Letter Sequence Acceptance Review |
---|
|
|
MONTHYEARML21189A0202021-06-29029 June 2021 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise Technical Specifications 3.3.6 and 3.3.7 Re Radiation Monitor Redundant Unit of Measure Project stage: Acceptance Review ML22014A2062022-05-0404 May 2022 Issuance of Amendment Nos. 152 and 61 Regarding Revision to Technical Specifications to Delete a Redundant Unit of Measure for Certain Radiation Monitors Project stage: Approval 2021-06-29
[Table View] |
|
---|
Category:E-Mail
MONTHYEARML24022A2592024-01-22022 January 2024 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Unit 1, License Amendment Request to Revise TS LCO 3.8.2 to Remove Note C-S Diesel Generator ML24016A0762024-01-16016 January 2024 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2 - License Amendment Request to Rebaseline of Sections 3.1 and 3.2 of the Technical Specifications ML23347A0642023-12-13013 December 2023 12-13-23 Email from Kimberly Green to Wells, Russell, Subject: Results of NRC SUNSI Review of Watts Bar Nuclear Plant Dual-Unit UFSAR, Amendment 5 ML23334A0932023-11-28028 November 2023 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise TS Surveillance Requirement 3.9.5.1 to Reduce RHR Flow Rate During Mode 6 ML23319A1662023-11-0202 November 2023 NRR E-mail Capture - Acceptance Review Results for Browns Ferry Nuclear Plant, Sequoyah Nuclear Plant, and Watts Bar Nuclear Plant, Exemption Request Related to 10 CFR 37.11(c)(2) ML23254A2872023-09-11011 September 2023 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise TS Table 1.1-1 Re Number of Required Rvh Closure Bolts ML23236A2562023-08-24024 August 2023 NRR E-mail Capture - Acceptance Review Results for the Sequoyah and Watts Bar License Amendment Request to Adopt TSTF-567 (L-2023-LLA-0106) ML23191A8672023-07-10010 July 2023 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-501-A, Revision 1, Relocate Stored Fuel Oil and Lube Oil Volume Values to Licensee Control ML23166A1142023-06-15015 June 2023 Document Request for Watts Bar Nuclear Plant - Radiation Protection Inspection - Inspection Report 2023-03 ML23150A2472023-05-25025 May 2023 NRR E-mail Capture - Audit Plan Related to Review of the Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Increase the Number of Tritium Producing Burnable Absorber Rods ML23116A1492023-04-21021 April 2023 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Increase the Number of Tritium Producing Burnable Absorber Rods ML23075A0032023-03-13013 March 2023 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Units 1, 2, and 3, License Amendment Request to Revise TS 3.7.11, Required Actions A.1 and E.1 Footnotes Re Date for the Modification ML23072A0722023-03-10010 March 2023 NRR E-mail Capture - (External_Sender) State Consultation - Sequoyah Nuclear Plant, Units 1 and 2; and Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise Technical Specification 3.4.12 (L-2022-LLA-0103) ML23067A2372023-03-0808 March 2023 WB_2023-02_RP_inspection_doc_request ML23013A0382023-01-12012 January 2023 NRR E-mail Capture - (External_Sender) State Consultation for Alabama - Browns Ferry, Units 1, 2 and 3; Sequoyah, Units 1 and 2; and Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-529, Revision 4 (L-2022-LLA-0088) ML23013A0362023-01-12012 January 2023 NRR E-mail Capture - (External_Sender) State Consultation for Alabama - Browns Ferry, Units 1, 2 and 3; Sequoyah, Units 1 and 2; and Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-554-A, Revision 1 (L-2022-LLA-0100) ML22356A2982022-12-22022 December 2022 Email Response to Letter, Dated November 22, 2022 Regarding Watts Bar Integrated Inspection Report ML22353A0812022-12-15015 December 2022 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Unit 2, Alternative Request WBN-2-ISI-01 Regarding Examination of Upper Head Injection Nozzle Dissimilar Metal Piping Butt Welds ML22348A0972022-12-14014 December 2022 NRR E-mail Capture - State Consultation - Browns Ferry, Units 1, 2 and 3; Sequoyah, Units 1 and 2; and Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-529, Revision 4 (L-2022-LLA-0088) ML22348A0442022-12-13013 December 2022 NRR E-mail Capture - State Consultation - Browns Ferry, Units 1, 2 and 3; Sequoyah, Units 1 and 2; and Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-554-A, Revision 1 (L-2022-LLA-0100) ML22343A0692022-12-0808 December 2022 NRR E-mail Capture - Request for Additional Information - Sequoyah Nuclear Plant, Units 1 and 2, and Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise Technical Specification 3.4.12 (L-2022-LLA-0103) ML22227A0712022-08-15015 August 2022 NRR E-mail Capture - Acceptance Review Results for Sequoyah and Watts Bar License Amendment Request to Revise TS 3.4.12 (EPID L-2022-LLA-0103) - Corrected ML22227A0262022-08-12012 August 2022 NRR E-mail Capture - Acceptance Review Results for Sequoyah and Watts Bar License Amendment Request to Revise TS 3.4.12 ML22227A0272022-08-11011 August 2022 NRR E-mail Capture - Request for Additional Information Related to Alternative Requests RP-11 for Sequoyah Nuclear Plant, Units 1 and 2, and IST-RR-9 for Watts Bar Nuclear Plant, Units 1 and 2 ML22215A2752022-08-0303 August 2022 NRR E-mail Capture - Acceptance Review Results for TVA Fleet License Amendment Request to Adopt TSTF-554 ML22194A8762022-07-13013 July 2022 NRR E-mail Capture - Acceptance Review Results for TVA Fleet License Amendment Request to Adopt TSTF-529 ML22166A4292022-06-0606 June 2022 NRR E-mail Capture - LAR to Adopt TSTF-577 ML22146A3342022-05-25025 May 2022 NRR E-mail Capture - Acceptance Review Results for Browns Ferry Nuclear Plant, Units 1, 2, and 3, Sequoyah Nuclear Plant, Units 1 and 2, and Watts Bar Nuclear Plant, Units 1 and 2, Relief Requests (EPID L-2022-LLR-0045 - 0047) ML22136A0182022-05-16016 May 2022 NRR E-mail Capture - Acceptance Review Results for Sequoyah Nuclear Plant, Units 1 and 2, Alternative Request RP-11 and Watts Bar Nuclear Plant, Units 1 and 2, Alternative Request IST-RR-9 ML22144A1002022-05-12012 May 2022 NRR E-mail Capture - Request for Additional Information Related to Tva'S Request to Revised the TVA Plants' Radiological Emergency Plans ML22123A1812022-05-0303 May 2022 NRR E-mail Capture - Acceptance Review Results for Sequoyah Nuclear Plant, Units 1 and 2, and Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Adopt TSTF-577 ML22115A1402022-04-25025 April 2022 NRR E-mail Capture - Requests for Confirmation of Information and Additional Information Regarding Watts Bar Nuclear Plant, Unit 2 Exemption Request Re 10 CFR Part 26 (L-2022-LLE-0017) ML22083A2372022-03-24024 March 2022 NRR E-mail Capture - Request for Additional Information and Confirmation of Information Related to Tva'S Request for Changes to Watts Bar Nuclear Plant, Units 1 and 2, Technical Specification 3.7.8 ML22081A2222022-03-22022 March 2022 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Unit 1, License Amendment Request to Revise Allowable Value for TS Table 3.3.2-1, Function 6.e(1) ML22056A3802022-02-25025 February 2022 Document Request for Watts Bar Nuclear Plant - Radiation Protection Inspection - Inspection Report 2022-02 ML22131A1902022-02-23023 February 2022 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Unit 2, Request to Revise the Reactor Vessel Surveillance Capsule Withdrawal Schedule ML22046A0392022-02-15015 February 2022 NRR E-mail Capture - Request for Confirmation of Information Regarding the Watts Bar Nuclear Plant, Unit 2, Cycle 4 Mid-Cycle Outage Generic Letter 95-05 Final Report ML22038A1882022-02-0404 February 2022 NRR E-mail Capture - Acceptance Review Results for TVA Fleet License Amendment Request to Revise the TVA Radiological Emergency Plan ML22018A0272022-01-18018 January 2022 2022 All RFI Responses - Exercise and Program Inspections - Revl ML22011A0382022-01-10010 January 2022 NRR E-mail Capture - Acceptance Review Results for Watts Bar, Units 1 and 2, License Amendment Request to Adopt TSTF-205-A, Rev. 3 and TSTF-563-A ML21306A2452021-11-0202 November 2021 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise Technical Specification 3.7.8, Essential Raw Cooling Water (ERCW) System ML21267A1392021-09-23023 September 2021 Document Request for Upcoming RP Inspection at Watts Bar ML21252A0912021-09-0909 September 2021 NRR E-mail Capture - Request for Comments on Proposed Issuance of Amendments to Watts Bar Nuclear Plant, Unit 2 - Revise Steam Generator Secondary Side Water Level ML21223A2592021-08-11011 August 2021 Affidavit - Prop Slides - Partially Closed Meeting with TVA Potential Watts Bar, Unit 2 Tube Locking LAR ML21221A2602021-08-0909 August 2021 NRR E-mail Capture - Request for Additional Information Regarding Tva'S Request to Revise Watts Bar, Unit 1 Tech Specs Related to Continuous Opening of the Auxiliary Building Secondary Containment Enclosure Boundary ML21215A1152021-07-26026 July 2021 NRR E-mail Capture - (External_Sender) Correction to WBN Chiller Replacement LAR ML21215A1142021-07-26026 July 2021 NRR E-mail Capture - (External_Sender) Correction to WBN Chiller Replacement LAR ML21197A0452021-07-15015 July 2021 WBN U1 Isi/Sgisi Request for Information (RFI) Letter ML21193A2422021-07-12012 July 2021 NRR E-mail Capture - Request for Additional Information Regarding Tva'S Request to Revise the Watts Bar Nuclear Plant, Unit 2 Technical Specifications Related to Steam Generator Inspection/Repair Program Provisions ML21189A0202021-06-29029 June 2021 NRR E-mail Capture - Acceptance Review Results for Watts Bar Nuclear Plant, Units 1 and 2, License Amendment Request to Revise Technical Specifications 3.3.6 and 3.3.7 Re Radiation Monitor Redundant Unit of Measure 2024-01-22
[Table view] |
Text
&Ž '<
^ d:D
dŽ tZŽ
tŽ
^ ZZŽtEWh>
ZŽZd^Ž
ZŽDŽŽZhŽDW/>>>
'HDU0U:HOOV
%\OHWWHUGDWHG-XQH $JHQF\ZLGH'RFXPHQWV$FFHVVDQG0DQDJHPHQW6\VWHP
$FFHVVLRQ1R0/$ 7HQQHVVHH9DOOH\$XWKRULW\ 79$ VXEPLWWHGDOLFHQVH
DPHQGPHQWUHTXHVW /$5 IRUWKH:DWWV%DU1XFOHDU3ODQW :DWWV%DU 8QLWVDQG7KH
SURSRVHGDPHQGPHQWVZRXOGUHYLVH:DWWV%DU8QLWDQG7HFKQLFDO6SHFLILFDWLRQ 76
³&RQWDLQPHQW9HQW,VRODWLRQ,QVWUXPHQWDWLRQ'DQG76³&RQWURO5RRP(PHUJHQF\
9HQWLODWLRQ6\VWHP &5(96 $FWXDWLRQ,QVWUXPHQWDWLRQ'WRGHOHWHDUHGXQGDQWXQLWRIPHDVXUH
DVVRFLDWHGZLWKWKHWULSVHWSRLQWRI767DEOH)XQFWLRQ³&RQWDLQPHQW3XUJH([KDXVW
5DGLDWLRQ0RQLWRUV'DQG767DEOH)XQFWLRQ³&RQWURO5RRP5DGLDWLRQ&RQWURO5RRP
$LU,QWDNHV'
7KHSXUSRVHRIWKLVHPDLOLVWRSURYLGHWKHUHVXOWVRIWKH861XFOHDU5HJXODWRU\&RPPLVVLRQ
15& VWDII¶VDFFHSWDQFHUHYLHZRIWKHSURSRVHG/$57KHDFFHSWDQFHUHYLHZZDVSHUIRUPHG
WRGHWHUPLQHLIWKHUHLVVXIILFLHQWWHFKQLFDOLQIRUPDWLRQLQVFRSHDQGGHSWKWRDOORZWKH15&VWDII
WRFRPSOHWHLWVGHWDLOHGWHFKQLFDOUHYLHZ7KHDFFHSWDQFHUHYLHZLVDOVRLQWHQGHGWRLGHQWLI\
ZKHWKHUWKHDSSOLFDWLRQKDVDQ\UHDGLO\DSSDUHQWLQIRUPDWLRQLQVXIILFLHQFLHVLQLWV
FKDUDFWHUL]DWLRQRIWKHUHJXODWRU\UHTXLUHPHQWVRUWKHOLFHQVLQJEDVLVRIWKHSODQW
&RQVLVWHQWZLWK6HFWLRQRI7LWOHRIWKHCode of Federal RegulationsDQDPHQGPHQWWR
WKHOLFHQVH LQFOXGLQJWKHWHFKQLFDOVSHFLILFDWLRQV PXVWIXOO\GHVFULEHWKHFKDQJHVUHTXHVWHG
DQGIROORZLQJDVIDUDVDSSOLFDEOHWKHIRUPSUHVFULEHGIRURULJLQDODSSOLFDWLRQV7KH15&VWDII
KDVUHYLHZHG79$¶V/$5DQGFRQFOXGHGWKDWLWGRHVSURYLGHWHFKQLFDOLQIRUPDWLRQLQVXIILFLHQW
GHWDLOWRHQDEOHWKH15&VWDIIWRFRPSOHWHLWVGHWDLOHGWHFKQLFDOUHYLHZDQGPDNHDQ
LQGHSHQGHQWDVVHVVPHQWUHJDUGLQJWKHDFFHSWDELOLW\RIWKHSURSRVHGDPHQGPHQWVLQWHUPVRI
UHJXODWRU\UHTXLUHPHQWVDQGWKHSURWHFWLRQRISXEOLFKHDOWKDQGVDIHW\DQGWKHHQYLURQPHQW
- LYHQWKHOHVVHUVFRSHDQGGHSWKRIWKHDFFHSWDQFHUHYLHZDVFRPSDUHGWRWKHGHWDLOHG
WHFKQLFDOUHYLHZWKHUHPD\EHLQVWDQFHVLQZKLFKLVVXHVWKDWLPSDFWWKH15&VWDII¶VDELOLW\WR
FRPSOHWHWKHGHWDLOHGWHFKQLFDOUHYLHZDUHLGHQWLILHGGHVSLWHFRPSOHWLRQRIDQDGHTXDWH
DFFHSWDQFHUHYLHZ,IDGGLWLRQDOLQIRUPDWLRQLVQHHGHG\RXZLOOEHDGYLVHGE\VHSDUDWH
FRUUHVSRQGHQFH
%DVHGRQWKHLQIRUPDWLRQSURYLGHGLQ79$¶VVXEPLWWDOWKH15&VWDIIKDVHVWLPDWHGWKDWWKLV
OLFHQVLQJUHTXHVWZLOOWDNHDSSUR[LPDWHO\KRXUVWRFRPSOHWHDQGWKDWWKHUHYLHZFDQEH
FRPSOHWHGE\-XQH,IWKHUHDUHHPHUJHQWFRPSOH[LWLHVRUFKDOOHQJHVLQRXUUHYLHZWKDW
ZRXOGFDXVHFKDQJHVWRWKHLQLWLDOIRUHFDVWHGFRPSOHWLRQGDWHRUVLJQLILFDQWFKDQJHVLQWKH
IRUHFDVWHGKRXUVWKHUHDVRQVIRUWKHFKDQJHVDORQJZLWKWKHQHZHVWLPDWHVZLOOEH
FRPPXQLFDWHGGXULQJWKHURXWLQHLQWHUDFWLRQV7KHVHHVWLPDWHVDUHEDVHGRQWKHVWDII¶VLQLWLDO
UHYLHZRIWKHDSSOLFDWLRQDQGWKH\FRXOGFKDQJHGXHWRVHYHUDOIDFWRUVLQFOXGLQJUHTXHVWVIRU
DGGLWLRQDOLQIRUPDWLRQDQGXQDQWLFLSDWHGDGGLWLRQRIVFRSHWRWKHUHYLHZ
,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQWDFWPHDW
6LQFHUHO\
.LPEHUO\-*UHHQ6HQLRU3URMHFW0DQDJHU
3ODQW/LFHQVLQJ%UDQFK,,
'LYLVLRQRI2SHUDWLQJ5HDFWRU/LFHQVLQJ
2IILFHRI1XFOHDU5HDFWRU5HJXODWLRQ
+HDULQJ,GHQWLILHU 155B'50$
(PDLO1XPEHU
0DLO(QYHORSH3URSHUWLHV %/$350%)'&'$'$)()
6XEMHFW $FFHSWDQFH5HYLHZ5HVXOWVIRU:DWWV%DU1XFOHDU3ODQW8QLWVDQG/LFHQVH
$PHQGPHQW5HTXHVWWR5HYLVH7HFKQLFDO6SHFLILFDWLRQVDQGUH5DGLDWLRQ0RQLWRU5HGXQGDQW
8QLWRI0HDVXUH (3,'///$
6HQW'DWH $0
5HFHLYHG'DWH $0
)URP *UHHQ.LPEHUO\
&UHDWHG%\ .LPEHUO\*UHHQ#QUFJRY
5HFLSLHQWV
:URQD'DYLG'DYLG:URQD#QUFJRY!
7UDFNLQJ6WDWXV1RQH
:HOOV5XVVHOO'RXJODVUGZHOOV#WYDJRY!
7UDFNLQJ6WDWXV1RQH
3RVW2IILFH %/$350%QDPSUGSURGRXWORRNFRP
)LOHV 6L]H 'DWH 7LPH
0(66$*( $0
2SWLRQV
3ULRULW\ 1RUPDO
5HWXUQ1RWLILFDWLRQ 1R
5HSO\5HTXHVWHG 1R
6HQVLWLYLW\ 1RUPDO
([SLUDWLRQ'DWH