all within 30-35 miles of Plant 2.Station 96, which is the control station for milk, is also located within the control area.It is 36 miles from Plant 2.Station 9B, which was the control location for milk until 1986, is now an indicator milk location.(e)Duplicate samples, i.e., samples drawn at the same time as the routine samples and submitted for analysis as a quality assurance check, are collected at this location.The station designation for the duplicate of Station 27 is Station 72 for second and fourth quarters and 92 for the first quarter.The station designation for the duplicate of Station 36 is Station 37.1997 REMP ANNUAL REPORT 4-16 TABLE 4-3 19 7 FIVE MlLE LAND USE CENSUS RESULTS SECTOR('i NEAREST RESIDENTS'> GARDEN ()50M')DAIRY<'>ANIMALS LIVESTOCK 4.3 4.1 4.5 4.2 none 4.1<<none 4 3(4 none none none none 4.8 none none 4.6 SE none none none none (a)Eleven of the sixteen meteorological sectors within the five-mile radius of Plant 2 are on the federally-owned Hanford Site;the remaining land is comprised of 4.5 sq.miles of privately-owned farm land.Only those sectors containing points of interest are presented here.(b)Estimated distances in miles.(c)The closest dairy animal locations are at 8.3 miles SE and 7.2 and 9.7 miles ESE.The dairy at 8.3 miles SE is not used for milk sample collection due to the owner's reluctance to participate in the sampling program.(d)Small garden with broadleaf; samples were not available due to the small amounts grown.4-17 1997 REMP ANNUAL REPORT TABLE 4-4 C MPARISON OF TELEDYNE NOMINAL LOWER LIMITS OF DETECTION WITH OFFSITE DOSE CALCULATION MANUAL RE UIREMENTS N MEDIA (UNITS)Air (pCi/mi)IVateri (pCi/I)Soil/Sediment: (pCi/kg dry)Fish: (pCi/kg wet)ltiilk: (pCin)ANALYSIS Gross Beta Ganuna Spectrometry Cs-134 Cs-137 1-131 Gross Beta Tritium 1-131 Sr 90 Gamma Spectrometry Mn-54 Fe-59 Co-58 Co-60 Zn-65 Zr-95 Nh-95 Cs-134 Cs-137 Ba-140 La-140 Gamins Spectroinetry Co-57 Co-60 Zn-65 Cs-134 Cs-137 Sr-90 Gamma Spectrometry Mn-54 Fe-59 Co-58 Co-60 Zn-65 Cs-134 Cs-137 1-131 Gamma Spectrometry Cs-134 Cs-137 Ba-140 La-140 Sr-90 TELEDYNE LLDs 0.003 0.001.0.001 0.01 4 300 I I 10 20 10 10 20 20 10 10 10 20 10 120 30 100 30 40 10 20 30 20 20 30 20 20 0.5 10 10 20 10 I BTP REQUIRED LLDs 0.01 0.05 0.06 0.07 4 2000 15 30 15 IS 30 30 15~IS 18 60 15 150 180 130 260 130 130 260 130 150 IS 18 60 15 Garden Produce: (pCi/kg wet)Gamma Spectroinetry Cs-134 Cs-137 1-131 20 20 30 60 80 60'hese are the contract LLDs.Actual LLDs may be lower.for specific samples.+If no drinking water pathway exists, a value of 3,000 pCi/l may be used.1997 REMP ANNUAL REPORT 4-18}}