|
---|
Category:CORRESPONDENCE-LETTERS
MONTHYEARML20217P7111999-10-26026 October 1999 Informs That Licensee 990330 Response to GL 97-06 Provides Reasonable Assurance That Condition of Licensee Steam Generator Internals Is in Compliance with Current Licensing Bases for Plant ML20217K3571999-10-21021 October 1999 Discusses Use of SONGS as Generic Safety Issue 191 Ref Plant.Future Requests for Info & Addl Coordination Activities Be Handled Through D Evans of Organization.With Diskette ML20217K8541999-10-21021 October 1999 Forwards Revised Pages to ERDS Data Point Library,Per Requirements of 10CFR50,App E,Section VI.3.a.Described Unit 2 & 3 Changes for 2/3R7813 Were Completed on 990924 ML20217L9491999-10-21021 October 1999 Forwards SONGS Emergency Response Telephone Directory, for Oct-Dec 1999 ML20217J8631999-10-15015 October 1999 Forwards Insp Repts 50-361/99-12 & 50-362/99-12 on 990808- 0918.One Violation Identified Involving Inoperability of Emergency Diesel Generator in Excess of Allowed Outage Time ML20217E3221999-10-13013 October 1999 Forwards MORs for Sept 1999 for Songs,Units 2 & 3.No Challenges Were Noted to Psvs for Either Units 2 or 3 ML20217E7671999-10-12012 October 1999 Forwards Rev 62 to NRC Approved Aug 1983, Physical Security Plan,Songs,Units 1,2 & 3, IAW 10CFR50.54(p).Changes,as Described in Encls 1 & 2,do Not Reduce Effectiveness of Plan.Encl Withheld,Per 10CFR73.21 ML20217B5981999-10-0606 October 1999 Informs That Staff Concluded That All Requested Info for GL 98-01, Year 2000 Readiness in Us Nuclear Power Plants, Provided for San Onofre Nuclear Generating Station,Units 2 & 3 ML20216H8741999-09-29029 September 1999 Provides Requested Written Response to GL 99-02, Lab Testing of Nuclear-Grade Activated Charcoal. Lab Testing of Charcoal Adsorber Samples for Creacus & Pacu Satisfies Listed Requirements ML20216H8541999-09-29029 September 1999 Submits Encl Request for Relief from ASME Code,Section III Requirements in 10CFR50.55(a)(3) to Use Mechanical Nozzle Seal Assembly as Alternate ASME Code Replacement at SONGS, Units 2 & 3 for Period of Operation Beginning with Cycle 11 ML20216J2631999-09-28028 September 1999 Forwards Copy of Final Accident Sequence Precursor (ASP) Analysis of Operational Event at Songs,Unit 2,reported in LER 361/98-003 ML20212H4461999-09-28028 September 1999 Forwards Suppl Info,As Discussed with NRC During 990812 Telcon,To Support Risk Informed Inservice Testing & GL 96-05, Periodic Verification of Design-Basis Capability of Safety-Related Movs ML20212G5611999-09-24024 September 1999 Informs NRC That SCE Remains Committed to Performing Eddy Current Examinations of 100% of Reactor Vessel Head Penetrations at Songs,Unit 3.Exams Will Not Be Performed During Cycle 11 RFO 05000361/LER-1999-005, Forwards 30-day follow-up LER 99-005-00,describing Loss of Physical Train Separation in Control Room.Any Actions Listed Intended to Ensure Continued Compliance with Existing Commitments1999-09-23023 September 1999 Forwards 30-day follow-up LER 99-005-00,describing Loss of Physical Train Separation in Control Room.Any Actions Listed Intended to Ensure Continued Compliance with Existing Commitments ML20212D9921999-09-16016 September 1999 Informs That on 990818,NRC Staff Completed Midcycle PPR of San Onofre.Nrc Plan to Conduct Core Insps & One Safety Issues Evaluation of MOVs at Facility Over Next 7 Months. Details of Insp Plan Through March 2000 Encl ML20212A4061999-09-14014 September 1999 Forwards Revised Pages to ERDS Data Point Library.Described Unit 2 Changes for 2R7817 & 2R7828 Were Completed on 990818 & Unit 3 Change for 3R7828 Was Completed on 990903 ML20216E6031999-09-10010 September 1999 Provides Response to NRC Administrative Ltr 99-03, Preparation & Scheduling of Operator Licensing Exams, Dtd 990820.Schedule Shown on Attachment 1, Operator Licensing Exam Data, Provides Util Best Estimate Through Cy 2003 ML20217B9011999-09-10010 September 1999 Responds to Which Addressed Concerns Re Y2K Issue & Stockpiling of Potassium Iodide (Ki) Tablets by Informing That San Onofre Nuclear Station Already Completed All Work Required to Be Ready for Y2K Transition ML20211K4191999-09-0303 September 1999 Final Response to FOIA Request for Documents.Documents Listed in App a Being Withheld in Part (Ref FOIA Exemptions 5 & 7) ML20211N0261999-09-0303 September 1999 Forwards Exemption from Certain Requirements of 10CFR50.44 & 10CFR50,app A,General Design Criterion 41 in Response to Util Request of 980910,as Supplemented 990719 & SER 05000206/LER-1999-001, Forwards LER 99-001-00 for Occurrence Re Unattended Security Weapon Inside Protected Area.Single Rept for Unit 1 Is Being Submitted,Iaw NUREG-1022,Rev 1,since Condition Involves Shared Sys & Is Applicable to Units 1,2 & 31999-08-31031 August 1999 Forwards LER 99-001-00 for Occurrence Re Unattended Security Weapon Inside Protected Area.Single Rept for Unit 1 Is Being Submitted,Iaw NUREG-1022,Rev 1,since Condition Involves Shared Sys & Is Applicable to Units 1,2 & 3 ML20211H3321999-08-30030 August 1999 Discusses 1999 Emergency Preparedness Exercise Extent of Play & Objectives.Based on Review,Nrc Has Determined That Exercise Extent of Play & Objectives Are Appropriate to Meet Emergency Plan Requirements ML20211J7151999-08-27027 August 1999 Forwards Insp Repts 50-361/99-09 & 50-362/99-09 on 990627- 0807.Two Violations Being Treated as non-cited Violations ML20211H8561999-08-23023 August 1999 Forwards SE Accepting Licensee 970625 Requests for Relief RR-E-2-03 - RR-E-2-04 from Exam Requirements of Applicable ASME Code,Section Xi,For First Containment ISI Interval ML20211J5821999-08-23023 August 1999 Corrected Copy of ,Changing Application Date from 970625 to 990625.Ltr Forwarded SE Accepting Licensee 990625 Requests for Relief RR-E-2-03 - RR-E-2-08 from Exam Requirements of Applicable ASME Code,Section XI as Listed ML20210V4271999-08-16016 August 1999 Forwards Proprietary Certified Renewal Applications for SROs a Harkness,R Grabo & T Vogt & RO D Carter,Submitted on Facsimile Form NRC-398 & Certified NRC Form 396.Encls Withheld ML20210R6681999-08-13013 August 1999 Forwards Response to NRC RAI Re SCE License Amend Applications 173 & 159 for Songs,Units 2 & 3,proposed Change Number 485,which Requests Addition of SR to TS 3.3.9, CR Isolation Signal ML20211A9501999-08-12012 August 1999 Discusses 990720-21 Workshop Conducted in Region IV Ofc,Re Exchange of Info in Area of Use of Risk Insights in Regulatory Activities.List of Attendees,Summary of Topic & Issues,Agenda & Copies of Handouts Encl ML20210Q6451999-08-12012 August 1999 Forwards Monthly Operating Repts for July 1999 for SONGS, Units 2 & 3,per TS 5.7.1.4.There Were No Challenges to Pressurizer Safety Valves for Either Units ML20210P5711999-08-11011 August 1999 Forwards Amend Application Number 189 for License NPF-10 & Amend Application Number 174 to License NPF-15,replacing Analytical Limits Currently Specified as Acceptance Criteria with Allowable Values,Per Encl Calculation E4C-098 ML20210P4681999-08-11011 August 1999 Forwards COLR for Cycle 10 for Songs,Units 2 & 3,IAW TS Section 5.7.1.5.d, Colr. Changes to COLR Parameters Have Been Conducted IAW Approved COLR Methodologies & All Applicable Limits of Safety Analysis Were Met ML20210P6221999-08-10010 August 1999 Forwards Replacement Pages for Attachments E & F of Amend Application Numbers 168 & 154 for Songs,Units 2 & 3.Pages Are Provided to Correct Errors to Pagination & Headings in 970618 Submittal ML20210N9721999-08-10010 August 1999 Responds to Appeal of FOIA Request for Documents Re Osre Issue.No Osre Visit Scheduled for Sept 1996 at Plant,Per 990722 Telcon.V Dricks,In Ofc of Public Affairs Should Be Contacted Re Osre Issue ML20210N0901999-08-0909 August 1999 Informs That 990312 Application Requested Amends to Licenses DPR-13,NPF-10 & NPF-15,respectively,being Treated as Withdrawn.Proposed Change Would Have Modified Facility TSs Pertaining to SONGS Physical Security Plan ML20210N5051999-08-0909 August 1999 Forwards Cycle 10 Update to TS Bases,Which Have Been Revised Between 980101-990630,per 10CFR50.71(e) 05000361/LER-1999-004, Forwards LER 99-004-00 Re Automatic Tgis Actuation.Event Affected Units 2 & 3 Equally Because Tgis Is Shared Sys. Single Rept Is Being Provided for Unit 2 IAW NUREG-1022, Rev 1.No New Commitments Are Contained in Encl1999-08-0606 August 1999 Forwards LER 99-004-00 Re Automatic Tgis Actuation.Event Affected Units 2 & 3 Equally Because Tgis Is Shared Sys. Single Rept Is Being Provided for Unit 2 IAW NUREG-1022, Rev 1.No New Commitments Are Contained in Encl ML20210L2311999-08-0505 August 1999 Forwards ISI Summary Rept,Including Owners Repts of Repairs & Replacements,For Songs,Unit 3.Rept Covers 970916 Through 990509,date Unit 3 Returned to Service Following Cycle 10 Refueling Outage ML20210L1461999-08-0303 August 1999 Informs That NRC Plans to Administer Gfes of Written Operator Licensing Exam on 991006.Requests Submittal of Ltr Identifying Individuals Taking Exam,Personnel Allowed Access to Exams & Mailing Address for Exams ML20216D9671999-07-29029 July 1999 Provides Response to RAI to Support Proposed TS Change 460 Re Containment Isolation Valve Completion Time for SONGS, Units 2 & 3.Rev 3 to Abnormal Operating Instruction SO23-13-14, Reactor Coolant Leak, Encl ML20210C1821999-07-22022 July 1999 Forwards Rept Providing Results of Insp of Eggcrate Tube Supports Done on Secondary Side of Sgs,Using Remote Controlled Visual Equipment ML20210B2451999-07-21021 July 1999 Forwards Response to NRC 990615 RAI Re GL 95-07, Pressure Locking & Thermal Bldg of SR Power-Operated Gate Valves, for Songs,Units 2 & 3 ML20210B9891999-07-20020 July 1999 Ack Receipt of Transmitting Plant Emergency Plan Implementing Procedure SO123-VIII-1, Recognition & Classification of Emergencies ML20209J5241999-07-19019 July 1999 Provides Clarification of Util Intentions Re Disposition of Systems for Which Exemption & TS Changes Were Requested in Licensee .Deferment of Action Re Hydrogen Monitors,Encl ML20210N2881999-07-19019 July 1999 Forwards Rev 61 to Physical Security Plan,Rev 21 to Safeguards Contingency Plan & Rev 20 to Security Force Training & Qualification Plan,Per 10CFR50.54(p),for Plant. Screening Criteria Forms Encl.Plans Withheld ML20210A2911999-07-19019 July 1999 Submits Withdrawal Request Submitted by Ltr Dtd 990312, Requesting NRC Approval of Revs to Physical Security Plan & Safeguards Contingency Plan Tactical Response Plan ML20209G3421999-07-15015 July 1999 Forwards Table of 16 Affected Tube Locations in SG E089, Discovered During Cycle 10 Outage Insp,Which Were Probably Not Examined by Bobbin During Cycle Outage Insp ML20209D8051999-07-12012 July 1999 Discusses Licensee Response to RAI Re GL 92-01,Rev 1,Suppl 1, Rc Structural Integrity, Issue on 950519 to Plant. NRC Revised Info in Reactor Vessel Integrity Database & Is Releasing It as Rvid Version 2 ML20209F5681999-07-0909 July 1999 Forwards Insp Repts 50-361/99-08 & 50-362/99-08 on 990516- 0626.One Violation Identified & Being Treated as Noncited Violation,Consistent with App C of Enforcement Policy ML20209C1571999-07-0202 July 1999 Forwards Response to NRC RAI Re SCE Submittal Dtd 980710,re GL 96-06, Assurance of Equipment Operability & Containment Integrity During Design-Basis Accident Conditions ML20196K6721999-07-0202 July 1999 Discusses 990628 Meeting Conducted in Region IV Office Re Status of San Onofre Nuclear Generating Station Emergency Preparedness Program.List of Attendees & Licensee Presentation Encl 1999-09-03
[Table view] Category:INCOMING CORRESPONDENCE
MONTHYEARML20217L9491999-10-21021 October 1999 Forwards SONGS Emergency Response Telephone Directory, for Oct-Dec 1999 ML20217K3571999-10-21021 October 1999 Discusses Use of SONGS as Generic Safety Issue 191 Ref Plant.Future Requests for Info & Addl Coordination Activities Be Handled Through D Evans of Organization.With Diskette ML20217K8541999-10-21021 October 1999 Forwards Revised Pages to ERDS Data Point Library,Per Requirements of 10CFR50,App E,Section VI.3.a.Described Unit 2 & 3 Changes for 2/3R7813 Were Completed on 990924 ML20217E3221999-10-13013 October 1999 Forwards MORs for Sept 1999 for Songs,Units 2 & 3.No Challenges Were Noted to Psvs for Either Units 2 or 3 ML20217E7671999-10-12012 October 1999 Forwards Rev 62 to NRC Approved Aug 1983, Physical Security Plan,Songs,Units 1,2 & 3, IAW 10CFR50.54(p).Changes,as Described in Encls 1 & 2,do Not Reduce Effectiveness of Plan.Encl Withheld,Per 10CFR73.21 ML20216H8741999-09-29029 September 1999 Provides Requested Written Response to GL 99-02, Lab Testing of Nuclear-Grade Activated Charcoal. Lab Testing of Charcoal Adsorber Samples for Creacus & Pacu Satisfies Listed Requirements ML20216H8541999-09-29029 September 1999 Submits Encl Request for Relief from ASME Code,Section III Requirements in 10CFR50.55(a)(3) to Use Mechanical Nozzle Seal Assembly as Alternate ASME Code Replacement at SONGS, Units 2 & 3 for Period of Operation Beginning with Cycle 11 ML20212H4461999-09-28028 September 1999 Forwards Suppl Info,As Discussed with NRC During 990812 Telcon,To Support Risk Informed Inservice Testing & GL 96-05, Periodic Verification of Design-Basis Capability of Safety-Related Movs ML20212G5611999-09-24024 September 1999 Informs NRC That SCE Remains Committed to Performing Eddy Current Examinations of 100% of Reactor Vessel Head Penetrations at Songs,Unit 3.Exams Will Not Be Performed During Cycle 11 RFO 05000361/LER-1999-005, Forwards 30-day follow-up LER 99-005-00,describing Loss of Physical Train Separation in Control Room.Any Actions Listed Intended to Ensure Continued Compliance with Existing Commitments1999-09-23023 September 1999 Forwards 30-day follow-up LER 99-005-00,describing Loss of Physical Train Separation in Control Room.Any Actions Listed Intended to Ensure Continued Compliance with Existing Commitments ML20212A4061999-09-14014 September 1999 Forwards Revised Pages to ERDS Data Point Library.Described Unit 2 Changes for 2R7817 & 2R7828 Were Completed on 990818 & Unit 3 Change for 3R7828 Was Completed on 990903 ML20216E6031999-09-10010 September 1999 Provides Response to NRC Administrative Ltr 99-03, Preparation & Scheduling of Operator Licensing Exams, Dtd 990820.Schedule Shown on Attachment 1, Operator Licensing Exam Data, Provides Util Best Estimate Through Cy 2003 05000206/LER-1999-001, Forwards LER 99-001-00 for Occurrence Re Unattended Security Weapon Inside Protected Area.Single Rept for Unit 1 Is Being Submitted,Iaw NUREG-1022,Rev 1,since Condition Involves Shared Sys & Is Applicable to Units 1,2 & 31999-08-31031 August 1999 Forwards LER 99-001-00 for Occurrence Re Unattended Security Weapon Inside Protected Area.Single Rept for Unit 1 Is Being Submitted,Iaw NUREG-1022,Rev 1,since Condition Involves Shared Sys & Is Applicable to Units 1,2 & 3 ML20210V4271999-08-16016 August 1999 Forwards Proprietary Certified Renewal Applications for SROs a Harkness,R Grabo & T Vogt & RO D Carter,Submitted on Facsimile Form NRC-398 & Certified NRC Form 396.Encls Withheld ML20210R6681999-08-13013 August 1999 Forwards Response to NRC RAI Re SCE License Amend Applications 173 & 159 for Songs,Units 2 & 3,proposed Change Number 485,which Requests Addition of SR to TS 3.3.9, CR Isolation Signal ML20210Q6451999-08-12012 August 1999 Forwards Monthly Operating Repts for July 1999 for SONGS, Units 2 & 3,per TS 5.7.1.4.There Were No Challenges to Pressurizer Safety Valves for Either Units ML20210P5711999-08-11011 August 1999 Forwards Amend Application Number 189 for License NPF-10 & Amend Application Number 174 to License NPF-15,replacing Analytical Limits Currently Specified as Acceptance Criteria with Allowable Values,Per Encl Calculation E4C-098 ML20210P4681999-08-11011 August 1999 Forwards COLR for Cycle 10 for Songs,Units 2 & 3,IAW TS Section 5.7.1.5.d, Colr. Changes to COLR Parameters Have Been Conducted IAW Approved COLR Methodologies & All Applicable Limits of Safety Analysis Were Met ML20210P6221999-08-10010 August 1999 Forwards Replacement Pages for Attachments E & F of Amend Application Numbers 168 & 154 for Songs,Units 2 & 3.Pages Are Provided to Correct Errors to Pagination & Headings in 970618 Submittal ML20210N5051999-08-0909 August 1999 Forwards Cycle 10 Update to TS Bases,Which Have Been Revised Between 980101-990630,per 10CFR50.71(e) 05000361/LER-1999-004, Forwards LER 99-004-00 Re Automatic Tgis Actuation.Event Affected Units 2 & 3 Equally Because Tgis Is Shared Sys. Single Rept Is Being Provided for Unit 2 IAW NUREG-1022, Rev 1.No New Commitments Are Contained in Encl1999-08-0606 August 1999 Forwards LER 99-004-00 Re Automatic Tgis Actuation.Event Affected Units 2 & 3 Equally Because Tgis Is Shared Sys. Single Rept Is Being Provided for Unit 2 IAW NUREG-1022, Rev 1.No New Commitments Are Contained in Encl ML20210L2311999-08-0505 August 1999 Forwards ISI Summary Rept,Including Owners Repts of Repairs & Replacements,For Songs,Unit 3.Rept Covers 970916 Through 990509,date Unit 3 Returned to Service Following Cycle 10 Refueling Outage ML20216D9671999-07-29029 July 1999 Provides Response to RAI to Support Proposed TS Change 460 Re Containment Isolation Valve Completion Time for SONGS, Units 2 & 3.Rev 3 to Abnormal Operating Instruction SO23-13-14, Reactor Coolant Leak, Encl ML20210C1821999-07-22022 July 1999 Forwards Rept Providing Results of Insp of Eggcrate Tube Supports Done on Secondary Side of Sgs,Using Remote Controlled Visual Equipment ML20210B2451999-07-21021 July 1999 Forwards Response to NRC 990615 RAI Re GL 95-07, Pressure Locking & Thermal Bldg of SR Power-Operated Gate Valves, for Songs,Units 2 & 3 ML20210A2911999-07-19019 July 1999 Submits Withdrawal Request Submitted by Ltr Dtd 990312, Requesting NRC Approval of Revs to Physical Security Plan & Safeguards Contingency Plan Tactical Response Plan ML20210N2881999-07-19019 July 1999 Forwards Rev 61 to Physical Security Plan,Rev 21 to Safeguards Contingency Plan & Rev 20 to Security Force Training & Qualification Plan,Per 10CFR50.54(p),for Plant. Screening Criteria Forms Encl.Plans Withheld ML20209J5241999-07-19019 July 1999 Provides Clarification of Util Intentions Re Disposition of Systems for Which Exemption & TS Changes Were Requested in Licensee .Deferment of Action Re Hydrogen Monitors,Encl ML20209G3421999-07-15015 July 1999 Forwards Table of 16 Affected Tube Locations in SG E089, Discovered During Cycle 10 Outage Insp,Which Were Probably Not Examined by Bobbin During Cycle Outage Insp ML20209C1571999-07-0202 July 1999 Forwards Response to NRC RAI Re SCE Submittal Dtd 980710,re GL 96-06, Assurance of Equipment Operability & Containment Integrity During Design-Basis Accident Conditions ML20210N9871999-07-0101 July 1999 Appeals Denial of Documents Re Sept 1996 Osre for San Onofre Nuclear Generating Station.Requests Copies of Sept 1996 Osre Rept & Any More Recent Osre Repts ML20209B3571999-06-28028 June 1999 Submits Response to GL 98-01,Suppl 1 Y2K Readiness of Computer Sys at Nuclear Power Plants. GL 98-01 Requested Response on Status of Facility Y2K Readiness by 990701. Disclosure Encl ML20209B4831999-06-25025 June 1999 Requests NRC Approval of Six Relief Requests from ASME Code Requirement for Containment ISI Exams.Six Relief Requests, Provided as Enclosures 1-6,are as Listed ML20196A9801999-06-17017 June 1999 Responds to NRC 990420 RAI Re Proposed risk-informed Inservice Testing & GL 96-05 Programs at Songs,Units 2 & 3. Revised Pages to risk-informed Inservice Testing Program, Encl ML20195G8091999-06-14014 June 1999 Forwards Response to RAI Made During 990511 Telcon Re LARs 184 & 170 for SONGS Units 2 & 3.Amend Applications Proposed Restriction on Operation with Channel of RAS or Efas in Tripped Condition ML20195K4201999-06-11011 June 1999 Forwards LERs 99-003-00 & 99-004-00 Re Manual Esfas (Reactor Trips) Due to Problems with Main Feedwater Control.Two Events Are Being Reported Separately Because Actual Causes Are Considered Different & Independent of Each Other ML20195H1561999-06-10010 June 1999 Forwards MORs for May 1999 for Songs,Units 2 & 3.There Were No Challenges to Pressurizer Safety Valves for Either Unit 2 & 3 ML20195E4981999-06-0808 June 1999 Forwards Application for Amends 188 & 173 to Licenses NPF-10 & NPF-15 for SONGS Units 2 & 3,respectively.Amends Would Revise TS 3.5.2,3.1.9,3.7.1 & 5.1.7.5 Re Small Break LOCA Charging Flow & Main Steam Safety Valve Setpoints ML20196L3191999-05-24024 May 1999 Forwards ISI Summary Rept,Including Owners Repts of Repairs & Replacements for Songs,Unit 2.Rept Covers Period of 970916-990226 ML20207A3831999-05-24024 May 1999 Responds to NRC 990326 RAI on DG Srs.Proposed to Add Listed Sentence to TS Bases for SRs 3.8.1.7,3.8.1.12 & 3.8.1.15,as Result of Discussion with NRC During 990427 Telcon ML20211K4261999-05-18018 May 1999 FOIA Request for Documents Re San Onofre OI Repts 4-98-041, 4-98-043 & 4-98-045 ML20206S7161999-05-17017 May 1999 Forwards MORs for Apr 1999 for Songs,Units 2 & 3.There Were No Challenges to Pressurizer Safety Valves for Either Unit 2 or 3 ML20206N4711999-05-13013 May 1999 Provides Info Requested by NRC Re Reduced Pressurizer Water Vol Change Amends Application 172 & 158 for Songs,Units 2 & 3,respectively.Proposed Change Will Reduce Pressurizer Water Level Required for Operability ML20206M7791999-05-13013 May 1999 Informs NRC of Changes Being Made to Emergency Response Data Sys (ERDS) at SONGS Unit 3.Revised Page to ERDS Data Point Library Is Provided in Encl ML20206K6891999-05-11011 May 1999 Forwards Approved Amends to NPDES Permits CA0108073,Order 94-49 & CA0108181,Order 94-50 & State Water Resources Board Resolution ML20206M0681999-05-10010 May 1999 Submits Correction to Info Contained in Licensee to NRC Re Proposed TS Change Number NPF-10/15-475.Stated Info Was Incorrect in That Overtime Provisions Were Not Contained in TR at Time of Was Submitted ML20206H0451999-05-0404 May 1999 Forwards Annual Financial Repts for Listed Licensees of Songs,Units 1,2 & 3.Each Rept Includes Appropriate Certified Financial Statement Required by 10CFR50.71(b) ML20206H1931999-05-0303 May 1999 Forwards 1998 Annual Rept, for SONGS Units 2 & 3 & PVNGS Units 1,2 & 3.SCEs Form 10K Annual Rept to Securites & Exchange Commission for Fiscal Yr Ending 981231,encl ML20206C5151999-04-29029 April 1999 Forwards 1998 Radiological Environ Operating Rept for Songs,Units 1,2 & 3. Annual Radiological Environ Operating Rept Covers Operation of Songs,Units 1,2 & 3 During CY98 & Includes Summaries Interpretations & Analysis of Trends ML20206E5851999-04-29029 April 1999 Forwards Annual Radioactive Effluent Release Rept for 1998 for SONGS Units 1,2 & 3. Also Encl Are Rev 13 to Unit 1 ODCM & Rev 31 to Units 2 & 3 Odcm 1999-09-29
[Table view] Category:PUBLIC ENTITY/CITIZEN/ORGANIZATION/MEDIA TO NRC
MONTHYEARML20056A6211990-07-0606 July 1990 Forwards Preexam & post-exam Security Agreement ML20206F0991988-09-27027 September 1988 FOIA Request for Documents Re Drug Use & Distribution, Alcohol Use or Fitness for Duty Issues at Util ML20245C9351987-07-0909 July 1987 FOIA Request for Documents & All Records Generated in Connection W/All NRC Insps or Investigations on Allegations Raised by L Penzes from 1983 to Present Re San Onofre Seismic Design ML20236C4021986-06-30030 June 1986 FOIA Request for Documents Re NRC Investigation Into Alleged Drug Activity at Plant ML20141N3161986-01-14014 January 1986 FOIA Request for R Jackson to R Vollmer Re Diablo Canyon Hearing Reopening & San Onofre Review Status ML20133Q2471985-06-13013 June 1985 FOIA Request for Documents Re Performance Appraisal Team Insp Conducted at Facility Starting Wk of 850301 & Info on Fire Protection Deficiencies ML20111B8171985-03-0606 March 1985 Requests That Commissioners Appoint ASLB Member to Review, Investigate & Issue Findings on NRC Mgt of Ee Kent Allegations.Evidence Suggests Investigation Deliberately Narrowed in Scope ML20126G8451985-02-21021 February 1985 FOIA Request for Documents Re 1982 Order Requiring 0.67g Seismic Design Std & 1984 Order Allowing Restart,Including Applications for Amends to Const Permit,Ol,Psar & FSAR & Facility Seismic Design Deficiency Repts ML20126G7531984-11-28028 November 1984 FOIA Request for Documents Re Restart Prior to 100% Completion of Seismic Upgrades ML20136J3341984-11-20020 November 1984 Submits View Re Possible Restart of Facility Prior to Completion of Seismic Design Improvements Required by NRC 820811 Order ML20091C8911983-07-20020 July 1983 Advises of Technical Inadequacies in safety-related Piping Sys & Other Incidents at Facility ML20081B5781983-06-29029 June 1983 FOIA Request for AEOD Rept, Loss of Shutdown Cooling & Subsequent Boron Dilution at San Onofre 2, & Info Re Fuel Rod Degradation Problem Described in IE Info Notice 82-27 ML20077F3151983-06-22022 June 1983 Forwards Govt Accountability Project (Gap) Rept of Gap Investigation Into Region V/Nrr Effort on Former Bechtel Employee Allegations Re Welding Practices ML20078N7231982-09-0606 September 1982 Comments on Developments in Investigations of Allegations. Opportunity to Submit Input & Initiation of Investigative Effort Requested ML20041F1011982-03-0404 March 1982 Forwards Corrections to Intervenor 820226 Brief in Support of Exceptions to ASLB 820111 Partial Initial Decision.W/O Encl.Certificate of Svc Encl ML20040H1691982-02-0808 February 1982 Opposes Licensing of Facilities ML20040D6681982-01-21021 January 1982 Comments Opposing Use of Nuclear Power.Supportive Articles Encl ML20040A4221982-01-16016 January 1982 Requests Delay in Facility Licensing Until Proper Evacuation Plan Is Developed & Earthquake Incidence Resolved ML20040A4241982-01-15015 January 1982 Opposes Licensing of Facilities Due to Ongoing Investigation Into Evacuation Plans & Earthquake Safety ML20040A5811982-01-15015 January 1982 Opposes Licensing of Facilities ML20040H1681982-01-12012 January 1982 Opposes Licensing of Facilities ML20040A8661982-01-12012 January 1982 Opposes Licensing of Unit 2 ML20039D1381981-12-28028 December 1981 Package of Two Comments Opposing Low Power Test Licenses for Facilities ML20039E4061981-12-26026 December 1981 Opposes Licensing of Unit 2 ML20039D1421981-12-23023 December 1981 Requests Independent Investigation of Facilities Prior to Licensing & Congressional Hearing ML20039D1521981-12-18018 December 1981 Opposes Licensing Facilities ML20039D1531981-12-15015 December 1981 Requests Independent Review of Facility Prior to Issuance of Low Power Test Permit ML20038C2051981-12-0303 December 1981 Requests Independent QA Audit of Facilities ML20038C1991981-12-0101 December 1981 Requests Evacuation Plans Be Made Before Plant Testing ML20038B6211981-11-22022 November 1981 Opposes Licensing of Facilities ML20010D5371981-08-20020 August 1981 Submits Resolution Supporting Issuance of OL & Continued Development of Alternate Energy Sources ML20010C5381981-08-18018 August 1981 Supports Licensing of Facilities ML20010C5371981-08-17017 August 1981 Petition Opposing Licensing of Facilities ML20010E0121981-08-0606 August 1981 Forwards Resolution Supporting Facility Licensing.W/O Encl ML20009H5131981-08-0505 August 1981 Package of Eight Ltrs Supporting Licensing of Facilities ML20009H2131981-08-0404 August 1981 Supports Licensing of Facilities ML20009H2911981-08-0404 August 1981 Package of 12 Ltrs Supporting Licensing of Facilities ML20009G9271981-08-0303 August 1981 Package of Twelve Ltrs Supporting Licensing of Facilities ML20009G9251981-07-31031 July 1981 Supports Licensing of Facilities ML20009G9291981-07-30030 July 1981 Supports Licensing of Facilities ML20009G8321981-07-27027 July 1981 Forwards Paper Re Facility Security to Be Presented at 810729 Licensing Hearing ML20009G9481981-07-21021 July 1981 Opposes Licensing of Facilities ML20009E0491981-07-21021 July 1981 Opposes Licensing of Facilities ML20009A8751981-07-0909 July 1981 Requests to Make Limited Appearance Statement at 810711 OL Hearings ML20009A4601981-07-0808 July 1981 Requests to Make Limited Appearance Statement at 810711 OL Hearings ML20009A4541981-06-30030 June 1981 Requests to Make Limited Appearance Statement at 810711 OL Hearings ML20009A9361981-06-30030 June 1981 Requests to Make Limited Appearance Statement at 810711 OL Hearings ML20126L7491981-05-29029 May 1981 Requests to Make Limited Appearance Statement at Seismic Hearing ML20126L7331981-05-28028 May 1981 Requests to Make Limited Appearance Statement at 810615 Seismic Hearing ML20004D0821981-05-28028 May 1981 Requests to Make Limited Appearance Statement at 810615 Seismic Hearing 1990-07-06
[Table view] |
Text
p 7' q 0- s ,
)
=)
9, f'..
L RECEIVED NRC REGION V auly 6, 1990 :
I??0 JJL 10 /JI B 54 i Michael J. Royack- '
USNRC Region V ;
1450 Marie Lane Suite 210 Walnut Creek, Ca. 94596 i:
- Mr. Michael J. Royack
=
r.
Enclosed are the Pre-Examination and Post-Examination Security Agreement.
Donald Miller
.c 4
t t
9008080342 900706 PDR ADOCK 0500 361 i1 2 7- %
crm
, Rev 6 06/01/90
[ ATTACHMENT 1 (continued) l Enclosure 4
' REQUIREMENTS FOR FACILITY REVIEW OF WRITTEN EXAMINATIONS
('
- 1. At the option of the Chief Examiner, the facility may review the written examination up to two weeks prior to its administration. This review may take place at the facility or in the Regional office. The review will be conducted using the same material sent to the NRC for exam generation pur-poses. The Chief Examiner will coordinate the details of the review with the facility. An NRC examiner will always be available during the review.
4 Whenever this option of examination review is utilized, the facility re- .
viewers will sign the following statement prior to being allowed access to the examination. The examination or written notes will not be retained by the facility.
L
- a. Pre-Examination Security Agreement >
I Muy/M A84/ acknowledge that I have acquired sp##0 ecialized knowledge concerning the examination scheduled for /M at L rwc p'n , t' id as of the date of my signature below. I agree ,
I that I will not knowingly divulge any information concerning this l examination to any unauthorized persons. I understand that I am not to participate in any instruction involving those applicants scheduled >
to be administered the above examination from this date until after the examination has been administered. I further understand that ;
violation of the conditions of this agreement may result in the exam-ination being cancelled and/or enforcement action against myself or (C the facility licensee by whom I am employed or represent, i
/Y$hA55b '56 9 l Signature /Date '
In addition, the facility staff reviewers will sign the following statement after the written examination has been administered,
- b. Post-Examination Security Agreement I did not, to the best of my knowledge, divulge any information concerning the examinations administered during the week of at to any unauthorized persons. I did not participate in providing any instruction to those applicants who were administered the examination from the date I en-tered into this security agreement until the completion of examination administration.
Signature /Date {
Examiner Standardc 16 of 17
07/02/1990 11:22 REACTOR SW ETY t PROJ R5 415 943 T 55 P.02 Rev 6 06/01/90 ATTACHMENT I (continued)
Enclosure 4 REQUIREMENTS FOR FAC!t.!TY REVIEW OF WRITTEN EXAMINATIONS
(.
- 1. AttheoptionoftheChiefExamir.er,thefacilitymayreviewthewritken elamination up to two weeks prior to its administration. This review may take p) ace at the facility or in the Regional office. The review will be f;onducted using the same material sent to the NRC for exam generation pur-loses. The Chief Examiner will coordinate the details of the review with the facility. An NRC examiner will always be available during the review.
Whenever this option of examination review is utilized, the facility re-viewers will sign the following statement prior to being allowed access to the examination. The examination or written notes will not be retained by the facility.- -
- a. Pre-Examination Security Agreement I bruM t : Mf/ acknowledge that I have acquired specialized knowleoge concerning the examination scheduled for M - W $'O at w s ._ /A / W as of the date of my signature below. ~ T agree -
that 1 will not knowingly divulge any information concerning this A ,s am ( n a t. 4 nn en map v. e n e b e =J a + si ps.=eena.
- 3. r.d e *e4 .eJ 4 f .. b B e.m .. .w t " * *
- to participate in any instruction involving those applicants scheduled to be administered the above examination from this date until after the examination has been administered. I further understand that E
violation of the conditions of this agreement may result in the exam-ination being cancelled and/or enforcement action against myself or (A
the facility licensee by whom I am employed or represent.
?W)$b Signal.ure/Date '
k ff In addition, the facility staff reviewers will sign the following statement after the written examination has been administered,
- b. Post Examination Security Agr u ent '
I X M _
did not, to the best of my knowledge, divulge thy information concerning the examinations administered during the week of 44$/o at H 9/fd to any unauthorized persons. I did not participate in pFoviding any instruction to those
- applicants who were administered the examination from the date I en-tered into this security agreement until the completion of examination administration.
t i
4VhYh Signature /Date Wbk0
{
Examiner Standards 16 of 17
. _ _ _ _ . . , m. - . . - . , - .,,-m.
co cus Rev 6 06/01/90 ATTACHMENT 1 (continued)
Enclosure 4 REQUIREMENTS FOR FACILITY REVIEW OF WRITTEN EXAMINATIONS
(
- 1. At the option of the Chief Examiner, the facility may review the written examination up to two weeks prior to its administration. This review may take place at the facility or in the Regional office. The review will be conducted using the same material sent to the NRC for exam generation pur-poses. The Chief Examiner will coordinate the details of the review with the facility. An NRC examiner will always be available during the review, Whtnever this option of examinatien review is utilized, the facility re- ,
vievers will sign the following statement prior to being allowed access 1 to the examinatio' The examination or written notes will not be retained by tt.e facility.
j- a. Pre-rxamination Security Agreement I t \sv e\ EE\C sQb acknowledge that I have acquired ppecialized :
knowledge egncerning the examination scheduled for b A%190 at !
Sc3:4Gs N9 as of the date of my signature below. I agree !
j that I will not knowingly divulge any information concerning this
! examination to any unauthorized persons. I understand that I am not to participate in any instruction involving those applicants scheduled to be administered the above examination-from this date until after
- the-examination has been administered. I further understand that l- violation of the conditions of this agreement may result in the exam-ination being cancelled and/or enforcement action against myself or (A i the facility licensee by whom I am employed or represent. !
Signature /Date
)? /
Lk%
I
- t. In addition, the facility staff reviewers will sign the following statement after the written examination has been administered.
i 4
L b. Post-Examination Security Agreement l
I did not, to the best of my knowledge, divulge any information concerning the examinations administered during the week of at to any unauthorized persons. I did not participate in providing any instruction to those atplicants who were administered the examination from the date I en- I tered into this security agreement until the completion of examination j administration, i
V __ ,
Signature /Date (- l Examiner Standards 16 of 17 !
i I
-- _ _ . . - l___--___-_-____----__-__.____
07/02/1990 11:23 R i.CTOR St.fETY & FPOJ R5 4159433755,[.,0,3 Rev 6 06/01/90 i.
ATTACHMENT 1*(continued)
Enclosure 4 REQUIREMENTS FOR FACILITY REVIEW OF WRITTEN EXAMINATIONS
(
- 1. At the' option of the chief Examiner, the facility may review the written examination up to two weeks prior to its administration. This review may take place at the facility or in the Regional office. The review will be conducted using the same material sent to the NRC for exam generation pur-poses.
The Chief Examiner will coordinate the details of the review with the facility. An NRC examiner will always be available during the review.
Whenever this option of examination review is utilized, the facility re-viewers will sign the following statement prior to being allowed access to the examination. The examination or written notes will not be retained by the facility. ~
- a. Pre-Examination Security Agreement I Chud. Q\M acknowledge that I have acquired $pecialized knowledge cgncerning the examination scheduled for A DN *. o at ioso.A N1
~
as of the date of my signature below. I agree that I will not knowingly divulge any information concerning this examination to any unauthorized persons. l understand that I am not to participate in any instruction involving those applicants scheduled to be administered the above examination from this date until after
'the examination has been administered. I further understand that violation of the conditions of this agreement may result in the exam-ination being cancelled and/or enforcement action against myself or (A the facility licensee by whom I am employed or represent.
Signature /Date 'O he
In' addition, the facility staff reviewers will sign the following statement after the written examination has been administered.
- b. Post Examination Security Agreement IChud T.Tho did not, to the best of my knowledge, divulge any information concerning the examinatjens administered during the week of T u m as, M *n o at _.SoM S W3 to any unauthorized persons. I d'd not participate in providing any instruction to those applicants who were administered the examination from the date ! en-tered into this security agreement until the completion of examination administration.
Signature /Date ~~
Examiner Standards
{
16 of 17
{
TOTAL P.03
, ES-201 Rev 5 01/01/89 ATTACHMENT 2 (continued) -
Enclosure 4 REQUIREMENTS FOR FACILITY REVIEW 0F WRITTEN EXAMINATIONS
- 1. At the option of the Chief Examiner, the facility may review the written examination up to two weeks prior to its administration. This review may take place at the facility or in the Regional office. The Chief Examiner will coordinate the details of the review with the facility. An NRC examiner will always be present during the review.
Whenever this option of examination review is utilized, the facility ,
reviewers will sign the following statement prior to being allowed access to the examination. The examination or written notes will not by ratained "
by the facility. -
t
- a. Pre-Examination Security Agreement '
Iel A UNnh agree that I will not knowin information concernipg the replacement (or initial) examination gly divulge any-scheduled for __b\v.N to any unauthorized persons. I understand that I am not to participate in any instruction involving those reactor operator or senior reactor operator applicants
, scheduled to be administered the above replacement (or initial) examination from now until after the examination has been [
administered. I understand that violation of this security agreement could result in the examination being voided,
(
- [>--- E Mko Signature /Date l
In addition, the facility staff reviewers will sign the following
. statement after 'he written examination has been administered,
- b. Post-Examination Security Agreement L I tb 1 E d.M did not, to the best of knowledge, divulgeanyinformytionconcerningthewrittenexamination administered on W w h o to any unauthorized persons. I did not participate' in providing any instruction to those reactor operator and senior reactor operator applicants who were administered the examination from the time that I was allowed access to the l
examination.
l C
Signature /Date b abo l
Examiner Standards 16 of 18
\
ES-302 I Rev 5 01/01/89 l Attachment 2
- Pre-Examination Security Agreement >
I d o e_k 7 \\(.,% agree that I will not knowingly divulge any information concerning the operating tests scheduled for b b% - G'il \AS c to any unauthorized persons. I understand that I .am not to' participdte in any instruction involving those reactor operator or senior reactor operator applicants scheduled to be administered the above operating test from now until after the examination has been administered.
6 [*go Signature /Date Post-Examination Security Agreement I h vek. E_Mi.% did not, to the best of my knowledge, divulge any information concerning the operating tests administered on dsdge to any unauthorized persons. I did not participate in providing any~ instruction to those reactor operator and senior reactor operator applicants who were ;
administered the operating test from the time I was allowed access to the operating test.
(g L
~ kSia:'ture/Date T > - - (3 ok 9c '
4 L
Examiner Standards 9 of 9
7 ..
ES-302
"" 5 ' '89 me sm Attachment 2 -
Pre-Examination Security Agreement I- )lxiNG -
Af2DE67V agree that I will not knowingly divulge any iniormation concerning the operating tests scheduled for (J hg Tur>o 6facd 90 I to any unauthorized persons. I understand that I.am not'to' participate in any instruction involving those reactor operator or senior reactor operator applicants scheduled to be administered the above operating test from now until after the examination has been administered. 1 a
/1
/ hR Signature /DagA(
- b. !D Nsy j l Post-Examination Se;urity Agreement 13sm /drMah did not, tc. the best of my knowledge, divulge.any -
information concerning the operating tests administered on 4/e## -to any 1 unauthorized persons. I did not participate in providing any ~ instruction to
.those reactor operator and senior reacto* operator applicants who were administered the operating test from the time I was allowed access to the operattnga test.
(g l
Signature /Date 1
)
I i
l l .
l 1*
1 L Examiner Standards 9 of 9 I
w ES-302 Rev 5 01/01/89
. c nce. w m A Attachment 2 -
l Pre-Examination Security Agreement I )l v.iN; nRDE6T'i inf ormation concerning the agree thattests I willscheduled not knowingly for c',divulge hg Tueoany 6laed90 -
operating to any unauthorized persons. I understand that I.am not'to' participate in any instruction involving those reactor operator or senior reactor operator applicants' scheduled to be administered the above operating test from now '
until after the examination has been administered.
f'xsy . l hp Y f l
Signature /Da g A( t Post-Examination Security Agreement I N o,e /drAh did not, to the best of my knowledge, divulge any information concerning the operating tests administered on 4/ev/0 to any unauthorized persons. I did not participate in provitling any~ instruction to those reactor operator and senior reactor operator applicants who were administered the operating test from the time I was allowe d sccess to the operating
1 C
i Signature /Jate i
L Examiner Standards 9 o'f 9 9
i
~
{
l c5mvi mm wcouw c ES-302 Rev 5 01/01/89 ;
Attachment 2 -
Pre-Examination Security Agreement I N////en 5%'wnSou agree that I will not knowingly divulge any
^ information concerning the o TuPo 6 faq .90 to any unauthorized persons.perating tests scheduled I understand for _to'sh9 that I .am not' participate in any 1
instruction involving those reactor operator or senior reactor operator ]
applicants scheduled to be administered the above operating test from now ,
j until after the examination has been administered. l
,e*
,/ } } {W' h/-)#
Signature /Date Post-Examination Security Agreement I did not, to the best of my knowledge, divulge any information concerning the operating tests administered on to any unauthorized persons. I did not participate in providing any' instruction to those reactor operator and senior reactor operator applicants who were administered the operating test from the time I was allowed access to the operating test.
( ,
Signature /Date 1
Examiner Standards 9 of 9 l
F -
\
i ES-302 csinot enc + eit--t Rev 5 01/01/89 Attachment 2 ~ -
j 1
Pre-Examination Security Agreement ;
.I y %///em. 5 /e wn:c & agree that I will not knowingly divulge any information concerning the operating tests scheduled for <!, h g rwed 4fa%k90 i to any unauthorized persons, I understand that I am not to' participate in any instruction involving those reactor operator or senior reactor operator applicants scheduled to be administered the above operating test from now .
until af ter the examination has been administered. I s
h, lf f ' $~l-) #
Signature /Date '
Post-Examination Security Agreeteret I U.'/b Jbe45c+ did not, to the best of my l.nowledge, divulge any information concernin to any unauthorized persons.g the operating tests administered on vd-//dI did not partic those reactor operator and senior reactor operator applicants who were administered the operating test from the time I was allowed access to the operating test.
h h & }2-2~}d.
" SignKture7Date - <
Examiner Standards- 9 of 9
m . - ._. _ . .. . _ . _
)
ES-302 !
Rev 5 01/01/89 )
Attachment 2 Pre-Examination Security Agreement l I Svva//d N &x._. agree that I will not knowingly divul e any information concerning the operating tests scheduled for 6 h6 9- G b / O/90 to any unauthori2rd persons. I understand that I .am not to participate in 'any instruction involving those reactor operator or senior reactor operator applicants scheduled to be administered the above operating test from now :
~until after the examination has been administered. ,
~l5 gnhh is-/R40
'ure/Date Post-Examination Security Agreement I Maso /7//dur" e any :
information cohcerning didnot,tothebestofmyknowledge,divylp/0 the operating tests administered on V4 to any unauthorized persons. I did not participate in providing any instruction to those reactor operator and senior reactor operator applicants who were ,
administered the operating test from the time I was allowed access to the operating test, ]t C.) 1 h
Si nhture/Date
&-t9-90
. v ;
i
,i I
O-
~!
s Examiner Standards 9 of 9
~ ._ _ - _ _____ . . . -- .. . . .
\
r . ES-302
' 'M ** Rev 5 01/01/89 ;
Attachment 2 -
L ;
Pre-Examination Security Agreement I fhce- 1 bio agree that I will not knowingly divulge any information concerning the operating tests scheduled for (!,h9- TW 4> facd 90 to any unauthorized persons. I understand t.nat I.am not'to' participate in any instruction involving those reactor operator or senior reactor operator- ,
applicants scheduled to he administered the above operating test from now j until after the examination has been administered. ;
< fo Signature /Date Post-Examination Security Agreement 1 I d v / , /,o did not, to the best of my knowledge, div 1g any information concerning the operating tests administered on 4 / /0 to any
. unauthorized persons. I did not participate in providing any instruction to i those reactor operator and senior reactor operator applicants who were ;
administered the operating test from the time I was allowed access to the j operating
lg '
7C.h Signature /Date mV1a
~
l 1
l-L Examiner Standards 9 o'f 9
ES-201 Rev 5 01/01/89 (I ) '
ATTACHMENT 2 (continued) - .-
Enclosure 4 REQUIREMENTS FOR FACILITY REVIEW 0F WRITTEN EXAMINATIONS
- 1. At the option of the Chief Examiner, the facility may review the written -
examination up to two weeks prior to its administration. This review may !
take place at the facility or in the Region 31 office. The Chief Examiner j will coordinate the details of the review with the facility. An NRC )
examiner will always be present during the review.
Whenever this option of examination review is utilized, the facility reviewers will sign the following statement prior to being allowed access to the examination. The examination or written notes will not by retained by the facility,
- a. Pre-Examination Security Agreement i
I AuvW/' M## agree that I will not knowin information concerning scheduled for 4/ Nfo the) toreplacement (or on examinat initial) gly divul any unauthorized persons.
I understand that I am not to participate in any instruction involving those reactor operator or senior reactor operator applicants scheduled to be administered the above replacement (or initial) examination from now until after the examination has been administered. I understand that viol' tion of this security agreement could result in the examination being voided. ;
< t
+
N)WN$D Signature /Date sYo :
In addition, che facility staff reviewers will sign the following statement after the written examination has been administered. ,
- b. ' Post-Examination Security Agreement l' I 42'Wh did not, to the best of knowledge, L divulge (any information congerning the written examination i
administered on 4Ar/f0 to any unauthorized persons. I L
did not participate in providing any instruction to those reactor operator and senior reactor operator applicants who were administered the examination from the time that I was allowed access to the examination.
l MWdb A/Sf/fd l Signature /Date l
Examiner Standards 16 of 18 .
- -- ~-
^
~
I ES-302
'd '** * *p, A' Rev 5 01/01/89
. or Attachment 2 -
Pre-Examination Security Agreement I # M /t. E nom E. agree that I will not knowingly divulge any information concerning the operating tests scheduled for i, h9 Twed (>laed 90 to any unauthorized persons. I understand that I.am not'to' participate in any Instruction involving those reactor operator or senior reactor gerator applicants scheduled to be administered the above operating test from now until after the examination has been administered.
0%'1m nd /. 10 5ignature/Date Post-Examination Security Agreement ,
I /[W V Nova E did not, to the best of my knowledge, divulgg any information concerning the operating tests administered on fd//// to any.
unauthorized persons. I did not participate in providing any instruction to those reactor operator and senior reactor operator applicants who were administered the operating test from the time I was allowed access to the operati ng
W WA C 9 70 Signature /Date ;
{
i l-1 l
l lI 9 of 9 Examiner Standards
i.
h: .
ES-302 Rev 5 01/01/89 Attachment 2 Pre-Examination Security Agreement
.I J'1 9 43/ &I#)r agree that I will not knowingly divulge
.. inTormation concerning the o to any unauthorized persons.perating. tests scheduled yp (/M / N for to participate in any I understand that I.am not instruction involving those reactor operator or senior reactor operator .
applicants scheduled to be administered the above operating test from now-until after the examination has been administered.
f6WhSignature /DateSYU
/
Post-Examination Security Agreement:
I.dt!"Jd/h information concernin d d not, to the best of my knowledge, divulge any unauthorized persons.gI V /////// to any dideperating tests administered not participate in providing onany instruction to-those reactor operator and senior reactor operator applicants who were administered the operating test from the time I was allowed access to the operating test.
<:6k"AAd& //b//he *
, ' Signature /Date 9
i
- Examiner Standards 9 of 9
~ ~
If-J +
s _,..
4 i.,
.- 9-
+-
ES-302-Rev 5 01/01/89 sM -C Attachment 2 ,
- pre-Examination Security Agreement I- Knnv f H /4 j information concerning theagree that Itests will. scheduled not knowingly divulge any 6. f.M t 90 -
operating for' (!,h9 Tweo-to any unauthorized persons. I' understand that I..am not'to' participate -in any
. instruction' involving those reactor operator or senior reactor operator applicants scheduled to be administered the-above operating test-from now until af ter. the examination has been administered '
_jlf e ,, C/l/TO Signatur#Date Post-Examination Security Agreement ,
- l. ,.
I' /A MI (Mv' did not, to the best of my' knowledge, divulg#0 e any information concerning the operating tests administered on' 44// to any unauthorized persons. I did not participate in providing any instruction to
- i. those reactor operator and senior reactor operator applicants who_were. . ,
administered the operating test from the time I was allowed accessito the.
operating
m C '
A% C/19/Tf)~
(
l SignaturefDate '
h l
t t H 7 L
,= .
.i l\ ,
o r
l.
o t
l Examiner Standards 9$f9 7 3 :